Biological Process
stringlengths
7
1.01k
Cellular Component
stringlengths
6
867
Molecular Function
stringlengths
11
871
Organism
stringlengths
8
73
Keywords
stringlengths
1
810
Sequence 10
stringlengths
5
10
Sequence
stringlengths
5
1.02k
Combined
stringlengths
136
3.91k
oocyte growth protein tetramerization protein-containing complex assembly purine nucleobase metabolic process response to virus retinol metabolic process thyroid hormone transport
clathrin-coated vesicle; extracellular space; protein-containing complex; yolk
hormone activity hormone binding protein domain specific binding protein heterodimerization activity small molecule binding thyroid hormone binding
Gallus gallus
3D-structure Direct protein sequencing Hormone Reference proteome Secreted Signal Sulfation Thyroid hormone Transport
MAFHSTLLVF
MAFHSTLLVFLAGLVFLSEAAPLVSHGSVDSKCPLMVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATGKTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLGLSPFHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAVVSDPQE
oocyte growth protein tetramerization protein-containing complex assembly purine nucleobase metabolic process response to virus retinol metabolic process thyroid hormone transport clathrin-coated vesicle; extracellular space; protein-containing complex; yolk hormone activity hormone binding protein domain specific bind...
membrane fusion involved in viral entry into host cell viral entry into host cell virion attachment to host cell
host cell endosome membrane; host cell plasma membrane; membrane; viral envelope; virion membrane
structural molecule activity
Simian immunodeficiency virus agm.vervet
Apoptosis Cleavage on pair of basic residues Coiled coil Disulfide bond Fusion of virus membrane with host membrane Glycoprotein Host cell membrane Host endosome Host membrane Host-virus interaction Membrane Signal Transmembrane Transmembrane helix Viral attachment to host cell Viral envelope protein Viral penetration ...
MTKFLGIFIV
MTKFLGIFIVLGIGIGIGISTKQQWITVFYGVPVWKNSSVQAFCMTPTTRLWATTNCIPDDHDYTEVPLNITEPFEAWADRNPLVAQAGSNIHLLFEQTLKPCVKLSPLCIKMNCVELKGSATSTPATSTTAGTKLPCVRNKTDSNLQSCNDTIIEKEMNDEAASNCTFAMAGYIRDQKKNYSVVWNDAEIFCKRSTSHNGTKECYMIHCNDSVIKEACDKTYWDELRLRYCAPAGYALLKCNDWDYAGFKPECSNVSVVHCTTLMNTTVTTGLLLNGSYSENRTQIWQKHGVSNDSVLILLNKHYNLTVTCKRPGNKTV...
membrane fusion involved in viral entry into host cell viral entry into host cell virion attachment to host cell host cell endosome membrane; host cell plasma membrane; membrane; viral envelope; virion membrane structural molecule activity Simian immunodeficiency virus agm.vervet Apoptosis Cleavage on pair of basic r...
adaptive immune response cellular response to interleukin-7 cellular response to vitamin D extrinsic apoptotic signaling pathway peptide antigen assembly with MHC class I protein complex platelet aggregation positive regulation of extrinsic apoptotic signaling pathway positive regulation of protein folding protein fold...
acrosomal vesicle; apical plasma membrane; cell surface; endoplasmic reticulum; endoplasmic reticulum lumen; extracellular region; extracellular space; melanosome; MHC class I peptide loading complex; myelin sheath; smooth endoplasmic reticulum; TAP complex; Tapasin-ERp57 complex
identical protein binding MHC class I protein binding peptidase activity protein disulfide isomerase activity protein-disulfide reductase (glutathione) activity protein-disulfide reductase activity
Mus musculus
Acetylation Adaptive immunity Direct protein sequencing Disulfide bond Endoplasmic reticulum Immunity Isomerase Methylation Phosphoprotein Redox-active center Reference proteome Repeat Signal
MRFSCLALLP
MRFSCLALLPGVALLLASARLAAASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVGFFRDLFSDGHSEFLKAASNLRDNYRFAHTNIESLVKEYDDNGEGITIFRPLHLANKFEDKTVAYTEKKMTSGKIKKFIQDSIFGLCPHMTEDNKDLIQGKDLLTAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTT...
adaptive immune response cellular response to interleukin-7 cellular response to vitamin D extrinsic apoptotic signaling pathway peptide antigen assembly with MHC class I protein complex platelet aggregation positive regulation of extrinsic apoptotic signaling pathway positive regulation of protein folding protein fold...
cell chemotaxis cellular response to interleukin-1 cellular response to tumor necrosis factor cellular response to type II interferon chemokine-mediated signaling pathway eosinophil chemotaxis G protein-coupled receptor signaling pathway inflammatory response lymphocyte chemotaxis monocyte chemotaxis neutrophil chemota...
extracellular space
CCR chemokine receptor binding CCR1 chemokine receptor binding chemoattractant activity chemokine activity
Mus musculus
Chemotaxis Cytokine Disulfide bond Reference proteome Secreted Signal
MRNSKTAISF
MRNSKTAISFFILVAVLGSQAGLIQEMEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA
cell chemotaxis cellular response to interleukin-1 cellular response to tumor necrosis factor cellular response to type II interferon chemokine-mediated signaling pathway eosinophil chemotaxis G protein-coupled receptor signaling pathway inflammatory response lymphocyte chemotaxis monocyte chemotaxis neutrophil chemota...
glucocorticoid biosynthetic process hormone biosynthetic process positive regulation of steroid hormone biosynthetic process progesterone metabolic process steroid biosynthetic process steroid metabolic process
axon; cell projection; endoplasmic reticulum membrane; mitochondrion; neuronal cell body
17-alpha-hydroxyprogesterone aldolase activity heme binding iron ion binding steroid 17-alpha-monooxygenase activity
Mus musculus
Endoplasmic reticulum Heme Iron Lipid metabolism Lyase Membrane Metal-binding Microsome Monooxygenase Oxidoreductase Reference proteome Steroidogenesis
MWELVGLLLL
MWELVGLLLLILAYFFWPKSKTPNAKFPRSLPFLPLVGSLPFLPRRGHMHANFFKLQEKYGPIYSLRLGTTTAVIVGHYQLAREVLVKKGKEFSGRPQMVTLGLLSDQGKGVAFADSSSSWQLHRKLVFSTFSLFRDDQKLEKMICQEANSLCDLILTYDGESRDLSTLIFKSVINIICTICFNISFENKDPILTTIQTFTEGIVDVLGHSDLVDIFPWLKIFPNKNLEMIKEHTKIREKTLVEMFEKCKEKFNSESLSSLTDILIQAKMNAENNNTGEGQDPSVFSDKHILVTVGDIFGAGIETTSSVLNWILAFLVHN...
glucocorticoid biosynthetic process hormone biosynthetic process positive regulation of steroid hormone biosynthetic process progesterone metabolic process steroid biosynthetic process steroid metabolic process axon; cell projection; endoplasmic reticulum membrane; mitochondrion; neuronal cell body 17-alpha-hydroxyprog...
electron transport chain response to light stimulus
chloroplast; chloroplast stroma
2 iron, 2 sulfur cluster binding electron transfer activity metal ion binding
Zea mays
2Fe-2S 3D-structure Chloroplast Direct protein sequencing Electron transport Iron Iron-sulfur Metal-binding Plastid Reference proteome Transit peptide Transport
MATVLGSPRA
MATVLGSPRAPAFFFSSSSLRAAPAPTAVALPAAKVGIMGRSASSRRRLRAQATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELTGA
electron transport chain response to light stimulus chloroplast; chloroplast stroma 2 iron, 2 sulfur cluster binding electron transfer activity metal ion binding Zea mays 2Fe-2S 3D-structure Chloroplast Direct protein sequencing Electron transport Iron Iron-sulfur Metal-binding Plastid Reference proteome Transit peptid...
fatty acid beta-oxidation phenylacetate catabolic process
mitochondrial intermembrane space; peroxisomal matrix; peroxisome
acetyl-CoA C-acyltransferase activity mRNA binding
Saccharomyces cerevisiae
3D-structure Acyltransferase Fatty acid metabolism Lipid metabolism Mitochondrion Peroxisome Reference proteome Transferase Transit peptide
MSQRLQSIKD
MSQRLQSIKDHLVESAMGKGESKRKNSLLEKRPEDVVIVAANRSAIGKGFKGAFKDVNTDYLLYNFLNEFIGRFPEPLRADLNLIEEVACGNVLNVGAGATEHRAACLASGIPYSTPFVALNRQCSSGLTAVNDIANKIKVGQIDIGLALGVESMTNNYKNVNPLGMISSEELQKNREAKKCLIPMGITNENVAANFKISRKDQDEFAANSYQKAYKAKNEGLFEDEILPIKLPDGSICQSDEGPRPNVTAESLSSIRPAFIKDRGTTTAGNASQVSDGVAGVLLARRSVANQLNLPVLGRYIDFQTVGVPPEIMGVGPA...
fatty acid beta-oxidation phenylacetate catabolic process mitochondrial intermembrane space; peroxisomal matrix; peroxisome acetyl-CoA C-acyltransferase activity mRNA binding Saccharomyces cerevisiae 3D-structure Acyltransferase Fatty acid metabolism Lipid metabolism Mitochondrion Peroxisome Reference proteome Transfe...
defecation determination of adult lifespan endoplasmic reticulum calcium ion homeostasis endoplasmic reticulum unfolded protein response hemidesmosome assembly multicellular organismal reproductive process programmed cell death protein folding regulation of gene expression response to ethanol response to heat ubiquitin...
cytoplasm; endoplasmic reticulum lumen; endoplasmic reticulum membrane
calcium ion binding carbohydrate binding unfolded protein binding
Caenorhabditis elegans
Calcium Chaperone Disulfide bond Endoplasmic reticulum Lectin Metal-binding Reference proteome Repeat Signal Zinc
MKSLCLLAIV
MKSLCLLAIVAVVSAEVYFKEEFNDASWEKRWVQSKHKDDFGAFKLSAGKFFDVESRDQGIQTSQDAKFYSRAAKFDKDFSNKGKTLVIQYTVKHEQGIDCGGGYVKVMRADADLGDFHGETPYNVMFGPDICGPTRRVHVILNYKGENKLIKKEITCKSDELTHLYTLILNSDNTYEVKIDGESAQTGSLEEDWDLLPAKKIKDPDAKKPEDWDEREYIDDAEDAKPEDWEKPEHIPDPDAKKPEDWDDEMDGEWEPPMIDNPEYKGEWKPKQIKNPAYKGKWIHPEIENPEYTPDDELYSYESWGAIGFDLWQVKSGT...
defecation determination of adult lifespan endoplasmic reticulum calcium ion homeostasis endoplasmic reticulum unfolded protein response hemidesmosome assembly multicellular organismal reproductive process programmed cell death protein folding regulation of gene expression response to ethanol response to heat ubiquitin...
gamma-aminobutyric acid transport glycine betaine transport neurotransmitter transport sodium ion transmembrane transport
basolateral plasma membrane; plasma membrane
gamma-aminobutyric acid:sodium:chloride symporter activity
Canis lupus familiaris
Cell membrane Disulfide bond Glycoprotein Membrane Neurotransmitter transport Reference proteome Symport Transmembrane Transmembrane helix Transport
MDRKVAVPED
MDRKVAVPEDGPPVVSWLPEEGEKLDQEGEDQVKDRGQWTNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYFIFFFTCGIPVFFLEVALGQYTSQGSVTAWRKICPLLQGIGLASVVIESYLNIYYIIILAWALFYLFSSFTSELPWTTCTNTWNTEHCMDFLNHSGARTATSSENFTSPVMEFWERRVLGITSGIHDLGALRWELALCLLLAWLICYFCIWKGVKTTGKVVYFTATFPYLMLVILLIRGITLPGAYQGVIYYLKPDLLRLKDPQVWMDAGTQIFFSFAICQGCLTALGSYNKYHNNCYRDSI...
gamma-aminobutyric acid transport glycine betaine transport neurotransmitter transport sodium ion transmembrane transport basolateral plasma membrane; plasma membrane gamma-aminobutyric acid:sodium:chloride symporter activity Canis lupus familiaris Cell membrane Disulfide bond Glycoprotein Membrane Neurotransmitter tr...
endosome organization Golgi to endosome transport intracellular protein transport late endosome to vacuole transport organelle fusion regulation of SNARE complex assembly regulation of vacuole fusion, non-autophagic vacuole fusion, non-autophagic vacuole organization vesicle docking involved in exocytosis vesicle tethe...
CORVET complex; cytosol; early endosome membrane; endosome; fungal-type vacuole membrane; HOPS complex
metal ion binding protein-macromolecule adaptor activity
Saccharomyces cerevisiae
3D-structure Membrane Metal-binding Phosphoprotein Protein transport Reference proteome Transport Vacuole Zinc Zinc-finger
MIKTRIEEVQ
MIKTRIEEVQLQFLTGNTELTHLKVSNDQLIVTTQRTIYRINLQDPAIVNHFDCPLSKELETIMNVHVSPMGSVILIRTNFGRYMLLKDGEFTQLNKIKNLDLSSLHWINETTFLMGIKKTPKLYRVELTGKDITTKLWYENKKLSGGIDGIAYWEGSLLLTIKDNILYWRDVTNMKFPLVLPDESEQFERLKHHAIKKFDSYNGLFAWVTSNGIVFGDLKEKQMEKDPASNNFGKFLSSSKVLLNFELPDYQNDKDHLIKDIVLTAFHILLLRKNTVTMVSQLNNDVVFHETIPRHQLTGSNTDSNEKFLGLVRDSVKE...
endosome organization Golgi to endosome transport intracellular protein transport late endosome to vacuole transport organelle fusion regulation of SNARE complex assembly regulation of vacuole fusion, non-autophagic vacuole fusion, non-autophagic vacuole organization vesicle docking involved in exocytosis vesicle tethe...
in utero embryonic development protein N-linked glycosylation protein N-linked glycosylation via asparagine UDP-N-acetylglucosamine catabolic process
Golgi apparatus; Golgi membrane; perinuclear region of cytoplasm
acetylglucosaminyltransferase activity alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity manganese ion binding
Mus musculus
Cytoplasm Disulfide bond Glycosyltransferase Golgi apparatus Manganese Membrane Metal-binding Reference proteome Signal-anchor Transferase Transmembrane Transmembrane helix
MLKKQTAGLV
MLKKQTAGLVLWGAIIFVGWNALLLLFFWTRPAPGRLPSDSALGDDPASLTREVIHLAEDAEAELERQRGLLQQIKEHYALWRQRWRVPTVAPPAWPRVPVTPSPVQIPILVIACDRSTVRRCLDKLLHYRPSAERFPIIVSQDCGHEETAQVIASYGTAVTHIRQPDLSNIAVQPDHRKFQGYYKIARHYRWALGQIFNKFKFPAAVVVEDDLEVAPDFFEYFQATYPLLRTDPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLADLWAELEPKWPKAFWDDWMRRPEQRKGRACIRPEISRTMTFGRKG...
in utero embryonic development protein N-linked glycosylation protein N-linked glycosylation via asparagine UDP-N-acetylglucosamine catabolic process Golgi apparatus; Golgi membrane; perinuclear region of cytoplasm acetylglucosaminyltransferase activity alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransfer...
cell wall mannoprotein biosynthetic process mannosylation N-glycan processing protein N-linked glycosylation protein O-linked glycosylation
fungal-type vacuole membrane; Golgi apparatus; Golgi medial cisterna; Golgi membrane
alpha-1,2-mannosyltransferase activity
Saccharomyces cerevisiae
3D-structure Direct protein sequencing Glycoprotein Glycosyltransferase Golgi apparatus Manganese Membrane Reference proteome Signal-anchor Transferase Transmembrane Transmembrane helix
MALFLSKRLL
MALFLSKRLLRFTVIAGAVIVLLLTLNSNSRTQQYIPSSISAAFDFTSGSISPEQQVISEENDAKKLEQSALNSEASEDSEAMDEESKALKAAAEKADAPIDTKTTMDYITPSFANKAGKPKACYVTLVRNKELKGLLSSIKYVENKINKKFPYPWVFLNDEPFTEEFKEAVTKAVSSEVKFGILPKEHWSYPEWINQTKAAEIRADAATKYIYGGSESYRHMCRYQSGFFWRHELLEEYDWYWRVEPDIKLYCDINYDVFKWMQENEKVYGFTVSIHEYEVTIPTLWQTSMDFIKKNPEYLDENNLMSFLSNDNGKTYN...
cell wall mannoprotein biosynthetic process mannosylation N-glycan processing protein N-linked glycosylation protein O-linked glycosylation fungal-type vacuole membrane; Golgi apparatus; Golgi medial cisterna; Golgi membrane alpha-1,2-mannosyltransferase activity Saccharomyces cerevisiae 3D-structure Direct protein se...
cell wall mannoprotein biosynthetic process mannosylation protein N-linked glycosylation protein O-linked glycosylation
fungal-type vacuole; fungal-type vacuole membrane; Golgi apparatus; Golgi membrane
alpha-1,2-mannosyltransferase activity
Saccharomyces cerevisiae
Glycoprotein Glycosyltransferase Golgi apparatus Manganese Membrane Reference proteome Signal-anchor Transferase Transmembrane Transmembrane helix
MAKIMIPASK
MAKIMIPASKQPVYKKLGLLLVAVFTVYVFFHGAQYARGSAPSPKYSTVLSSGSGYKYSKVELPKYTGPREKATFVTLVRNRDLYSLAESIKSVEDRFNSKFNYDWVFLNDEEFTDEFKNVTSALVSGTTKYGVIPKEHWSFPEWIDEEKAAQVRKEMGEKRIIYGDSISYRHMCRFESGFFYRHPLMDDYDWYWRVEPDIKLHCDIDYDVFKFMKDNKKKYAFAISIKEYEATIPTLWETTRKFMEAHPELIHENNMLDFVSDDQGLSYNLCHFWSNFEIAALDLWRSPAYSAYFDYLDREGGFFYERWGDAPVHSIGA...
cell wall mannoprotein biosynthetic process mannosylation protein N-linked glycosylation protein O-linked glycosylation fungal-type vacuole; fungal-type vacuole membrane; Golgi apparatus; Golgi membrane alpha-1,2-mannosyltransferase activity Saccharomyces cerevisiae Glycoprotein Glycosyltransferase Golgi apparatus Man...
negative regulation of natural killer cell mediated cytotoxicity regulation of natural killer cell mediated cytotoxicity
cell surface; external side of plasma membrane; plasma membrane
carbohydrate binding identical protein binding signaling receptor activity
Mus musculus
Disulfide bond Lectin Membrane Receptor Reference proteome Signal-anchor Transmembrane Transmembrane helix
MDSTTLVYAD
MDSTTLVYADLNLARIQEPKHDSPPSLSPDTCRCPRWHRLALKFGCAGLILLVLVVIGLCVLVLSVQKSSVQKICADVQENRTHTTDCSVNLECPQDWLSHRDKCFRVFQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGDTENGSCASISGDKVTSESCSTDNRWICQKELNHETPSNDS
negative regulation of natural killer cell mediated cytotoxicity regulation of natural killer cell mediated cytotoxicity cell surface; external side of plasma membrane; plasma membrane carbohydrate binding identical protein binding signaling receptor activity Mus musculus Disulfide bond Lectin Membrane Receptor Referen...
natural killer cell activation positive regulation of natural killer cell mediated cytotoxicity regulation of natural killer cell mediated cytotoxicity
cell surface; external side of plasma membrane; plasma membrane
carbohydrate binding identical protein binding signaling receptor activity
Mus musculus
Alternative splicing Disulfide bond Glycoprotein Lectin Membrane Reference proteome Signal-anchor Transmembrane Transmembrane helix
MDTASIYLGL
MDTASIYLGLKPPRTLGAWHESPPSLPPDACRCPRSHRLALKLSCAGLILLVLTLIGMSVLVRVLVQKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDS
natural killer cell activation positive regulation of natural killer cell mediated cytotoxicity regulation of natural killer cell mediated cytotoxicity cell surface; external side of plasma membrane; plasma membrane carbohydrate binding identical protein binding signaling receptor activity Mus musculus Alternative spli...
cAMP catabolic process cellular response to xenobiotic stimulus G protein-coupled receptor signaling pathway regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway regulation of protein kinase A signaling sensory perception of smell signal transduction
cytosol; extrinsic component of membrane; membrane; nucleoplasm; nucleus; perinuclear region of cytoplasm; plasma membrane; ruffle membrane
3',5'-cyclic-AMP phosphodiesterase activity cAMP binding metal ion binding
Homo sapiens
3D-structure Alternative splicing cAMP Cell membrane Cell projection Cytoplasm Hydrolase Isopeptide bond Manganese Membrane Metal-binding Phosphoprotein Reference proteome Ubl conjugation Zinc
MEPPTVPSER
MEPPTVPSERSLSLSLPGPREGQATLKPPPQHLWRQPRTPIRIQQRGYSDSAERAERERQPHRPIERADAMDTSDRPGLRTTRMSWPSSFHGTGTGSGGAGGGSSRRFEAENGPTPSPGRSPLDSQASPGLVLHAGAATSQRRESFLYRSDSDYDMSPKTMSRNSSVTSEAHAEDLIVTPFAQVLASLRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEELDWCLEQLETMQTYRSVSEMASHKFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEIPSPTMKEREKQQAPRPRPSQ...
cAMP catabolic process cellular response to xenobiotic stimulus G protein-coupled receptor signaling pathway regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway regulation of protein kinase A signaling sensory perception of smell signal transduction cytosol; extrinsic component of me...
clathrin-dependent endocytosis protein folding protein folding in endoplasmic reticulum protein secretion synaptic vesicle endocytosis ubiquitin-dependent ERAD pathway viral protein processing
endoplasmic reticulum; endoplasmic reticulum lumen; endoplasmic reticulum membrane; endoplasmic reticulum quality control compartment; extracellular exosome; lumenal side of endoplasmic reticulum membrane; melanosome membrane; membrane; mitochondria-associated endoplasmic reticulum membrane; mitochondrial membrane; nuc...
calcium ion binding carbohydrate binding RNA binding unfolded protein binding
Homo sapiens
Acetylation Alternative splicing Calcium Chaperone Direct protein sequencing Disulfide bond Endoplasmic reticulum Host-virus interaction Lectin Lipoprotein Membrane Metal-binding Mitochondrion Palmitate Phosphoprotein Reference proteome Repeat Signal Transmembrane Transmembrane helix Ubl conjugation
MEGKWLLCML
MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKP...
clathrin-dependent endocytosis protein folding protein folding in endoplasmic reticulum protein secretion synaptic vesicle endocytosis ubiquitin-dependent ERAD pathway viral protein processing endoplasmic reticulum; endoplasmic reticulum lumen; endoplasmic reticulum membrane; endoplasmic reticulum quality control compa...
protein folding ubiquitin-dependent ERAD pathway
endoplasmic reticulum; endoplasmic reticulum membrane
calcium ion binding carbohydrate binding unfolded protein binding
Saccharomyces cerevisiae
Chaperone Disulfide bond Endoplasmic reticulum Glycoprotein Lectin Membrane Reference proteome Repeat Signal Transmembrane Transmembrane helix
MKFSAYLWWL
MKFSAYLWWLFLNLALVKGTSLLSNVTLAEDSFWEHFQAYTNTKHLNQEWITSEAVNNEGSKIYGAQWRLSQGRLQGSAWDKGIAVRTGNAAAMIGHLLETPINVSETDTLVVQYEIKLDNSLTCGGAFIKLMSGFMNVEALKHYAPDTEGVELVFGPDYCAPEINGVQFAINKVDKITHESKLRYLQEMPLSKLTDTSQSHLYTLIIDESAQSFQILIDGKTVMVREHIEDKKKVNFEPPITPPLMIPDVSVAKPHDWDDRIRIPDPEAVKLSDRDERDPLMIPHPDGTEPPEWNSSIPEYILDPNAQKPSWWKELEHG...
protein folding ubiquitin-dependent ERAD pathway endoplasmic reticulum; endoplasmic reticulum membrane calcium ion binding carbohydrate binding unfolded protein binding Saccharomyces cerevisiae Chaperone Disulfide bond Endoplasmic reticulum Glycoprotein Lectin Membrane Reference proteome Repeat Signal Transmembrane Tr...
enterobacterial common antigen biosynthetic process
cytosol
protein homodimerization activity UDP-N-acetylglucosamine 2-epimerase activity
Escherichia coli
3D-structure Allosteric enzyme Cytoplasm Isomerase Reference proteome
MKVLTVFGTR
MKVLTVFGTRPEAIKMAPLVHALAKDPFFEAKVCVTAQHREMLDQVLKLFSIVPDYDLNIMQPGQGLTEITCRILEGLKPILAEFKPDVVLVHGDTTTTLATSLAAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLAMYHFSPTETSRQNLLRENVADSRIFITGNTVIDALLWVRDQVMSSDKLRSELAANYPFIDPDKKMILVTGHRRESFGRGFEEICHALADIATTHQDIQIVYPVHLNPNVREPVNRILGHVKNVILIDPQEYLPFVWLMNHAWLILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVTAG...
enterobacterial common antigen biosynthetic process cytosol protein homodimerization activity UDP-N-acetylglucosamine 2-epimerase activity Escherichia coli 3D-structure Allosteric enzyme Cytoplasm Isomerase Reference proteome MKVLTVFGTR MKVLTVFGTRPEAIKMAPLVHALAKDPFFEAKVCVTAQHREMLDQVLKLFSIVPDYDLNIMQPGQGLTEITCRILEGLKPILA...
enterobacterial common antigen biosynthetic process
cytosol
NAD binding oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor protein homodimerization activity UDP-N-acetyl-D-mannosamine dehydrogenase activity
Escherichia coli
NAD Oxidoreductase Reference proteome
MSFATISVIG
MSFATISVIGLGYIGLPTAAAFASRQKQVIGVDINQHAVDTINRGEIHIVEPDLASVVKTAVEGGFLRASTTPVEADAWLIAVPTPFKGDHEPDMTYVESAARSIAPVLKKGALVILESTSPVGSTEKMAEWLAEMRPDLTFPQQVGEQADVNIAYCPERVLPGQVMVELIKNDRVIGGMTPVCSARASELYKIFLEGECVVTNSRTAEMCKLTENSFRDVNIAFANELSLICADQGINVWELIRLANRHPRVNILQPGPGVGGHCIAVDPWFIVAQNPQQARLIRTAREVNDHKPFWVIDQVKAAVADCLAATDKRASE...
enterobacterial common antigen biosynthetic process cytosol NAD binding oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor protein homodimerization activity UDP-N-acetyl-D-mannosamine dehydrogenase activity Escherichia coli NAD Oxidoreductase Reference proteome MSFATISVIG MSFATISVIGLG...
iron-sulfur cluster assembly
cytoplasm; cytosol
ferric iron binding ferrous iron binding
Escherichia coli
3D-structure Iron Metal-binding Reference proteome
MNDSEFHRLA
MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGSKIIINRQEPLHQVWLATKQGGYHFDLKGDEWICDRSGETFWDLLEQAATQQAGETVSFR
iron-sulfur cluster assembly cytoplasm; cytosol ferric iron binding ferrous iron binding Escherichia coli 3D-structure Iron Metal-binding Reference proteome MNDSEFHRLA MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGSKIIINRQEPLHQVWLATKQGGYHFDLKGDEWICDRSGETFWDLLEQAATQQAGETVSFR
response to hydrogen peroxide
cytoplasm; cytosol
3'-5'-RNA exonuclease activity DNA nuclease activity magnesium ion binding metal ion binding single-stranded DNA 3'-5' DNA exonuclease activity
Escherichia coli
3D-structure Cytoplasm Direct protein sequencing Exonuclease Hydrolase Magnesium Manganese Metal-binding Nuclease Reference proteome
MFDIGVNLTS
MFDIGVNLTSSQFAKDRDDVVACAFDAGVNGLLITGTNLRESQQAQKLARQYSSCWSTAGVHPHDSSQWQAATEEAIIELAAQPEVVAIGECGLDFNRNFSTPEEQERAFVAQLRIAADLNMPVFMHCRDAHERFMTLLEPWLDKLPGAVLHCFTGTREEMQACVAHGIYIGITGWVCDERRGLELRELLPLIPAEKLLIETDAPYLLPRDLTPKPSSRRNEPAHLPHILQRIAHWRGEDAAWLAATTDANVKTLFGIAF
response to hydrogen peroxide cytoplasm; cytosol 3'-5'-RNA exonuclease activity DNA nuclease activity magnesium ion binding metal ion binding single-stranded DNA 3'-5' DNA exonuclease activity Escherichia coli 3D-structure Cytoplasm Direct protein sequencing Exonuclease Hydrolase Magnesium Manganese Metal-binding Nucle...
base-excision repair
nucleus
3'-5' exonuclease activity class II DNA-(apurinic or apyrimidinic site) endonuclease activity DNA binding DNA polymerase binding DNA-(apurinic or apyrimidinic site) endonuclease activity double-stranded DNA 3'-5' DNA exonuclease activity metal ion binding phosphoric diester hydrolase activity
Drosophila melanogaster
DNA damage DNA repair Hydrolase Magnesium Metal-binding Nucleus Phosphoprotein Reference proteome
MPRVKAVKKQ
MPRVKAVKKQAEALASEPTDPTPNANGNGVDENADSAAEELKVPAKGKPRARKATKTAVSAENSEEVEPQKAPTAAARGKKKQPKDTDENGQMEVVAKPKGRAKKATAEAEPEPKVDLPAGKATKPRAKKEPTPAPDEVTSSPPKGRAKAEKPTNAQAKGRKRKELPAEANGGAEEAAEPPKQRARKEAVPTLKEQAEPGTISKEKVQKAETAAKRARGTKRLADSEIAAALDEPEVDEVPPKAASKRAKKGKMVEPSPETVGDFQSVQEEVESPPKTAAAPKKRAKKTTNGETAVELEPKTKAKPTKQRAKKEGKEPAP...
base-excision repair nucleus 3'-5' exonuclease activity class II DNA-(apurinic or apyrimidinic site) endonuclease activity DNA binding DNA polymerase binding DNA-(apurinic or apyrimidinic site) endonuclease activity double-stranded DNA 3'-5' DNA exonuclease activity metal ion binding phosphoric diester hydrolase activi...
flagellated sperm motility fructose biosynthetic process glucuronate catabolic process to xylulose 5-phosphate L-xylitol catabolic process L-xylitol metabolic process response to cadmium ion response to copper ion response to hormone response to nutrient levels response to xenobiotic stimulus sorbitol catabolic process...
cytosol; extracellular exosome; membrane; mitochondrial membrane; mitochondrion; motile cilium
D-sorbitol dehydrogenase (acceptor) activity D-xylulose reductase activity identical protein binding L-iditol 2-dehydrogenase activity NAD binding zinc ion binding
Rattus norvegicus
Acetylation Cell projection Cilium Flagellum Membrane Metal-binding Mitochondrion NAD Oxidoreductase Phosphoprotein Reference proteome Zinc
MAAPAKGENL
MAAPAKGENLSLVVHGPGDIRLENYPIPELGPNDVLLKMHSVGICGSDVHYWEHGRIGDFVVKKPMVLGHEAAGTVTKVGPMVKHLKPGDRVAIEPGVPREIDEFCKIGRYNLTPSIFFCATPPDDGNLCRFYKHSADFCYKLPDSVTFEEGALIEPLSVGIYACRRGSVSLGNKVLVCGAGPIGIVTLLVAKAMGASQVVVIDLSASRLAKAKEVGADFTIQVAKETPHDIAKKVESVLGSKPEVTIECTGAESSVQTGIYATHSGGTLVVVGMGPEMINLPLVHAAVREVDIKGVFRYCNTWPMAVSMLASKTLNVKP...
flagellated sperm motility fructose biosynthetic process glucuronate catabolic process to xylulose 5-phosphate L-xylitol catabolic process L-xylitol metabolic process response to cadmium ion response to copper ion response to hormone response to nutrient levels response to xenobiotic stimulus sorbitol catabolic process...
cell migration G protein-coupled receptor signaling pathway immune response integrin-mediated signaling pathway intracellular signal transduction neutrophil chemotaxis phagocytosis positive regulation of cell adhesion positive regulation of natural killer cell mediated cytotoxicity reactive oxygen species metabolic pro...
cell-cell junction; cytoplasm; cytosol
guanyl-nucleotide exchange factor activity metal ion binding phosphorylation-dependent protein binding phosphotyrosine residue binding
Mus musculus
3D-structure Guanine-nucleotide releasing factor Metal-binding Phosphoprotein Proto-oncogene Reference proteome Repeat SH2 domain SH3 domain Zinc Zinc-finger
MELWRQCTHW
MELWRQCTHWLIQCRVLPPSHRVTWEGAQVCELAQALRDGVLLCQLLNNLLPQAINLREVNLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPIAQNKGIMPFPTEDSALNDEDIYSGLSDQIDDTAEEDEDLYDCVENEEAEGDEIYEDLMRLESVPTPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPQDMETIFVNIEELFSVHTHFLKELKDALAGPGATTLYQVFIKYKERFLVYGRYCSQVESASKHLDQVATAREDVQMKLEECSQRANNGRF...
cell migration G protein-coupled receptor signaling pathway immune response integrin-mediated signaling pathway intracellular signal transduction neutrophil chemotaxis phagocytosis positive regulation of cell adhesion positive regulation of natural killer cell mediated cytotoxicity reactive oxygen species metabolic pro...
apoptotic mitochondrial changes carbohydrate phosphorylation cellular response to leukemia inhibitory factor establishment of protein localization to mitochondrion fructose 6-phosphate metabolic process glucose 6-phosphate metabolic process glucose catabolic process glucose metabolic process glycolytic process intracel...
centrosome; cytosol; mitochondrial outer membrane; mitochondrion; sarcoplasmic reticulum
ATP binding fructokinase activity glucokinase activity glucose binding hexokinase activity
Rattus norvegicus
Acetylation Allosteric enzyme ATP-binding Cytoplasm Direct protein sequencing Glycolysis Kinase Membrane Mitochondrion Mitochondrion outer membrane Nucleotide-binding Reference proteome Repeat Transferase
MIASHMIACL
MIASHMIACLFTELNQNQVQKVDQFLYHMRLSDETLLEISRRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLRVRVTDNGLQRVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKEKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVDLIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDQNCEIGLIVGTGSNACYMEEMRHIDMVEGDEGRMCINMEWGAFGDDGTLNDIRTEFDREIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKAELLF...
apoptotic mitochondrial changes carbohydrate phosphorylation cellular response to leukemia inhibitory factor establishment of protein localization to mitochondrion fructose 6-phosphate metabolic process glucose 6-phosphate metabolic process glucose catabolic process glucose metabolic process glycolytic process intracel...
cellular response to oxidative stress intracellular iron ion homeostasis protein import into mitochondrial intermembrane space
mitochondrial intermembrane space; mitochondrion
flavin adenine dinucleotide binding flavin-dependent sulfhydryl oxidase activity thiol oxidase activity
Saccharomyces cerevisiae
3D-structure Disulfide bond FAD Flavoprotein Mitochondrion Oxidoreductase Reference proteome
MKAIDKMTDN
MKAIDKMTDNPPQEGLSGRKIIYDEDGKPCRSCNTLLDFQYVTGKISNGLKNLSSNGKLAGTGALTGEASELMPGSRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPCNWCAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDGWDE
cellular response to oxidative stress intracellular iron ion homeostasis protein import into mitochondrial intermembrane space mitochondrial intermembrane space; mitochondrion flavin adenine dinucleotide binding flavin-dependent sulfhydryl oxidase activity thiol oxidase activity Saccharomyces cerevisiae 3D-structure D...
cell division initial mitotic spindle pole body separation meiotic sister chromatid segregation microtubule depolymerization microtubule-based movement mitotic sister chromatid segregation mitotic spindle assembly mitotic spindle elongation mitotic spindle elongation (spindle phase three) regulation of mitotic sister c...
astral microtubule; kinetochore; kinetochore microtubule; mitochondrion; mitotic spindle; nucleus; spindle microtubule
ATP binding microtubule binding microtubule motor activity minus-end-directed microtubule motor activity plus-end-directed microtubule motor activity
Saccharomyces cerevisiae
ATP-binding Cell cycle Cell division Coiled coil Cytoplasm Cytoskeleton Microtubule Mitochondrion Mitosis Motor protein Nucleotide-binding Phosphoprotein Reference proteome
MPAENQNTGQ
MPAENQNTGQDRSSNSISKNGNSQVGCHTVPNEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDSNSNGSSNTGFDGQFMKKLRIFDSSTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTIKQQYQQQQAVNSRNNSSSNSGSTTNNASSNTNTNNGQRSSMAPNDQTNGIYIQN...
cell division initial mitotic spindle pole body separation meiotic sister chromatid segregation microtubule depolymerization microtubule-based movement mitotic sister chromatid segregation mitotic spindle assembly mitotic spindle elongation mitotic spindle elongation (spindle phase three) regulation of mitotic sister c...
cell fate specification fruit development gibberellic acid mediated signaling pathway jasmonic acid mediated signaling pathway regulation of protein localization regulation of trichome morphogenesis trichome differentiation trichome patterning
nucleus
DNA binding DNA-binding transcription factor activity
Arabidopsis thaliana
Activator Developmental protein DNA-binding Nucleus Reference proteome Repeat Transcription Transcription regulation
MRIRRRDEKE
MRIRRRDEKENQEYKKGLWTVEEDNILMDYVLNHGTGQWNRIVRKTGLKRCGKSCRLRWMNYLSPNVNKGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLVGDYSSAVKTTGEDDDSPPSLFITAATPSSCHHQQENIYENIAKSFNGVVSASYEDKPKQELAQKDVLMATTNDPSHYYGNNALWVHDDDFELSSLVMMNFASGDVEYCL
cell fate specification fruit development gibberellic acid mediated signaling pathway jasmonic acid mediated signaling pathway regulation of protein localization regulation of trichome morphogenesis trichome differentiation trichome patterning nucleus DNA binding DNA-binding transcription factor activity Arabidopsis th...
carbohydrate metabolic process viral budding from plasma membrane
host cell plasma membrane; membrane; virion membrane
exo-alpha-(2->3)-sialidase activity exo-alpha-(2->6)-sialidase activity exo-alpha-(2->8)-sialidase activity metal ion binding
Influenza B virus
3D-structure Calcium Direct protein sequencing Disulfide bond Glycoprotein Glycosidase Host cell membrane Host membrane Hydrolase Membrane Metal-binding Signal-anchor Transmembrane Transmembrane helix Virion
MLPSTIQTLT
MLPSTIQTLTLFLTSGGVLLSLYVSASLSYLLYSDILLKFSSKITAPTMTLDCANASNVQAVNRSATKEMTFLLPEPEWTYPRLSCQGSTFQKALLISPHRFGEARGNSAPLIIREPFIACGPKECKHFALTHYAAQPGGYYNGTREDRNKLRHLISVKLGKIPTVENSIFHMAAWSGSACHDGREWTYIGVDGPDSNALIKIKYGEAYTDTYHSYANNILRTQESACNCIGGDCYLMITDGSASGISKCRFLKIREGRIIKEIFPTGRVEHTEECTCGFASNKTIECACRDNSYTAKRPFVKLNVETDTAEIRLMCTET...
carbohydrate metabolic process viral budding from plasma membrane host cell plasma membrane; membrane; virion membrane exo-alpha-(2->3)-sialidase activity exo-alpha-(2->6)-sialidase activity exo-alpha-(2->8)-sialidase activity metal ion binding Influenza B virus 3D-structure Calcium Direct protein sequencing Disulfide ...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell
extracellular region; host cell endoplasmic reticulum membrane; host cell nucleus; host cell perinuclear region of cytoplasm; membrane; viral envelope; viral nucleocapsid; virion membrane
protein dimerization activity structural molecule activity
Dengue virus type 1
Capsid protein Clathrin-mediated endocytosis of virus by host Cleavage on pair of basic residues Disulfide bond Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Host cytoplasm Host endoplasmic reticulum Host membrane Host nucleus Host-virus interaction Membr...
MNNQRKKTGN
MNNQRKKTGNPSFNMLKRARNRVSTGSQLAKRFSKGLLSGQGPMKLVMAFVAFLRFLAIPPTAGILKRWGSFKKNGAINVLRGFRKEISNMLNIMNRRRRSVTMILMLLPTALAFHLTTRGGEPTLIVSKQERGKSLLFKTSAGVNMCTLIAMDLGELCEDTMTYKCPRMTEAEPDDVDCWCNATDTWVTYGTCSQTGEHRRDKRSVALDPHVGLGLETRTETWMSSEGAWKQIQKVETWALRHPGFTVIGLFLAHAIGTSITQKGIIFILLMLVTPSMAMRCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKNKPT...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell extracellular region; host cell endoplasmic reticulum membrane; host cell nucleus; host cell perinuclear region of cytoplasm; membrane; viral envelope; viral nucleocapsid; virion memb...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell
extracellular region; host cell endoplasmic reticulum membrane; host cell nucleus; host cell perinuclear region of cytoplasm; membrane; viral envelope; viral nucleocapsid; virion membrane
lipid binding protein dimerization activity structural molecule activity
Dengue virus type 1
Capsid protein Clathrin-mediated endocytosis of virus by host Cleavage on pair of basic residues Disulfide bond Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Host cytoplasm Host endoplasmic reticulum Host membrane Host nucleus Host-virus interaction Membr...
MNNQRKKTGR
MNNQRKKTGRPSFNMLKRARNRVSTGSQLAKRFSKGLLSGQGPMKLVMAFIAFLRFLAIPPTAGILARWSSFKKNGAIKVLRGFKKEISSMLNIMNRRKRSVTMLLMLLPTALAFHLTTRGGEPTLIVSKQERGKSLLFKTSAGVNMCTLIAMDLGELCEDTMTYKCPRITERQPDDVDCWCNATDTWVTYGTCSQTGEHRRDKRSVALAPHVGLGLETRTETWMSSEGAWKQIQKVETWALRHPGFTVIGLFLAHAIGTSITQKGIIFILLMLVTPSMAMRCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKNKPT...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell extracellular region; host cell endoplasmic reticulum membrane; host cell nucleus; host cell perinuclear region of cytoplasm; membrane; viral envelope; viral nucleocapsid; virion memb...
dopamine transport dopamine uptake involved in synaptic transmission hyaloid vascular plexus regression norepinephrine transport sodium ion transmembrane transport
axon; neuron projection; neuronal cell body membrane; presynaptic membrane
dopamine:sodium symporter activity metal ion binding norepinephrine:sodium symporter activity
Bos taurus
Cell membrane Cell projection Disulfide bond Glycoprotein Membrane Metal-binding Neurotransmitter transport Reference proteome Sodium Symport Transmembrane Transmembrane helix Transport
MSEGRCSVAH
MSEGRCSVAHMSSVVAPAKEANAMGPKAVELVLVKEQNGVQLTNSTLLNPPQSPTEAQDRETWSKKADFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLFFMVVAGVPLFYMELALGQFNREGAAGVWKICPILRGVGYTAILISLYIGFFYNVIIAWALHYLLSSFTTELPWTHCNHSWNSPRCSDARAPNASSGPNGTSRTTPAAEYFERGVLHLHESQGIDDLGPPRWQLTSCLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLFALLLRGITLPGAVDAIRAYLSVDFHRLCEASVWIDAAIQICFSLG...
dopamine transport dopamine uptake involved in synaptic transmission hyaloid vascular plexus regression norepinephrine transport sodium ion transmembrane transport axon; neuron projection; neuronal cell body membrane; presynaptic membrane dopamine:sodium symporter activity metal ion binding norepinephrine:sodium sympor...
cell differentiation circadian rhythm negative regulation of apoptotic process positive regulation of DNA-templated transcription positive regulation of fat cell differentiation positive regulation of lipid biosynthetic process positive regulation of transcription by RNA polymerase II protein stabilization regulation o...
ATF4-CREB1 transcription factor complex; nucleus
cAMP response element binding DNA-binding transcription factor activity, RNA polymerase II-specific
Bos taurus
Activator Biological rhythms Differentiation DNA-binding Isopeptide bond Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation Ubl conjugation
MESGAENQQS
MESGAENQQSGDAAVTEAESQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLY...
cell differentiation circadian rhythm negative regulation of apoptotic process positive regulation of DNA-templated transcription positive regulation of fat cell differentiation positive regulation of lipid biosynthetic process positive regulation of transcription by RNA polymerase II protein stabilization regulation o...
carbohydrate phosphorylation fructose 6-phosphate metabolic process glucose 6-phosphate metabolic process glucose metabolic process glycolytic process intracellular glucose homeostasis negative regulation of hydrogen peroxide-mediated programmed cell death
cytosol; mitochondrion; protein-containing complex
ATP binding enzyme binding fructokinase activity glucokinase activity glucose binding hexokinase activity hormone binding
Rattus norvegicus
Allosteric enzyme ATP-binding Glycolysis Kinase Nucleotide-binding Reference proteome Repeat Transferase
MAAIEPSGLH
MAAIEPSGLHPGERDSSCPQEGIPRPSGSLELAQEYLQQFKVTMTQLQQIQASLLCSMEQALKGQDSPAPSVRMLPTYVRSTPHGTEQGDFLVLELGATGASLRVLWVTLTGTKEHSVETRSQEFVIPQEVILGAGQQLFDFAARCLSEFLDAYPVENQGLKLGFNFSFPCHQTGLDKSTLISWTKGFRCSGVEGQDVVQLLRDAIQRQGTYNIDVVAMVNDTVGTMMGCELGTRPCEVGLIVDTGTNACYMEEARHVAALDEDRGRTCVSIEWGSFYDEEALGPVLTTFDDALDHESLVPGAQRFEKMIGGLYLGELVR...
carbohydrate phosphorylation fructose 6-phosphate metabolic process glucose 6-phosphate metabolic process glucose metabolic process glycolytic process intracellular glucose homeostasis negative regulation of hydrogen peroxide-mediated programmed cell death cytosol; mitochondrion; protein-containing complex ATP binding ...
immune response negative regulation of cytokine production involved in inflammatory response negative regulation of interleukin-1 alpha production negative regulation of interleukin-1-mediated signaling pathway negative regulation of protein processing protein processing
cytoplasm; extracellular region; plasma membrane
interleukin-1 binding interleukin-1 receptor activity interleukin-1, type II, blocking receptor activity
Homo sapiens
3D-structure Alternative splicing Cell membrane Disulfide bond Glycoprotein Immunoglobulin domain Membrane Receptor Reference proteome Repeat Secreted Signal Transmembrane Transmembrane helix
MLRLYVLVMG
MLRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDNEKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVIISPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQEYSENNENYIEVPLIFDPVTREDL...
immune response negative regulation of cytokine production involved in inflammatory response negative regulation of interleukin-1 alpha production negative regulation of interleukin-1-mediated signaling pathway negative regulation of protein processing protein processing cytoplasm; extracellular region; plasma membrane...
negative regulation of cytokine production involved in inflammatory response negative regulation of interleukin-1 alpha production negative regulation of interleukin-1-mediated signaling pathway negative regulation of protein processing protein processing
cytoplasm; extracellular region; plasma membrane
interleukin-1 binding interleukin-1 receptor activity interleukin-1, type II, blocking receptor activity
Mus musculus
Cell membrane Disulfide bond Glycoprotein Immunoglobulin domain Membrane Receptor Reference proteome Repeat Secreted Signal Transmembrane Transmembrane helix
MFILLVLVTG
MFILLVLVTGVSAFTTPTVVHTGKVSESPITSEKPTVHGDNCQFRGREFKSELRLEGEPVVLRCPLAPHSDISSSSHSFLTWSKLDSSQLIPRDEPRMWVKGNILWILPAVQQDSGTYICTFRNASHCEQMSVELKVFKNTEASLPHVSYLQISALSTTGLLVCPDLKEFISSNADGKIQWYKGAILLDKGNKEFLSAGDPTRLLISNTSMDDAGYYRCVMTFTYNGQEYNITRNIELRVKGTTTEPIPVIISPLETIPASLGSRLIVPCKVFLGTGTSSNTIVWWLANSTFISAAYPRGRVTEGLHHQYSENDENYVEV...
negative regulation of cytokine production involved in inflammatory response negative regulation of interleukin-1 alpha production negative regulation of interleukin-1-mediated signaling pathway negative regulation of protein processing protein processing cytoplasm; extracellular region; plasma membrane interleukin-1 b...
protein ubiquitination suppression by virus of host NF-kappaB cascade
host cell cytoplasm; host cell nucleus; virion component
ATP binding ubiquitin conjugating enzyme activity
African swine fever virus
ATP-binding Early protein Host cytoplasm Host nucleus Host-virus interaction Inhibition of host NF-kappa-B by virus Late protein Nucleotide-binding Reference proteome Transferase Ubl conjugation pathway Virion
MVSRFLIAEY
MVSRFLIAEYRHLIENPSENFKISVNENNITEWDVILRGPPDTLYEGGLFKAKVAFPPEYPYAPPKLTFTSEMWHPNIYPDGRLCISILHGDNAEEQGMTWSPAQKIDTILLSVISLLNEPNPDSPANVDAAKSYRKYVYKEDLESYPMEVKKTVKKSLDECSPEDIEYFKNAASNVPPIPSDAYEDECEEMEDDTYILTYDDDEEEEDEEMDDE
protein ubiquitination suppression by virus of host NF-kappaB cascade host cell cytoplasm; host cell nucleus; virion component ATP binding ubiquitin conjugating enzyme activity African swine fever virus ATP-binding Early protein Host cytoplasm Host nucleus Host-virus interaction Inhibition of host NF-kappa-B by virus...
cellular response to interleukin-4 formation of translation preinitiation complex response to ethanol ribosomal small subunit assembly translation
cytosolic ribosome; cytosolic small ribosomal subunit; nucleoplasm; ribonucleoprotein complex; synapse
enzyme binding fibroblast growth factor binding mRNA binding protein-containing complex binding structural constituent of ribosome
Rattus norvegicus
3D-structure Acetylation Citrullination Cytoplasm Direct protein sequencing Isopeptide bond Nucleus Phosphoprotein Reference proteome Repeat Ribonucleoprotein Ribosomal protein Ubl conjugation
MADDAGAAGG
MADDAGAAGGPGGPGGPGLGGRGGFRGGFGSGLRGRGRGRGRGRGRGRGARGGKAEDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVATT
cellular response to interleukin-4 formation of translation preinitiation complex response to ethanol ribosomal small subunit assembly translation cytosolic ribosome; cytosolic small ribosomal subunit; nucleoplasm; ribonucleoprotein complex; synapse enzyme binding fibroblast growth factor binding mRNA binding protein-c...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell virus-mediated perturbation of host defense response
host cell endoplasmic reticulum membrane; host cell lipid droplet; host cell mitochondrial membrane; host cell nucleus; membrane; ribonucleoprotein complex; viral envelope; viral nucleocapsid; virion membrane
RNA binding structural molecule activity
Hepatitis C virus
Apoptosis Capsid protein Clathrin-mediated endocytosis of virus by host Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Host cytoplasm Host endoplasmic reticulum Host lipid droplet Host membrane Host mitochondrion Host nucleus Host-virus interaction Interfe...
RNLGKVIDTL
RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTVPASAYQVRNSSGLYHVTNDCPNSSIVYEAADAILHTPGCVPCVHEGNVSRCWVAMTPTVATRDGKLPTTQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRRHWTTQGCNCSI
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell virus-mediated perturbation of host defense response host cell endoplasmic reticulum membrane; host cell lipid droplet; host cell mitochondrial membrane; host cell nucleus; membrane; ...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell virus-mediated perturbation of host defense response
host cell endoplasmic reticulum membrane; host cell lipid droplet; host cell mitochondrial membrane; host cell nucleus; membrane; ribonucleoprotein complex; viral envelope; viral nucleocapsid; virion membrane
RNA binding structural molecule activity
Hepatitis C virus
Apoptosis Capsid protein Clathrin-mediated endocytosis of virus by host Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Host cytoplasm Host endoplasmic reticulum Host lipid droplet Host membrane Host mitochondrion Host nucleus Host-virus interaction Interfe...
GFADLMGYIP
GFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTVPASAYQVRNSSGIYHVTNDCPNSSIVYETADTILHSPGCVPCVREGNASKCWVPVAPTVATRDGNLPATQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRRHWTTQDCNCSIYPGHITGHRMAWDMMMNWSPTAALVMAQLLRIPQAILDMIAGAHWGVLAGIAYFSMVGNWAKVLVVLLLFAGVDATTYTTGGNAARTTQALTSFFSPGAKQDIQLINTNGSWHINRTALNCNASLDTGW
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell virus-mediated perturbation of host defense response host cell endoplasmic reticulum membrane; host cell lipid droplet; host cell mitochondrial membrane; host cell nucleus; membrane; ...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell virus-mediated perturbation of host defense response
host cell endoplasmic reticulum membrane; host cell lipid droplet; host cell mitochondrial membrane; host cell nucleus; membrane; ribonucleoprotein complex; viral envelope; viral nucleocapsid; virion membrane
RNA binding structural molecule activity
Hepatitis C virus
Apoptosis Capsid protein Clathrin-mediated endocytosis of virus by host Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Host cytoplasm Host endoplasmic reticulum Host lipid droplet Host membrane Host mitochondrion Host nucleus Host-virus interaction Interfe...
RNLGKVIDTL
RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTVPASAHQVRNSTGLYHVTNDCPNSSIVYEAADAILHTPGCVPCVHEGNVSRCWVAVTPTVATRDGKLPTTQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRRHWTTQGCNCSIYPGHITGHRMAWDMMMNWSPTAALVMAQLLRIPQAIMDMIAGAHWGVLAGIAYFSMVGNWAKVLVVLLLFAGVDAETYTSGGNAGHTMTGIVRFFAPGPKQNVHLINTNGSWHINSTALNCNDSLNTG...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell virus-mediated perturbation of host defense response host cell endoplasmic reticulum membrane; host cell lipid droplet; host cell mitochondrial membrane; host cell nucleus; membrane; ...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell virus-mediated perturbation of host defense response
host cell endoplasmic reticulum membrane; host cell lipid droplet; host cell mitochondrial membrane; host cell nucleus; membrane; ribonucleoprotein complex; viral envelope; viral nucleocapsid; virion membrane
RNA binding structural molecule activity
Hepatitis C virus
Apoptosis Capsid protein Clathrin-mediated endocytosis of virus by host Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Host cytoplasm Host endoplasmic reticulum Host lipid droplet Host membrane Host mitochondrion Host nucleus Host-virus interaction Interfe...
RNLGKVIDTL
RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSLFLLALLSCLTVPASAYQVRNSTGLYHVTNDCPNSSIVYEAADAILHAPGCVPCVREGNASRCWVAMTPTVATRDGRLPTTQLRRHIDLLVGSATLCSALYVGDLCGSIFLVGQLFTFSPRRHWTTQGCNCSIYPGHITGHRMAWDMMMNWSPTTALVVAQLLRIPQAILDMIAGAHWGVLAGIAYFSMVGNWAKVLVVLLLFAGVDAETTVTGGSAAHGALGIASLFNQGARQNIQLINTNGSWHINSTALNCNDSLNTG...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell virus-mediated perturbation of host defense response host cell endoplasmic reticulum membrane; host cell lipid droplet; host cell mitochondrial membrane; host cell nucleus; membrane; ...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell virus-mediated perturbation of host defense response
host cell endoplasmic reticulum membrane; host cell lipid droplet; host cell mitochondrial membrane; host cell nucleus; membrane; ribonucleoprotein complex; viral envelope; viral nucleocapsid; virion membrane
RNA binding structural molecule activity
Hepatitis C virus
Acetylation Apoptosis Capsid protein Clathrin-mediated endocytosis of virus by host Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Host cytoplasm Host endoplasmic reticulum Host lipid droplet Host membrane Host mitochondrion Host nucleus Host-virus interac...
MSTNPKPQRK
MSTNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRPEGRAWAQPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDSVNYATGNLPGCSFSIFLLALLSCLTIPASAYEVRNVSGVYHVTNDCSNSSIVYEAADLIMHAPGCVPCVRENNSSRCWVALTPTLAARNTSIPTTTIRRHVDLLVGAATFCSAMYVGDLCGSVFLVSQLFTFSPRRHETLQDCNCSIYPGHLSGHRMAW...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell virus-mediated perturbation of host defense response host cell endoplasmic reticulum membrane; host cell lipid droplet; host cell mitochondrial membrane; host cell nucleus; membrane; ...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell virus-mediated perturbation of host defense response
host cell endoplasmic reticulum membrane; host cell lipid droplet; host cell mitochondrial membrane; host cell nucleus; membrane; ribonucleoprotein complex; viral envelope; viral nucleocapsid; virion membrane
RNA binding structural molecule activity
Hepatitis C virus
Acetylation Apoptosis Capsid protein Clathrin-mediated endocytosis of virus by host Disulfide bond Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Host cytoplasm Host endoplasmic reticulum Host lipid droplet Host membrane Host mitochondrion Host nucleus Hos...
MSTNPKPQRK
MSTNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKDRRSTGKSWGKPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPNDPRHRSRNVGKVIDTLTCGFADLMGYIPVVGAPLGGVARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCITVPVSAVQVKNTSNSYMVTNDCSNDSITWQLQGAVLHVPGCVPCEKVGNMSRCWIPVSPNVAVRQPGALTQGLRTHIDMVVVSATLCSALYVGDLCGGVMLAAQMFIVSPQHHWFVQECNCSIYPGAITGHRMAW...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell virus-mediated perturbation of host defense response host cell endoplasmic reticulum membrane; host cell lipid droplet; host cell mitochondrial membrane; host cell nucleus; membrane; ...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell virus-mediated perturbation of host defense response
host cell endoplasmic reticulum membrane; host cell lipid droplet; host cell mitochondrial membrane; host cell nucleus; membrane; ribonucleoprotein complex; viral envelope; viral nucleocapsid; virion membrane
RNA binding structural molecule activity
Hepatitis C virus
Acetylation Apoptosis Capsid protein Clathrin-mediated endocytosis of virus by host Disulfide bond Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Host cytoplasm Host endoplasmic reticulum Host lipid droplet Host membrane Host mitochondrion Host nucleus Hos...
MSTNPKPQRK
MSTNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKDRRSTGKSWGKPGYPWPLYGNEGCGWAGWLLSPRGSRPTWGPTDPRHRSRNLGKVIDTLTCGFADLMGYIPVVGAPVGGVARALAHGVRVLEDGINYATGNLPGCSFSIFLLALLSCVTVPVSAVEVRNISSSYYATNDCSNNSITWQLTNAVLHLPGCVPCENDNGTLRCWIQVTPNVAVKHRGALTHNLRTHVDMIVMAATVCSALYVGDICGAVMIASQAFIISPERHNFTQECNCSIYQGHITGHRMAW...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane virion attachment to host cell virus-mediated perturbation of host defense response host cell endoplasmic reticulum membrane; host cell lipid droplet; host cell mitochondrial membrane; host cell nucleus; membrane; ...
viral budding via host ESCRT complex
host cell cytoplasm; host cell nucleus; viral nucleocapsid
RNA binding structural molecule activity zinc ion binding
Simian immunodeficiency virus agm.vervet
Capsid protein Host cytoplasm Host nucleus Host-virus interaction Lipoprotein Metal-binding Myristate Phosphoprotein Repeat Ribosomal frameshifting RNA-binding Viral budding Viral budding via the host ESCRT complexes Viral nucleoprotein Viral release from host cell Virion Zinc Zinc-finger
MGAATSALNR
MGAATSALNRRQLDEFEHIRLRPNGKKKYQIKHLIWAGKKMDRFGLHEKLLETEEGCKKIIEVLSPLEPTGSEGMKSLYNLVCVLLCVHQEKKVKDTEEALAIVRQCCHLVDKEKTAVTPPGGQQKNNTGGTATPGGSQNFPAQQQGNAWVHVPLSPRTLNAWVKAVEEKKFGAEIVPMFQALSEGCTPYDINQMLNVLGDHQGALQIVKEIINEEAAQWDVTHPPPAGPLPAGQLRDPGGSDIAGTTSTVQEQLEWIYTANPRVDVGAIYRRWIILGLQKCVKMYNPVSVLDIRQGPKEPFKDYVDRFYKAIRAEQASG...
viral budding via host ESCRT complex host cell cytoplasm; host cell nucleus; viral nucleocapsid RNA binding structural molecule activity zinc ion binding Simian immunodeficiency virus agm.vervet Capsid protein Host cytoplasm Host nucleus Host-virus interaction Lipoprotein Metal-binding Myristate Phosphoprotein Repeat...
membrane fusion involved in viral entry into host cell viral entry into host cell virion attachment to host cell
host cell endosome membrane; host cell plasma membrane; membrane; viral envelope; virion membrane
structural molecule activity
Simian immunodeficiency virus agm.vervet
Apoptosis Cleavage on pair of basic residues Coiled coil Disulfide bond Fusion of virus membrane with host membrane Glycoprotein Host cell membrane Host endosome Host membrane Host-virus interaction Membrane Signal Transmembrane Transmembrane helix Viral attachment to host cell Viral envelope protein Viral penetration ...
MKLTLLIGIL
MKLTLLIGILLIGIGVVLNTRQQWVTVFYGVPVWKNSSVQAFCMTPTTRLWATTNSIPDDHDYTEVPLNITEPFEAWADRNPLVAQAGSNIHLLFEQTLKPCVKLSPLCIKMSCVELNSSEPTTTPKSTTASTTNITASTTTLPCVQNKTSTVLESCNETIIEKELNEEPASNCTFAMAGYVRDQKKKYSVVWNDAEIMCKKGNNSNRECYMIHCNDSVIKEACDKTYWDELRLRYCAPAGFALLKCNDYDYAGFKTNCSNVSVVHCTNLINTTVTTGLLLNGSYSENRTQIWQKHRVSNDSVLVLFNKHYNLTVTCKRP...
membrane fusion involved in viral entry into host cell viral entry into host cell virion attachment to host cell host cell endosome membrane; host cell plasma membrane; membrane; viral envelope; virion membrane structural molecule activity Simian immunodeficiency virus agm.vervet Apoptosis Cleavage on pair of basic r...
viral budding via host ESCRT complex
host cell cytoplasm; host cell nucleus; viral nucleocapsid
RNA binding structural molecule activity zinc ion binding
Simian immunodeficiency virus agm.vervet
Capsid protein Host cytoplasm Host nucleus Host-virus interaction Lipoprotein Metal-binding Myristate Phosphoprotein Repeat Ribosomal frameshifting RNA-binding Viral budding Viral budding via the host ESCRT complexes Viral nucleoprotein Viral release from host cell Virion Zinc Zinc-finger
MGAATSALNR
MGAATSALNRRQLDKFEHIRLRPTGKKKYQIKHLIWAGKEMERFGLHERLLESEEGCKKIIEVLYPLEPTGSEGLKSLFNLVCVLFCVHKDKEVKDTEEAVAIVRQCCHLVEKERNAERNTTETSSGQKKNDKGVTVPPGGSQNFPAQQQGNAWIHVPLSPRTLNAWVKAVEEKKFGAEIVPMFQALSEGCTPYDINQMLNVLGDHQGALQIVKEIINEEAAQWDIAHPPPAGPLPAGQLRDPRGSDIAGTTSTVQEQLEWIYTANPRVDVGAIYRRWIILGLQKCVKMYNPVSVLDIRQGPKEAFKDYVDRFYKAIRAE...
viral budding via host ESCRT complex host cell cytoplasm; host cell nucleus; viral nucleocapsid RNA binding structural molecule activity zinc ion binding Simian immunodeficiency virus agm.vervet Capsid protein Host cytoplasm Host nucleus Host-virus interaction Lipoprotein Metal-binding Myristate Phosphoprotein Repeat...
cell surface receptor signaling pathway cellular response to calcium ion common myeloid progenitor cell proliferation inositol phosphate biosynthetic process inositol trisphosphate metabolic process MAPK cascade myeloid cell homeostasis negative regulation of myeloid cell differentiation negative regulation of neutroph...
cytoplasm; cytoskeleton; cytosol; endoplasmic reticulum; membrane; nucleus
ATP binding calmodulin binding inositol tetrakisphosphate kinase activity inositol-1,4,5-trisphosphate 3-kinase activity
Homo sapiens
Alternative splicing ATP-binding Calmodulin-binding Cytoplasm Cytoskeleton Endoplasmic reticulum Kinase Nucleotide-binding Phosphoprotein Reference proteome Transferase
MAVYCYALNS
MAVYCYALNSLVIMNSANEMKSGGGPGPSGSETPPPPRRAVLSPGSVFSPGRGASFLFPPAESLSPEEPRSPGGWRSGRRRLNSSSGSGSGSSGSSVSSPSWAGRLRGDRQQVVAAGTLSPPGPEEAKRKLRILQRELQNVQVNQKVGMFEAHIQAQSSAIQAPRSPRLGRARSPSPCPFRSSSQPPGRVLVQGARSEERRTKSWGEQCPETSGTDSGRKGGPSLCSSQVKKGMPPLPGRAAPTGSEAQGPSAFVRMEKGIPASPRCGSPTAMEIDKRGSPTPGTRSCLAPSLGLFGASLTMATEVAARVTSTGPHRPQD...
cell surface receptor signaling pathway cellular response to calcium ion common myeloid progenitor cell proliferation inositol phosphate biosynthetic process inositol trisphosphate metabolic process MAPK cascade myeloid cell homeostasis negative regulation of myeloid cell differentiation negative regulation of neutroph...
maintenance of transcriptional fidelity during transcription elongation by RNA polymerase II RNA-templated transcription transcription by RNA polymerase II transcription elongation by RNA polymerase II transcription initiation at RNA polymerase II promoter transcription-coupled nucleotide-excision repair
nucleolus; nucleus; RNA polymerase II, core complex
DNA-directed 5'-3' RNA polymerase activity nucleic acid binding zinc ion binding
Saccharomyces cerevisiae
3D-structure Direct protein sequencing DNA damage DNA repair DNA-directed RNA polymerase Metal-binding Nucleus Phosphoprotein Reference proteome Transcription Zinc Zinc-finger
MTTFRFCRDC
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
maintenance of transcriptional fidelity during transcription elongation by RNA polymerase II RNA-templated transcription transcription by RNA polymerase II transcription elongation by RNA polymerase II transcription initiation at RNA polymerase II promoter transcription-coupled nucleotide-excision repair nucleolus; nuc...
nucleolar large rRNA transcription by RNA polymerase I ribosome biogenesis termination of RNA polymerase I transcription termination of RNA polymerase III transcription transcription by RNA polymerase I transcription by RNA polymerase III transcription elongation by RNA polymerase I transcription initiation at RNA poly...
nucleoplasm; nucleus; RNA polymerase I complex; RNA polymerase III complex
DNA binding protein dimerization activity RNA polymerase I activity
Saccharomyces cerevisiae
3D-structure Direct protein sequencing DNA-directed RNA polymerase Isopeptide bond Nucleus Phosphoprotein Reference proteome Ribosome biogenesis Transcription Ubl conjugation
MTEDIEQKKT
MTEDIEQKKTATEVTPQEPKHIQEEEEQDVDMTGDEEQEEEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVIMKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKSM
nucleolar large rRNA transcription by RNA polymerase I ribosome biogenesis termination of RNA polymerase I transcription termination of RNA polymerase III transcription transcription by RNA polymerase I transcription by RNA polymerase III transcription elongation by RNA polymerase I transcription initiation at RNA poly...
intronic box C/D RNA processing maturation of 5.8S rRNA nuclear-transcribed mRNA catabolic process, RNase MRP-dependent rRNA processing tRNA 5'-leader removal tRNA processing
cytoplasm; nucleolar ribonuclease P complex; ribonuclease MRP complex
ribonuclease MRP activity ribonuclease P activity ribonuclease P RNA binding RNA binding
Saccharomyces cerevisiae
3D-structure Cytoplasm Hydrolase Nucleus Reference proteome rRNA processing tRNA processing
MVRLKSRYIL
MVRLKSRYILFEIIFPPTDTNVEESVSKADILLSHHRASPADVSIKSILQEIRRSLSLNLGDYGSAKCNSLLQLKYFSNKTSTGIIRCHREDCDLVIMALMLMSKIGDVDGLIVNPVKVSGTIKKIEQFAMRRNSKILNIIKCSQSSHLSDNDFIINDFKKIGRENENENEDD
intronic box C/D RNA processing maturation of 5.8S rRNA nuclear-transcribed mRNA catabolic process, RNase MRP-dependent rRNA processing tRNA 5'-leader removal tRNA processing cytoplasm; nucleolar ribonuclease P complex; ribonuclease MRP complex ribonuclease MRP activity ribonuclease P activity ribonuclease P RNA bindin...
snoRNA guided rRNA pseudouridine synthesis snRNA pseudouridine synthesis
box H/ACA snoRNP complex; nucleolus
box H/ACA snoRNA binding
Saccharomyces cerevisiae
3D-structure Isopeptide bond Methylation Nucleus Reference proteome Repeat Ribonucleoprotein Ribosome biogenesis RNA-binding rRNA processing Ubl conjugation
MSFRGGNRGG
MSFRGGNRGGRGGFRGGFRGGRTGSARSFQQGPPDTVLEMGAFLHPCEGDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTIKCGDGVQATSFKEGDKFYIAADKLLPIERFLPKPKVVGPPKPKNKKKRSGAPGGRGGASMGRGGSRGGFRGGRGGSSFRGGRGGSSFRGGSRGGSFRGGSRGGSRGGFRGGRR
snoRNA guided rRNA pseudouridine synthesis snRNA pseudouridine synthesis box H/ACA snoRNP complex; nucleolus box H/ACA snoRNA binding Saccharomyces cerevisiae 3D-structure Isopeptide bond Methylation Nucleus Reference proteome Repeat Ribonucleoprotein Ribosome biogenesis RNA-binding rRNA processing Ubl conjugation MSF...
anterior/posterior axis specification canonical Wnt signaling pathway embryonic axis specification negative regulation of cardiac cell fate specification neural crest cell fate commitment positive regulation of DNA-binding transcription factor activity positive regulation of transcription by RNA polymerase II Spemann o...
collagen-containing extracellular matrix; extracellular region
frizzled binding protease binding
Xenopus laevis
3D-structure Developmental protein Disulfide bond Extracellular matrix Glycoprotein Lipoprotein Reference proteome Secreted Signal Wnt signaling pathway
MQNTTLFILA
MQNTTLFILATLLIFCPFFTASAWSVNNFLMTGPKAYLTYSASVAVGAQNGIEECKYQFAWERWNCPESTLQLATHNGLRSATRETSFVHAISSAGVMYTLTRNCSMGDFDNCGCDDSRNGRIGGRGWVWGGCSDNAEFGERISKLFVDGLETGQDARALMNLHNNEAGRLAVKETMKRTCKCHGISGSCSIQTCWLQLAEFRDIGNHLKIKHDQALKLEMDKRKMRSGNSADNRGAIADAFSSVAGSELIFLEDSPDYCLKNISLGLQGTEGRECLQSGKNLSQWERRSCKRLCTDCGLRVEEKKTEIISSCNCKFHWC...
anterior/posterior axis specification canonical Wnt signaling pathway embryonic axis specification negative regulation of cardiac cell fate specification neural crest cell fate commitment positive regulation of DNA-binding transcription factor activity positive regulation of transcription by RNA polymerase II Spemann o...
10-formyltetrahydrofolate catabolic process bile acid signaling pathway folic acid metabolic process NADPH regeneration one-carbon metabolic process tetrahydrofolate biosynthetic process
cytosol; protein-containing complex
aldehyde dehydrogenase (NAD+) activity aldehyde dehydrogenase (NADP+) activity aldehyde dehydrogenase activity formyltetrahydrofolate dehydrogenase activity protein-containing complex binding
Rattus norvegicus
3D-structure Acetylation Cytoplasm Direct protein sequencing NADP One-carbon metabolism Oxidoreductase Phosphopantetheine Phosphoprotein Reference proteome
MKIAVIGQSL
MKIAVIGQSLFGQEVYCQLRKEGHEVVGVFTIPDKDGKADPLGLEAEKDGVPVFKFPRWRARGQALPEVVAKYQALGAELNVLPFCSQFIPMEVINAPRHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAVRLIAEGTAPRCPQSEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACGQKLTFFNSTLNTSGLSTQGEALPIPGAHRPGVVTKAGLILFGNDDRMLLVKNIQLEDGKMMPASQFFKGSASSDLELTEAE...
10-formyltetrahydrofolate catabolic process bile acid signaling pathway folic acid metabolic process NADPH regeneration one-carbon metabolic process tetrahydrofolate biosynthetic process cytosol; protein-containing complex aldehyde dehydrogenase (NAD+) activity aldehyde dehydrogenase (NADP+) activity aldehyde dehydroge...
fatty acid metabolic process lipopolysaccharide catabolic process negative regulation of inflammatory response
cytoplasmic vesicle; extracellular region
acyloxyacyl hydrolase activity calcium ion binding
Homo sapiens
3D-structure Alternative splicing Calcium Cytoplasmic vesicle Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Lipid metabolism Metal-binding Reference proteome Secreted Signal Zymogen
MQSPWKILTV
MQSPWKILTVAPLFLLLSLQSSASPANDDQSRPSLSNGHTCVGCVLVVSVIEQLAQVHNSTVQASMERLCSYLPEKLFLKTTCYLVIDKFGSDIIKLLSADMNADVVCHTLEFCKQNTGQPLCHLYPLPKETWKFTLQKARQIVKKSPILKYSRSGSDICSLPVLAKICQKIKLAMEQSVPFKDVDSDKYSVFPTLRGYHWRGRDCNDSDESVYPGRRPNNWDVHQDSNCNGIWGVDPKDGVPYEKKFCEGSQPRGIILLGDSAGAHFHISPEWITASQMSLNSFINLPTALTNELDWPQLSGATGFLDSTVGIKEKSIY...
fatty acid metabolic process lipopolysaccharide catabolic process negative regulation of inflammatory response cytoplasmic vesicle; extracellular region acyloxyacyl hydrolase activity calcium ion binding Homo sapiens 3D-structure Alternative splicing Calcium Cytoplasmic vesicle Direct protein sequencing Disulfide bond ...
adenylate cyclase-modulating G protein-coupled receptor signaling pathway cellular response to cGMP dauer larval development defense response to Gram-negative bacterium determination of adult lifespan G protein-coupled receptor signaling pathway negative regulation of gene expression phototransduction positive regulati...
axon; heterotrimeric G-protein complex; neuronal cell body; non-motile cilium
G protein-coupled receptor binding G-protein beta/gamma-subunit complex binding GTP binding GTPase activity metal ion binding olfactory receptor binding
Caenorhabditis elegans
GTP-binding Lipoprotein Magnesium Metal-binding Myristate Nucleotide-binding Palmitate Reference proteome Transducer
MGLCQSAEDK
MGLCQSAEDKELTLKSKAIDKEMMQNHMSQQKVVKLLLLGAGECGKSTVLKQMRILHDHGFTAEEAEQQKSVVFNNTLQAMTAILKGMEALRMTFDKPIRENDAKFVMESHKMLQEAKVFPEELANAIQALWNDKAVQQVIAKGNEFQMPESAPHFLSSLDRIKLPDYNPTEQDILLSRIKTTGIVEVKFQMKSVDFRVFDVGGQRSERKKWIHCFEDVNAIIFIAAISEYDQVLFEDETTNRMIESMRLFESICNSRWFINTSMILFLNKKDLFAEKIKRTSIKSAFPDYKGAQTYDESCRYIEEKFDGLNANPEKTIY...
adenylate cyclase-modulating G protein-coupled receptor signaling pathway cellular response to cGMP dauer larval development defense response to Gram-negative bacterium determination of adult lifespan G protein-coupled receptor signaling pathway negative regulation of gene expression phototransduction positive regulati...
cellular response to UV-A collagen catabolic process extracellular matrix organization proteolysis
extracellular matrix; extracellular space
metalloendopeptidase activity peptidase activity zinc ion binding
Bos taurus
Calcium Collagen degradation Direct protein sequencing Disulfide bond Extracellular matrix Glycoprotein Hydrolase Metal-binding Metalloprotease Phosphoprotein Protease Reference proteome Repeat Secreted Signal Zinc Zymogen
MPRLPLLLLL
MPRLPLLLLLLWGTGSHGFPAATSETQEQDVETVKKYLENYYNLNSNGKKVERQRNGGLITEKLKQMQKFFGLRVTGKPDAETLNVMKQPRCGVPDVAPFVLTPGKSCWENTNLTYRIENYTPDLSRADVDQAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGAGIGGDAHFDDDEWWTSNFQDYNLYRVAAHEFGHSLGLAHSTDIGALMYPSYTFSGDVQLSQDDIDGIQAIYGPSQNPTQPVGPQTPEVCDSKLTFDAITTIRGEVMFFKDRFYMRTNPLYPEVELNFISVF...
cellular response to UV-A collagen catabolic process extracellular matrix organization proteolysis extracellular matrix; extracellular space metalloendopeptidase activity peptidase activity zinc ion binding Bos taurus Calcium Collagen degradation Direct protein sequencing Disulfide bond Extracellular matrix Glycoprotei...
proteasomal protein catabolic process
cytoplasm; proteasome core complex, beta-subunit complex
endopeptidase activity threonine-type endopeptidase activity
Thermoplasma acidophilum
3D-structure Autocatalytic cleavage Cytoplasm Direct protein sequencing Hydrolase Protease Proteasome Reference proteome Threonine protease Zymogen
MNQTLETGTT
MNQTLETGTTTVGITLKDAVIMATERRVTMENFIMHKNGKKLFQIDTYTGMTIAGLVGDAQVLVRYMKAELELYRLQRRVNMPIEAVATLLSNMLNQVKYMPYMVQLLVGGIDTAPHVFSIDAAGGSVEDIYASTGSGSPFVYGVLESQYSEKMTVDEGVDLVIRAISAAKQRDSASGGMIDVAVITRKDGYVQLPTDQIESRIRKLGLIL
proteasomal protein catabolic process cytoplasm; proteasome core complex, beta-subunit complex endopeptidase activity threonine-type endopeptidase activity Thermoplasma acidophilum 3D-structure Autocatalytic cleavage Cytoplasm Direct protein sequencing Hydrolase Protease Proteasome Reference proteome Threonine protease...
antigen processing and presentation fat cell differentiation proteasomal protein catabolic process regulation of endopeptidase activity
cytosol; extracellular exosome; nucleoplasm; nucleus; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex; spermatoproteasome complex
endopeptidase activity threonine-type endopeptidase activity
Homo sapiens
3D-structure Alternative splicing Cytoplasm Differentiation Disease variant Host-virus interaction Hydrolase Immunity Nucleus Phosphoprotein Protease Proteasome Reference proteome Threonine protease Zymogen
MALLDVCGAP
MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
antigen processing and presentation fat cell differentiation proteasomal protein catabolic process regulation of endopeptidase activity cytosol; extracellular exosome; nucleoplasm; nucleus; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex; spermatoproteasome complex endopeptida...
antigen processing and presentation fat cell differentiation proteasomal protein catabolic process
cytosol; nucleoplasm; nucleus; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex; spermatoproteasome complex
endopeptidase activity threonine-type endopeptidase activity
Mus musculus
3D-structure Cytoplasm Differentiation Hydrolase Immunity Nucleus Protease Proteasome Reference proteome Threonine protease Zymogen
MALLDLCGAA
MALLDLCGAARGQRPEWAALDAGSGGRSDPGHYSFSAQAPELALPRGMQPTAFLRSFGGDQERNVQIEMAHGTTTLAFKFQHGVIVAVDSRATAGSYISSLRMNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMLQYRGMGLSMGSMICGWDKKGPGLYYVDDNGTRLSGQMFSTGSGNTYAYGVMDSGYRQDLSPEEAYDLGRRAIAYATHRDNYSGGVVNMYHMKEDGWVKVESSDVSDLLYKYGEAAL
antigen processing and presentation fat cell differentiation proteasomal protein catabolic process cytosol; nucleoplasm; nucleus; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex; spermatoproteasome complex endopeptidase activity threonine-type endopeptidase activity Mus muscul...
immune system process proteasomal protein catabolic process regulation of cysteine-type endopeptidase activity
cytosol; extracellular exosome; nucleoplasm; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex; spermatoproteasome complex
endopeptidase activity threonine-type endopeptidase activity
Homo sapiens
3D-structure Acetylation Alternative splicing Cytoplasm Host-virus interaction Hydrolase Immunity Nucleus Protease Proteasome Reference proteome Threonine protease Zymogen
MLRAGAPTGD
MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
immune system process proteasomal protein catabolic process regulation of cysteine-type endopeptidase activity cytosol; extracellular exosome; nucleoplasm; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex; spermatoproteasome complex endopeptidase activity threonine-type endopep...
adaptive immune response antigen processing and presentation of exogenous peptide antigen via MHC class II peptide antigen assembly with MHC class II protein complex positive regulation of immune response positive regulation of T cell activation
cell surface; intracellular membrane-bounded organelle; late endosome membrane; lysosomal membrane; membrane; MHC class II protein complex
MHC class II protein complex binding peptide antigen binding
Homo sapiens
3D-structure Adaptive immunity Disulfide bond Endosome Glycoprotein Immunity Lysosome Membrane MHC II Reference proteome Signal Transmembrane Transmembrane helix
MGHEQNQGAA
MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWHDHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLGVLGIIVGIVLIIYFRKPCSGD
adaptive immune response antigen processing and presentation of exogenous peptide antigen via MHC class II peptide antigen assembly with MHC class II protein complex positive regulation of immune response positive regulation of T cell activation cell surface; intracellular membrane-bounded organelle; late endosome memb...
adaptive immune response antigen processing and presentation of exogenous peptide antigen via MHC class II MHC class II protein complex assembly peptide antigen assembly with MHC class II protein complex positive regulation of immune response positive regulation of T cell activation positive regulation of T cell activa...
intracellular membrane-bounded organelle; late endosome membrane; lysosomal membrane; MHC class II protein complex
MHC class II protein complex binding peptide antigen binding
Homo sapiens
3D-structure Adaptive immunity Disulfide bond Endosome Glycoprotein Immunity Immunoglobulin domain Lysosome Membrane MHC II Reference proteome Signal Transmembrane Transmembrane helix
MITFLPLLLG
MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS
adaptive immune response antigen processing and presentation of exogenous peptide antigen via MHC class II MHC class II protein complex assembly peptide antigen assembly with MHC class II protein complex positive regulation of immune response positive regulation of T cell activation positive regulation of T cell activa...
adenohypophysis development negative regulation of cell population proliferation negative regulation of transcription by RNA polymerase II positive regulation of transcription by RNA polymerase II regulation of DNA-templated transcription regulation of transcription by RNA polymerase II
chromatin; cytosol; nucleoplasm; nucleus
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific lncRNA binding RNA polymerase II cis-regulatory region sequence-specific DNA binding RNA polymerase II-specific DNA-binding transcripti...
Homo sapiens
3D-structure Activator Alternative splicing Disease variant DNA-binding Dwarfism Homeobox Nucleus Reference proteome Transcription Transcription regulation
MSCQAFTSAD
MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHYGNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR
adenohypophysis development negative regulation of cell population proliferation negative regulation of transcription by RNA polymerase II positive regulation of transcription by RNA polymerase II regulation of DNA-templated transcription regulation of transcription by RNA polymerase II chromatin; cytosol; nucleoplasm;...
negative regulation of inflammatory response to antigenic stimulus proteasomal protein catabolic process proteasome-mediated ubiquitin-dependent protein catabolic process
ciliary basal body; cytoplasm; cytosol; extracellular exosome; mitochondrion; nucleoplasm; nucleus; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex
lipopolysaccharide binding
Homo sapiens
3D-structure Acetylation Cytoplasm Direct protein sequencing Disease variant Host-virus interaction Nucleus Phosphoprotein Proteasome Reference proteome
MEAFLGSRSG
MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE
negative regulation of inflammatory response to antigenic stimulus proteasomal protein catabolic process proteasome-mediated ubiquitin-dependent protein catabolic process ciliary basal body; cytoplasm; cytosol; extracellular exosome; mitochondrion; nucleoplasm; nucleus; proteasome complex; proteasome core complex; prot...
proteasomal protein catabolic process proteasome-mediated ubiquitin-dependent protein catabolic process
cytoplasm; cytosol; extracellular exosome; mitochondrion; nucleoplasm; nucleus; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex
cadherin binding endopeptidase activity threonine-type endopeptidase activity
Homo sapiens
3D-structure Acetylation Cytoplasm Direct protein sequencing Host-virus interaction Hydrolase Nucleus Phosphoprotein Protease Proteasome Reference proteome Threonine protease Zymogen
MAATLLAARG
MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFAVATLPPA
proteasomal protein catabolic process proteasome-mediated ubiquitin-dependent protein catabolic process cytoplasm; cytosol; extracellular exosome; mitochondrion; nucleoplasm; nucleus; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex cadherin binding endopeptidase activity threo...
proteasomal protein catabolic process
cytoplasm; nucleus; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex
endopeptidase activity threonine-type endopeptidase activity
Rattus norvegicus
3D-structure Acetylation Cytoplasm Direct protein sequencing Hydrolase Nucleus Phosphoprotein Protease Proteasome Reference proteome Threonine protease Zymogen
MAAALAVRGA
MAAALAVRGAVSAPAFGPEALTPDWENREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKDECLQFTANALALAMERDGSSGGVIRLAAIQQSGVERQVLLGDQIPKVTISTLPPP
proteasomal protein catabolic process cytoplasm; nucleus; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex endopeptidase activity threonine-type endopeptidase activity Rattus norvegicus 3D-structure Acetylation Cytoplasm Direct protein sequencing Hydrolase Nucleus Phosphoprotei...
proteasomal protein catabolic process proteasome-mediated ubiquitin-dependent protein catabolic process proteolysis response to oxidative stress
centrosome; cytoplasm; cytosol; extracellular exosome; nucleoplasm; nucleus; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex
endopeptidase activity peptidase activity threonine-type endopeptidase activity
Homo sapiens
3D-structure Alternative splicing Cytoplasm Direct protein sequencing Host-virus interaction Hydrolase Nucleus Protease Proteasome Reference proteome Threonine protease Zymogen
MALASVLERP
MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSGSTP
proteasomal protein catabolic process proteasome-mediated ubiquitin-dependent protein catabolic process proteolysis response to oxidative stress centrosome; cytoplasm; cytosol; extracellular exosome; nucleoplasm; nucleus; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex endopep...
proteasomal protein catabolic process proteasome-mediated ubiquitin-dependent protein catabolic process proteolysis response to oxidative stress
cytoplasm; nucleus; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex
endopeptidase activity peptidase activity threonine-type endopeptidase activity
Rattus norvegicus
3D-structure Cytoplasm Direct protein sequencing Hydrolase Nucleus Protease Proteasome Reference proteome Threonine protease Zymogen
MALASVLQRP
MALASVLQRPMPVNQHGFFGLGGRADLLDLGPGSPGDGLSLAAPSWGVPEEPRIEMLHGTTTLAFKFQHGVIVAADSRATAGPYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAFGVMDRGYSYDLQVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYTSSIP
proteasomal protein catabolic process proteasome-mediated ubiquitin-dependent protein catabolic process proteolysis response to oxidative stress cytoplasm; nucleus; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex endopeptidase activity peptidase activity threonine-type endopep...
antigen processing and presentation proteasomal protein catabolic process response to bacterium
cytosol; nucleoplasm; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex; spermatoproteasome complex
endopeptidase activity proteasome binding threonine-type endopeptidase activity
Mus musculus
3D-structure Acetylation Cytoplasm Hydrolase Immunity Nucleus Protease Proteasome Reference proteome Threonine protease Zymogen
MLRAGAPTAG
MLRAGAPTAGSFRTEEVHTGTTIMAVEFDGGVVVGSDSRVSAGTAVVNRVFDKLSPLHQRIFCALSGSAADAQAIADMAAYQLELHGLELEEPPLVLAAANVVKNISYKYREDLLAHLIVAGWDQREGGQVYGTMGGMLIRQPFTIGGSGSSYIYGYVDAAYKPGMTPEECRRFTTNAITLAMNRDGSSGGVIYLVTITAAGVDHRVILGDELPKFYDE
antigen processing and presentation proteasomal protein catabolic process response to bacterium cytosol; nucleoplasm; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex; spermatoproteasome complex endopeptidase activity proteasome binding threonine-type endopeptidase activity Mus...
antigen processing and presentation cellular response to electrical stimulus cellular response to interleukin-1 cellular response to virus liver development muscle atrophy proteasomal protein catabolic process response to alkaloid response to bacterium response to benzene response to xenobiotic stimulus spleen developm...
cytoplasm; nucleus; proteasome complex; proteasome core complex; proteasome core complex, beta-subunit complex; spermatoproteasome complex
endopeptidase activity proteasome binding threonine-type endopeptidase activity
Rattus norvegicus
Acetylation Cytoplasm Direct protein sequencing Hydrolase Immunity Nucleus Protease Proteasome Reference proteome Threonine protease Zymogen
MLQAGAPTAG
MLQAGAPTAGSFRTGEVHTGTTIMAVEFDGGVVVGSDSRVSAGAAVVNRVFDKLSPLHQRIYCALSGSAADAQAIADMAAYQLELHGLELEEPPLVLAAANIVKNISYKYREDLLAHLMVAGWDQHEGGQVYGTMGGMLIRQPFAIGGSGSTYIYGYVDAAYKPGMTPEECRRFTTDAITLAMNRDGSSGGVIYLVTITADGVDHRVILGDELPKFYDE
antigen processing and presentation cellular response to electrical stimulus cellular response to interleukin-1 cellular response to virus liver development muscle atrophy proteasomal protein catabolic process response to alkaloid response to bacterium response to benzene response to xenobiotic stimulus spleen developm...
antigen processing and presentation antigen processing and presentation of exogenous peptide antigen via MHC class II chaperone cofactor-dependent protein refolding immunoglobulin mediated immune response inner ear development peptide antigen assembly with MHC class II protein complex positive regulation of germinal ce...
cell surface; endosome membrane; intracellular membrane-bounded organelle; late endosome; late endosome membrane; lysosomal membrane; lysosome; MHC class II protein complex; multivesicular body
MHC class II protein complex binding peptide antigen binding
Mus musculus
3D-structure Adaptive immunity Disulfide bond Endosome Glycoprotein Immunity Lysosome Membrane MHC II Reference proteome Signal Transmembrane Transmembrane helix
MEHEQKSGAV
MEHEQKSGAVLLRLLRLLWLLPHSWAVLEASTPVLWDDPQNHTFRHTLFCQDGIPNIGLSETYDEDELFSFDFSQNTRVPRLPDFAEWAQGQGDASAIAFGKSFCEMLMREVSPKLEGQIPVSRGLSVAEVFTLKPLEFGKPNTLVCFISNLFPPTLTVNWQLHSAPVEGASPTSISAVDGLTFQAFSYLNFTPEPFDLYSCTVTHEIDRYTAIAYWVPQNALPSDLLENALCGVAFALGVLGTIIGIVFFLCSQRPCSGD
antigen processing and presentation antigen processing and presentation of exogenous peptide antigen via MHC class II chaperone cofactor-dependent protein refolding immunoglobulin mediated immune response inner ear development peptide antigen assembly with MHC class II protein complex positive regulation of germinal ce...
asymmetric cell division cell fate determination crystal cell differentiation hemopoiesis imaginal disc-derived leg morphogenesis imaginal disc-derived wing vein morphogenesis long-term memory negative regulation of compound eye cone cell fate specification negative regulation of DNA-templated transcription negative re...
CSL-Notch-Mastermind transcription factor complex; cytoplasm; nucleoplasm; nucleus; polytene chromosome; protein-containing complex; RNA polymerase II transcription repressor complex; transcription repressor complex
DNA binding DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity, RNA polymerase II-specific histone acetyltransferase binding RNA polymerase II cis-regulatory region sequence-specific DNA binding RNA polymerase II transcription regulatory region sequence-sp...
Drosophila melanogaster
3D-structure Activator Cytoplasm Developmental protein DNA-binding Notch signaling pathway Nucleus Reference proteome Repeat Repressor Transcription Transcription regulation
MKSYSQFNLN
MKSYSQFNLNAAAPPAIAYETTVVNPNGSPLDPHQQQQQQSQDMPHFGLPGPQPPSSQQQQQQLQVHHQQQQQQQQQQQQQQHQQQMQMSLLPGPYRPHIEEKKLTRDAMEKYMRERNDMVIVILHAKVAQKSYGNEKRFFCPPPCIYLFGSGWRRRYEEMLQQGEGEQGAQLCAFIGIGSSDQDMQQLDLNGKQYCAAKTLFISDSDKRKHFMLSVKMFYGNGHDIGVFNSKRIKVISKPSKKKQSLKNADLCIASGTNVALFNRLRSQTVSTRYLHVENGHFHASSTQWGAFTIHLLDDNESESEEFQVRDGYIHYGA...
asymmetric cell division cell fate determination crystal cell differentiation hemopoiesis imaginal disc-derived leg morphogenesis imaginal disc-derived wing vein morphogenesis long-term memory negative regulation of compound eye cone cell fate specification negative regulation of DNA-templated transcription negative re...
cellular detoxification of nitrogen compound cellular response to caffeine glutathione metabolic process hepoxilin biosynthetic process linoleic acid metabolic process negative regulation of ryanodine-sensitive calcium-release channel activity nitrobenzene metabolic process positive regulation of ryanodine-sensitive ca...
cytoplasm; cytosol; extracellular exosome; intercellular bridge; sarcoplasmic reticulum
enzyme binding fatty acid binding glutathione binding glutathione peroxidase activity glutathione transferase activity protein homodimerization activity signaling receptor binding
Homo sapiens
3D-structure Alternative splicing Cytoplasm Direct protein sequencing Lipid metabolism Phosphoprotein Reference proteome Transferase
MPMTLGYWNI
MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
cellular detoxification of nitrogen compound cellular response to caffeine glutathione metabolic process hepoxilin biosynthetic process linoleic acid metabolic process negative regulation of ryanodine-sensitive calcium-release channel activity nitrobenzene metabolic process positive regulation of ryanodine-sensitive ca...
cell adhesion hemolymph coagulation protein processing
extracellular region
carbohydrate binding serine-type endopeptidase activity
Tachypleus tridentatus
Alternative splicing Cell adhesion Direct protein sequencing Disulfide bond EGF-like domain Glycoprotein Hemolymph clotting Hydrolase Lectin Protease Repeat Secreted Serine protease Signal Sushi
MVLASFLVSG
MVLASFLVSGLVLGILAQQMRPVQSRGVDLGLCDETRFECKCGDPGYVFNVPMKQCTYFYRWRPYCKPCDDLEAKDICPKYKRCQECKAGLDSCVTCPPNKYGTWCSGECQCKNGGICDQRTGACTCRDRYEGAHCEILKGCPLLPSDSQVQEVRNPPDNPQTIDYSCSPGFKLKGVARISCLPNGQWSSFPPKCIRECAKVSSPEHGKVNAPSGNMIEGATLRFSCDSPYYLIGQETLTCQGNGQWSGQIPQCKKLVFCPDLDPVNHAEHQVKIGVEQKYGQFPQGTEVTYTCSGNYFLMGFNTLKCNPDGSWSGSQPS...
cell adhesion hemolymph coagulation protein processing extracellular region carbohydrate binding serine-type endopeptidase activity Tachypleus tridentatus Alternative splicing Cell adhesion Direct protein sequencing Disulfide bond EGF-like domain Glycoprotein Hemolymph clotting Hydrolase Lectin Protease Repeat Secreted...
bleb assembly cellular response to diterpene chemotaxis to cAMP negative regulation of Ras protein signal transduction polyphosphate-mediated signaling positive regulation of macropinocytosis protein phosphorylation pseudopodium assembly regulation of cell migration regulation of chemotaxis response to differentiation-...
cytoplasm; nucleus; plasma membrane
ATP binding cAMP-dependent protein kinase activity protein serine kinase activity
Dictyostelium discoideum
ATP-binding cAMP Cell membrane Chemotaxis Cytoplasm Kinase Lipoprotein Membrane Myristate Nucleotide-binding Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase
MGKGQSKIKN
MGKGQSKIKNGGSGKPAKAGKPKKGNKNDETTPTSTPTPTPTPTQQNLDNSAQQQQQQQQTTTAAVSLDNKEQQQQQNIPAPATQTPITQTGTPTIEESQKNTDNNNINGASNEASSSPDSPNGSGNGNDDEDEGPEEVIFSKNKQSATKDDFELLNVIGKGSFGKVMQVKKKGEDKIFAMKVLRKDAIIARKQVNHTKSEKTILQCISHPFIVNLHYAFQTKDKLYMVLDFVNGGELFFHLKREGRFSEPRVKIYAAEIVSALDHLHKQDIVYRDLKPENILLDSEGHICITDFGLSKKIETTDGTFTFCGTPEYLAPE...
bleb assembly cellular response to diterpene chemotaxis to cAMP negative regulation of Ras protein signal transduction polyphosphate-mediated signaling positive regulation of macropinocytosis protein phosphorylation pseudopodium assembly regulation of cell migration regulation of chemotaxis response to differentiation-...
cell wall biogenesis protein transport response to auxin
cytosol; endosome; extracellular region; plasma membrane
GTP binding GTPase activity
Arabidopsis thaliana
3D-structure Cell membrane GTP-binding Lipoprotein Membrane Nucleotide-binding Prenylation Protein transport Reference proteome Transport
MAGYRADEEY
MAGYRADEEYDYLFKLVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATKTTKVEGKVVKAQIWDTAGQERYRAITSAYYRGAVGALLIYDVTRHATFENAARWLRELRGHTDPNIVVMLIGNKCDLRHLVAVKTEEAKAFAERESLYFMETSALDATNVENAFTEVLTQIHKIVSKRSVDGGGESADLPGKGETINVKEDGSVLKRMGCCSN
cell wall biogenesis protein transport response to auxin cytosol; endosome; extracellular region; plasma membrane GTP binding GTPase activity Arabidopsis thaliana 3D-structure Cell membrane GTP-binding Lipoprotein Membrane Nucleotide-binding Prenylation Protein transport Reference proteome Transport MAGYRADEEY MAGYRADE...
inter-Golgi cisterna vesicle-mediated transport response to heat
Golgi membrane; Golgi stack; Golgi-associated vesicle; plasma membrane; trans-Golgi network
GTP binding GTPase activity
Arabidopsis thaliana
Cell membrane Golgi apparatus GTP-binding Lipoprotein Membrane Nucleotide-binding Prenylation Reference proteome
MSDDDERGEE
MSDDDERGEEYLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMLIDGKEVKAQIWDTAGQERFRAVTSAYYRGAVGALVVYDITRSSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLESIRAVSVEEGKSLAESEGLFFMETSALDSTNVKTAFEMVIREIYSNISRKQLNSDSYKEELTVNRVSLVKNENEGTKTFSCCSR
inter-Golgi cisterna vesicle-mediated transport response to heat Golgi membrane; Golgi stack; Golgi-associated vesicle; plasma membrane; trans-Golgi network GTP binding GTPase activity Arabidopsis thaliana Cell membrane Golgi apparatus GTP-binding Lipoprotein Membrane Nucleotide-binding Prenylation Reference proteome M...
endoplasmic reticulum to Golgi vesicle-mediated transport protein transport
extracellular region; Golgi membrane; plant-type vacuole; plasma membrane; trans-Golgi network membrane
GTP binding GTPase activity
Arabidopsis thaliana
ER-Golgi transport Golgi apparatus GTP-binding Lipoprotein Membrane Nucleotide-binding Prenylation Protein transport Reference proteome Transport
MNPEYDYLFK
MNPEYDYLFKLLLIGDSGVGKSCLLLRFSDDSYVESYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDEESFNNVKQWLSEIDRYASDNVNKLLVGNKSDLTENRAIPYETAKAFADEIGIPFMETSAKDATNVEQAFMAMSASIKERMASQPAGNNARPPTVQIRGQPVAQKNGCCST
endoplasmic reticulum to Golgi vesicle-mediated transport protein transport extracellular region; Golgi membrane; plant-type vacuole; plasma membrane; trans-Golgi network membrane GTP binding GTPase activity Arabidopsis thaliana ER-Golgi transport Golgi apparatus GTP-binding Lipoprotein Membrane Nucleotide-binding Pren...
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway adenylate cyclase-inhibiting serotonin receptor signaling pathway chemical synaptic transmission G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger intestine smooth muscle contraction regulation of behavio...
dendrite; plasma membrane; synapse
G protein-coupled serotonin receptor activity neurotransmitter receptor activity
Homo sapiens
3D-structure Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Membrane Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MSPLNQSAEG
MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVLTTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAKAQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKATKILGIILGAFIICWLPFFVV...
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway adenylate cyclase-inhibiting serotonin receptor signaling pathway chemical synaptic transmission G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger intestine smooth muscle contraction regulation of behavio...
AV node cell to bundle of His cell communication by electrical coupling cardiac muscle tissue development cell development cell-cell signaling chemical synaptic transmission gap junction assembly heart development vasculogenesis visual perception
connexin complex; endoplasmic reticulum; gap junction; nucleoplasm; plasma membrane; synapse
gap junction channel activity gap junction channel activity involved in AV node cell-bundle of His cell electrical coupling monoatomic ion channel activity
Mus musculus
Cell junction Cell membrane Gap junction Membrane Reference proteome Transmembrane Transmembrane helix
MSWSFLTRLL
MSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGCENVCYDAFAPLSHVRFWVFQIILVATPSVMYLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETEEDHEEDPMMYPEMELESEKENKEQSQPKPKHDGRRRIREDGLMKIYVLQLLARTVFEVGFLIGQYFLYGFQVHPFYVCSRLPCPHKIDCFISRPTEKTIFLLIMYGVTGLCLLLNIWEMLHLGFGTIRDSLNSKRRELDDPGAYNYPFTWNTPSAPPGYNIAVKPDQIQYTELSNAKIAYKQNKANIAQ...
AV node cell to bundle of His cell communication by electrical coupling cardiac muscle tissue development cell development cell-cell signaling chemical synaptic transmission gap junction assembly heart development vasculogenesis visual perception connexin complex; endoplasmic reticulum; gap junction; nucleoplasm; plasm...
cell-cell signaling epididymis development purine ribonucleotide transport
connexin complex; cytoplasm; gap junction; lateral plasma membrane; plasma membrane; protein-containing complex
gap junction channel activity identical protein binding
Mus musculus
Cell junction Cell membrane Gap junction Membrane Phosphoprotein Reference proteome Transmembrane Transmembrane helix
MNWTGLYTLL
MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGCNSVCYDHFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCEAFPCPNTVDCFVSRPTEKTVFTVFMLAASGICIILNVAEVVYLIIRACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
cell-cell signaling epididymis development purine ribonucleotide transport connexin complex; cytoplasm; gap junction; lateral plasma membrane; plasma membrane; protein-containing complex gap junction channel activity identical protein binding Mus musculus Cell junction Cell membrane Gap junction Membrane Phosphoprotein...
cell-cell signaling cellular response to retinoic acid in utero embryonic development placenta development skin development spermatogenesis
cell junction; cell-cell junction; connexin complex; cytoplasm; gap junction; intracellular membrane-bounded organelle
gap junction channel activity
Mus musculus
Cell junction Cell membrane Gap junction Membrane Reference proteome Transmembrane Transmembrane helix
MDWKKLQDLL
MDWKKLQDLLSGVNQYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKDFDCNTRQPGCTNVCYDNFFPISNIRLWALQLIFVTCPSMLVILHVAYREERERKHRQKHGEQCAKLYSHPGKKHGGLWWTYLFSLIFKLIIELVFLYVLHTLWHGFTMPRLVQCASIVPCPNTVDCYIARPTEKKVFTYFMVGASAVCIILTICEICYLIFHRIMRGISKGKSTKSISSPKSSSRASTCRCHHKLLESGDPEADPASEKLQASAPSLTPI
cell-cell signaling cellular response to retinoic acid in utero embryonic development placenta development skin development spermatogenesis cell junction; cell-cell junction; connexin complex; cytoplasm; gap junction; intracellular membrane-bounded organelle gap junction channel activity Mus musculus Cell junction Cell...
camera-type eye development cell-cell signaling gap junction-mediated intercellular transport lens development in camera-type eye regulation of granulocyte macrophage colony-stimulating factor production
connexin complex; plasma membrane
gap junction channel activity identical protein binding
Mus musculus
Cell junction Cell membrane Direct protein sequencing Disulfide bond Gap junction Membrane Reference proteome Transmembrane Transmembrane helix
MGDWSFLGNI
MGDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPGCENVCYDEAFPISHIRLWVLQIIFVSTPSLMYVGHAVHHVRMEEKRKDREAEELCQQSRSNGGERVPIAPDQASIRKSSSSSKGTKKFRLEGTLLRTYVCHIIFKTLFEVGFIVGHYFLYGFRILPLYRCSRWPCPNVVDCFVSRPTEKTIFILFMLSVAFVSLFLNIMEMSHLGMKGIRSAFKRPVEQPLGEIAEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLSAKPFSQFEEKIGTGPLADMS...
camera-type eye development cell-cell signaling gap junction-mediated intercellular transport lens development in camera-type eye regulation of granulocyte macrophage colony-stimulating factor production connexin complex; plasma membrane gap junction channel activity identical protein binding Mus musculus Cell junction...
glyoxylate cycle tricarboxylic acid cycle
cytoplasm; extracellular region; vacuole
isocitrate lyase activity metal ion binding methylisocitrate lyase activity
Saccharomyces cerevisiae
3D-structure Cytoplasm Extracellular matrix Glyoxylate bypass Lyase Magnesium Metal-binding Phosphoprotein Reference proteome Secreted Tricarboxylic acid cycle Vacuole
MPIPVGNTKN
MPIPVGNTKNDFAALQAKLDADAAEIEKWWSDSRWSKTKRNYSARDIAVRRGTFPPIEYPSSVMARKLFKVLEKHHNEGTVSKTFGALDPVQISQMAKYLDTIYISGWQCSSTASTSNEPGPDLADYPMDTVPNKVEHLFKAQLFHDRKQLEARSKAKSQEELDEMGAPIDYLTPIVADADAGHGGLTAVFKLTKMFIERGAAGIHMEDQTSTNKKCGHMAGRCVIPVQEHVNRLVTIRMCADIMHSDLIVVARTDSEAATLISSTIDTRDHYFIVGATNPNIEPFAEVLNDAIMSGASGQELADIEQKWCRDAGLKLFH...
glyoxylate cycle tricarboxylic acid cycle cytoplasm; extracellular region; vacuole isocitrate lyase activity metal ion binding methylisocitrate lyase activity Saccharomyces cerevisiae 3D-structure Cytoplasm Extracellular matrix Glyoxylate bypass Lyase Magnesium Metal-binding Phosphoprotein Reference proteome Secreted ...
glutamate biosynthetic process isocitrate metabolic process tricarboxylic acid cycle
mitochondrial isocitrate dehydrogenase complex (NAD+); mitochondrion
isocitrate dehydrogenase (NAD+) activity magnesium ion binding NAD binding RNA binding
Saccharomyces cerevisiae
3D-structure Allosteric enzyme Direct protein sequencing Magnesium Manganese Metal-binding Mitochondrion NAD Oxidoreductase Phosphoprotein Reference proteome RNA-binding Transit peptide Tricarboxylic acid cycle
MLRNTFFRNT
MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMM...
glutamate biosynthetic process isocitrate metabolic process tricarboxylic acid cycle mitochondrial isocitrate dehydrogenase complex (NAD+); mitochondrion isocitrate dehydrogenase (NAD+) activity magnesium ion binding NAD binding RNA binding Saccharomyces cerevisiae 3D-structure Allosteric enzyme Direct protein sequenc...
cysteine export across plasma membrane dipeptide transmembrane transport protein transport response to antibiotic xenobiotic detoxification by transmembrane export across the plasma membrane
plasma membrane
cysteine transmembrane transporter activity dipeptide transmembrane transporter activity sodium:proton antiporter activity xenobiotic transmembrane transporter activity
Escherichia coli
Antibiotic resistance Cell inner membrane Cell membrane Membrane Peptide transport Protein transport Reference proteome Transmembrane Transmembrane helix Transport
MTTRQHSSFA
MTTRQHSSFAIVFILGLLAMLMPLSIDMYLPALPVISAQFGVPAGSTQMTLSTYILGFALGQLIYGPMADSFGRKPVVLGGTLVFAAAAVACALANTIDQLIVMRFFHGLAAAAASVVINALMRDIYPKEEFSRMMSFVMLVTTIAPLMAPIVGGWVLVWLSWHYIFWILALAAILASAMIFFLIKETLPPERRQPFHIRTTIGNFAALFRHKRVLSYMLASGFSFAGMFSFLSAGPFVYIEINHVAPENFGYYFALNIVFLFVMTIFNSRFVRRIGALNMFRSGLWIQFIMAAWMVISALLGLGFWSLVVGVAAFVGCV...
cysteine export across plasma membrane dipeptide transmembrane transport protein transport response to antibiotic xenobiotic detoxification by transmembrane export across the plasma membrane plasma membrane cysteine transmembrane transporter activity dipeptide transmembrane transporter activity sodium:proton antiporter...
dTTP biosynthetic process dUMP biosynthetic process dUTP biosynthetic process nucleobase-containing small molecule interconversion protein homotrimerization response to radiation
cytosol; protein-containing complex
dCTP deaminase activity identical protein binding nucleotide binding
Escherichia coli
3D-structure Direct protein sequencing Hydrolase Nucleotide metabolism Nucleotide-binding Reference proteome
MRLCDRDIEA
MRLCDRDIEAWLDEGRLSINPRPPVERINGATVDVRLGNKFRTFRGHTAAFIDLSGPKDEVSAALDRVMSDEIVLDEGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAHRIDPGWSGCIVLEFYNSGKLPLALRPGMLIGALSFEPLSGPAVRPYNRREDAKYRNQQGAVASRIDKD
dTTP biosynthetic process dUMP biosynthetic process dUTP biosynthetic process nucleobase-containing small molecule interconversion protein homotrimerization response to radiation cytosol; protein-containing complex dCTP deaminase activity identical protein binding nucleotide binding Escherichia coli 3D-structure Direct...
negative regulation of gluconeogenesis proteasome-mediated ubiquitin-dependent protein catabolic process protein polyubiquitination ubiquitin-dependent protein catabolic process
cytoplasm; nucleus
ATP binding ubiquitin conjugating enzyme activity ubiquitin-protein transferase activity
Saccharomyces cerevisiae
ATP-binding Cytoplasm Nucleotide-binding Reference proteome Transferase Ubl conjugation pathway
MSSSKRRIET
MSSSKRRIETDVMKLLMSDHQVDLINDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYEEKIKEYIDKYATKEKYQQMFGGDNDSDDSDSGGDLQEEDSDSDEDMDGTGVSSGDDSVDELSEDLSDIDVSDDDDYDEVANQ
negative regulation of gluconeogenesis proteasome-mediated ubiquitin-dependent protein catabolic process protein polyubiquitination ubiquitin-dependent protein catabolic process cytoplasm; nucleus ATP binding ubiquitin conjugating enzyme activity ubiquitin-protein transferase activity Saccharomyces cerevisiae ATP-bind...
citrate metabolic process intestinal absorption intracellular iron ion homeostasis post-embryonic development regulation of gene expression regulation of translation response to iron(II) ion tricarboxylic acid cycle
cytoplasm; cytosol; endoplasmic reticulum; Golgi apparatus; mitochondrion
3 iron, 4 sulfur cluster binding 4 iron, 4 sulfur cluster binding aconitate hydratase activity iron-responsive element binding iron-sulfur cluster binding metal ion binding mRNA 5'-UTR binding RNA binding
Mus musculus
4Fe-4S Cytoplasm Iron Iron-sulfur Lyase Metal-binding Reference proteome RNA-binding Tricarboxylic acid cycle
MKNPFAHLAE
MKNPFAHLAEPLDAAQPGKRFFNLNKLEDSRYGRLPFSIRVLLEAAVRNCDEFLVKKNDIENILNWNVMQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPVCPADLVIDHSIQVDFNRRADSLQKNQDLEFERNKERFEFLKWGSQAFCNMRIIPPGSGIIHQVNLEYLARVVFDQDGCYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLPQVIGYKLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSIAYL...
citrate metabolic process intestinal absorption intracellular iron ion homeostasis post-embryonic development regulation of gene expression regulation of translation response to iron(II) ion tricarboxylic acid cycle cytoplasm; cytosol; endoplasmic reticulum; Golgi apparatus; mitochondrion 3 iron, 4 sulfur cluster bindi...
de novo' pyrimidine nucleobase biosynthetic process 'de novo' UMP biosynthetic process
cytoplasm
dihydroorotate dehydrogenase (fumarate) activity dihydroorotate dehydrogenase activity
Saccharomyces cerevisiae
Cytoplasm Flavoprotein FMN Isopeptide bond Oxidoreductase Pyrimidine biosynthesis Reference proteome Ubl conjugation
MTASLTTKFL
MTASLTTKFLNNTYENPFMNASGVHCMTTQELDELANSKAGAFITKSATTLEREGNPEPRYISVPLGSINSMGLPNEGIDYYLSYVLNRQKNYPDAPAIFFSVAGMSIDENLNLLRKIQDSEFNGITELNLSCPNVPGKPQVAYDFDLTKETLEKVFAFFKKPLGVKLPPYFDFAHFDIMAKILNEFPLAYVNSINSIGNGLFIDVEKESVVVKPKNGFGGIGGEYVKPTALANVRAFYTRLRPEIKVIGTGGIKSGKDAFEHLLCGASMLQIGTELQKEGVKIFERIEKELKDIMEAKGYTSIDQFRGKLNSI
de novo' pyrimidine nucleobase biosynthetic process 'de novo' UMP biosynthetic process cytoplasm dihydroorotate dehydrogenase (fumarate) activity dihydroorotate dehydrogenase activity Saccharomyces cerevisiae Cytoplasm Flavoprotein FMN Isopeptide bond Oxidoreductase Pyrimidine biosynthesis Reference proteome Ubl conju...
de novo' CTP biosynthetic process CTP biosynthetic process glutamine metabolic process phospholipid biosynthetic process pyrimidine nucleobase biosynthetic process
cytoophidium; cytoplasm; fungal-type vacuole
ATP binding CTP synthase activity identical protein binding
Saccharomyces cerevisiae
3D-structure ATP-binding Direct protein sequencing Glutamine amidotransferase Isopeptide bond Ligase Nucleotide-binding Pyrimidine biosynthesis Reference proteome Ubl conjugation
MKYVVVSGGV
MKYVVVSGGVISGIGKGVLASSTGMLMKTLGLKVTSIKIDPYMNIDAGTMSPLEHGECFVLDDGGETDLDLGNYERYLGVTLTKDHNITTGKIYSHVIAKERKGDYLGKTVQIVPHLTNAIQDWIERVAKIPVDDTGMEPDVCIIELGGTVGDIESAPFVEALRQFQFKVGKENFALIHVSLVPVIHGEQKTKPTQAAIKGLRSLGLVPDMIACRCSETLDKPTIDKIAMFCHVGPEQVVNVHDVNSTYHVPLLLLEQKMIDYLHARLKLDEISLTEEEKQRGLELLSKWKATTGNFDESMETVKIALVGKYTNLKDSYL...
de novo' CTP biosynthetic process CTP biosynthetic process glutamine metabolic process phospholipid biosynthetic process pyrimidine nucleobase biosynthetic process cytoophidium; cytoplasm; fungal-type vacuole ATP binding CTP synthase activity identical protein binding Saccharomyces cerevisiae 3D-structure ATP-binding ...
exit from host cell induction by virus of host NF-kappaB cascade perturbation by virus of host G1/S transition checkpoint regulation of DNA-templated transcription suppression by virus of host mRNA processing suppression by virus of host viral-induced cytoplasmic pattern recognition receptor signaling pathway via inhib...
host cell cytoplasm; host cell nucleus
metal ion binding RNA binding
Human herpesvirus 2
Activation of host NF-kappa-B by virus Activator Early protein Eukaryotic host gene expression shutoff by virus G1/S host cell cycle checkpoint dysregulation by virus Host cytoplasm Host gene expression shutoff by virus Host mRNA suppression by virus Host nucleus Host-virus interaction Inhibition of host innate immune ...
MATDIDMLID
MATDIDMLIDLGLDLSDSELEEDALERDEEGRRDDPESDSSGECSSSDEDMEDPCGDGGAEAIDAAIPKGPPARPEDAGTPEASTPRPAARRGADDPPPATTGVWSRLGTRRSASPREPHGGKVARIQPPSTKAPHPRGGRRGRRRGRGRYGPGGADSTPKPRRRVSRNAHNQGGRHPASARTDGPGATHGEARRGGEQLDVSGGPRPRGTRQAPPPLMALSLTPPHADGRAPVPERKAPSADTIDPAVRAVLRSISERAAVERISESFGRSALVMQDPFGGMPFPAANSPWAPVLATQAGGFDAETRRVSWETLVAHGP...
exit from host cell induction by virus of host NF-kappaB cascade perturbation by virus of host G1/S transition checkpoint regulation of DNA-templated transcription suppression by virus of host mRNA processing suppression by virus of host viral-induced cytoplasmic pattern recognition receptor signaling pathway via inhib...
adenylate cyclase-inhibiting serotonin receptor signaling pathway anesthesia-resistant memory chemical synaptic transmission G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger inter-male aggressive behavior male courtship behavior phospholipase C-activating serotonin receptor si...
dendrite; membrane; plasma membrane; synapse
G protein-coupled amine receptor activity G protein-coupled serotonin receptor activity Gi/o-coupled serotonin receptor activity neurotransmitter receptor activity
Drosophila melanogaster
Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Membrane Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MAHETSFNDA
MAHETSFNDALDYIYIANSMNDRAFLIAEPHPEQPNVDGQDQDDAELEELDDMAVTDDGQLEDTNNNNNSKRYYSSGKRRADFIGSLALKPPPTDVNTTTTTAGSPLATAALAAAAASASVAAAAARITAKAAHRALTTKQDATSSPASSPALQLIDMDNNYTNVAVGLGAMLLNDTLLLEGNDSSLFGEMLANRSGQLDLINGTGGLNVTTSKVAEDDFTQLLRMAVTSVLLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISQGWILGPELCDIWTSCDVLCCTASILHLVAI...
adenylate cyclase-inhibiting serotonin receptor signaling pathway anesthesia-resistant memory chemical synaptic transmission G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger inter-male aggressive behavior male courtship behavior phospholipase C-activating serotonin receptor si...
adenylate cyclase-inhibiting serotonin receptor signaling pathway chemical synaptic transmission entrainment of circadian clock G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger phospholipase C-activating serotonin receptor signaling pathway serotonin receptor signaling pathway...
dendrite; membrane; plasma membrane; synapse
G protein-coupled amine receptor activity G protein-coupled serotonin receptor activity Gi/o-coupled serotonin receptor activity neurotransmitter receptor activity
Drosophila melanogaster
Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Membrane Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MLKTVTTAMA
MLKTVTTAMAAGDDDVPASILEIELPAILLNESLFIELNGNLTQLVDTTSNLSQIVWNRSINGNGNSNTFDLVDDEQERAAVEFWLLVKMIAMAVVLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTNIDYNNLRTPRRVFLMIFCVWFAALIVSLAPQFGWKDPDYMKRIEEQHCMVSQDVGYQIFATCCTFYVPLLVILFLYWKIYIIARKRIQRRAQKSFNVTLTETDCDSAVRELKKERSKRRAERKRLE...
adenylate cyclase-inhibiting serotonin receptor signaling pathway chemical synaptic transmission entrainment of circadian clock G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger phospholipase C-activating serotonin receptor signaling pathway serotonin receptor signaling pathway...
bile acid and bile salt transport bile acid biosynthetic process fatty acid beta-oxidation fatty acid biosynthetic process long-chain fatty acid import into peroxisome peroxisome organization phytanic acid metabolic process response to organic cyclic compound response to xenobiotic stimulus very long-chain fatty acid c...
cytosol; intracellular membrane-bounded organelle; membrane; mitochondrion; peroxisomal matrix; peroxisomal membrane; peroxisome
ABC-type transporter activity acyl-CoA hydrolase activity ATP binding ATP hydrolysis activity ATPase-coupled transmembrane transporter activity long-chain fatty acid transporter activity protein homodimerization activity protein self-association
Homo sapiens
Acetylation Alternative splicing ATP-binding Glycoprotein Hydrolase Membrane Nucleotide-binding Peroxisome Phosphoprotein Reference proteome Translocase Transmembrane Transmembrane helix Transport Ubl conjugation
MAAFSKYLTA
MAAFSKYLTARNSSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFFSRLIQILKIMVPRTFCKETGYLVLIAVMLVSRTYCDVWMIQNGTLIESGIIGRSRKDFKRYLLNFIAAMPLISLVNNFLKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQDVEKFCNSVVDLYSNLSKPFLDIVLYIFKLTSAIGAQGPASMMAYLVVSGLFLTRLRRPIGKMTITEQKYEGEYRYVNSRLITNSEEIAFYNGNKREKQTVHSVFRKLVEHLHNFILFRFSMGFIDSII...
bile acid and bile salt transport bile acid biosynthetic process fatty acid beta-oxidation fatty acid biosynthetic process long-chain fatty acid import into peroxisome peroxisome organization phytanic acid metabolic process response to organic cyclic compound response to xenobiotic stimulus very long-chain fatty acid c...
actin filament organization adult locomotory behavior lens fiber cell development muscle contraction myofibril assembly pointed-end actin filament capping
actin filament; cortical cytoskeleton; cytoskeleton; cytosol; membrane; myofibril; sarcomere; striated muscle thin filament
actin binding tropomyosin binding
Homo sapiens
3D-structure Actin-binding Alternative splicing Cytoplasm Cytoskeleton Direct protein sequencing Reference proteome
MSYRRELEKY
MSYRRELEKYRDLDEDEILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTGPFKREELLDHLEKQAKEFKDREDLVPYTGEKRGKVWVPKQKPLDPVLESVTLEPELEEALANASDAELCDIAAILGMHTLMSNQQYYQALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPIPTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNTSLVEMKIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFT...
actin filament organization adult locomotory behavior lens fiber cell development muscle contraction myofibril assembly pointed-end actin filament capping actin filament; cortical cytoskeleton; cytoskeleton; cytosol; membrane; myofibril; sarcomere; striated muscle thin filament actin binding tropomyosin binding Homo sa...
astrocyte cell migration cellular response to fibroblast growth factor stimulus cellular response to interleukin-1 cellular response to tumor necrosis factor cellular response to type II interferon chemokine-mediated signaling pathway cytoskeleton organization eosinophil chemotaxis G protein-coupled receptor signaling ...
extracellular space
CCR chemokine receptor binding chemokine activity
Bos taurus
Chemotaxis Cytokine Disulfide bond Inflammatory response Pyrrolidone carboxylic acid Reference proteome Secreted Signal
MKVSAALLCL
MKVSAALLCLLLTVAAFSTEVLAQPDAINSQVACCYTFNSKKISMQRLMNYRRVTSSKCPKEAVIFKTILGKELCADPKQKWVQDSINYLNKKNQTPKP
astrocyte cell migration cellular response to fibroblast growth factor stimulus cellular response to interleukin-1 cellular response to tumor necrosis factor cellular response to type II interferon chemokine-mediated signaling pathway cytoskeleton organization eosinophil chemotaxis G protein-coupled receptor signaling ...