Biological Process
stringlengths
7
1.01k
Cellular Component
stringlengths
6
867
Molecular Function
stringlengths
11
871
Organism
stringlengths
8
73
Keywords
stringlengths
1
810
Sequence 10
stringlengths
5
10
Sequence
stringlengths
5
1.02k
Combined
stringlengths
136
3.91k
cell population proliferation eye pigment biosynthetic process melanin biosynthetic process melanin biosynthetic process from tyrosine pigmentation response to blue light response to cAMP response to UV response to vitamin D thymus development visual perception
cytoplasm; Golgi-associated vesicle; intracellular membrane-bounded organelle; lysosome; melanosome; melanosome membrane; perinuclear region of cytoplasm
copper ion binding identical protein binding protein homodimerization activity tyrosinase activity
Homo sapiens
3D-structure Albinism Alternative splicing Copper Deafness Disease variant Glycoprotein Melanin biosynthesis Membrane Metal-binding Monooxygenase Oxidoreductase Reference proteome Signal Transmembrane Transmembrane helix Tumor antigen Waardenburg syndrome
MLLAVLYCLL
MLLAVLYCLLWSFQTSAGHFPRACVSSKNLMEKECCPPWSGDRSPCGQLSGRGSCQNILLSNAPLGPQFPFTGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFWGPNCTERRLLVRRNIFDLSAPEKDKFFAYLTLAKHTISSDYVIPIGTYGQMKNGSTPMFNDINIYDLFVWMHYYVSMDALLGGSEIWRDIDFAHEAPAFLPWHRLFLLRWEQEIQKLTGDENFTIPYWDWRDAEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVCSRLEEYNSHQSLCNGTPEGPLRRNPGNHDKSRTPRLPSSADVEF...
cell population proliferation eye pigment biosynthetic process melanin biosynthetic process melanin biosynthetic process from tyrosine pigmentation response to blue light response to cAMP response to UV response to vitamin D thymus development visual perception cytoplasm; Golgi-associated vesicle; intracellular membran...
phosphorylation positive regulation of cell-substrate adhesion positive regulation of DNA-templated transcription positive regulation of response to extracellular stimulus protein kinase A signaling
cytoplasm; nucleus
ATP binding protein kinase activity protein serine kinase activity protein serine/threonine kinase activity protein serine/threonine/tyrosine kinase activity protein tyrosine kinase activity
Saccharomyces cerevisiae
ATP-binding Cytoplasm Kinase Nucleotide-binding Nucleus Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase Tyrosine-protein kinase
MNSSNNNDSS
MNSSNNNDSSSSNSNMNNSLSPTLVTHSDASMGSGRASPDNSHMGRGIWNPSYVNQGSQRSPQQQHQNHHQQQQQQQQQQQQNSQFCFVNPWNEEKVTNSQQNLVYPPQYDDLNSNESLDAYRRRKSSLVVPPARAPAPNPFQYDSYPAYTSSNTSLAGNSSGQYPSGYQQQQQQVYQQGAIHPSQFGSRFVPSLYDRQDFQRRQSLAATNYSSNFSSLNSNTNQGTNSIPVMSPYRRLSAYPPSTSPPLQPPFKQLRRDEVQGQKLSIPQMQLCNSKNDLQPVLNATPKFRRASLNSKTISPLVSVTKSLITTYSLCSP...
phosphorylation positive regulation of cell-substrate adhesion positive regulation of DNA-templated transcription positive regulation of response to extracellular stimulus protein kinase A signaling cytoplasm; nucleus ATP binding protein kinase activity protein serine kinase activity protein serine/threonine kinase act...
cell cycle intracellular signal transduction invasive growth in response to glucose limitation pheromone-dependent signal transduction involved in conjugation with cellular fusion phosphorylation positive regulation of division septum assembly signal transduction involved in filamentous growth
cellular bud neck; cytoplasm; nucleus; periplasmic space
ATP binding MAP kinase activity protein kinase activity protein serine kinase activity protein serine/threonine kinase activity
Saccharomyces cerevisiae
ATP-binding Cell cycle Cytoplasm Kinase Nucleotide-binding Nucleus Periplasm Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase
MARTITFDIP
MARTITFDIPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYLAMYHDPS...
cell cycle intracellular signal transduction invasive growth in response to glucose limitation pheromone-dependent signal transduction involved in conjugation with cellular fusion phosphorylation positive regulation of division septum assembly signal transduction involved in filamentous growth cellular bud neck; cytopl...
cell division cellular response to methylmercury DNA replication G1/S transition of mitotic cell cycle G2/M transition of mitotic cell cycle mitochondrial fusion mitotic intra-S DNA damage checkpoint signaling positive regulation of glucose transmembrane transport proteasome-mediated ubiquitin-dependent protein catabol...
chromosome, telomeric region; cytoplasm; nucleus; SCF ubiquitin ligase complex
ATP binding ubiquitin conjugating enzyme activity ubiquitin-protein transferase activity
Saccharomyces cerevisiae
3D-structure ATP-binding Cell cycle Cell division Cytoplasm DNA replication Nucleotide-binding Nucleus Phosphoprotein Reference proteome Transferase Ubl conjugation pathway
MSSRKSTASS
MSSRKSTASSLLLRQYRELTDPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVKMEVERSKQDIPKGFIMPTSESAYISQSKLDEPESNKDMADNFWYDSDLDDDENGSVILQDDDYDDGNNHIPFEDDDVYNYNDNDDDDERIEFEDDDDDDDDSIDNDSVMDRKQPHKAEDESEDVEDVERVSKKI
cell division cellular response to methylmercury DNA replication G1/S transition of mitotic cell cycle G2/M transition of mitotic cell cycle mitochondrial fusion mitotic intra-S DNA damage checkpoint signaling positive regulation of glucose transmembrane transport proteasome-mediated ubiquitin-dependent protein catabol...
cell differentiation immune complex clearance negative regulation of amyloid fibril formation positive regulation of apoptotic process positive regulation of receptor-mediated endocytosis protein stabilization regulation of cell population proliferation spermatogenesis
chromaffin granule; cytoplasm; cytosol; extracellular region; intracellular membrane-bounded organelle; mitochondrial inner membrane; mitochondrion; nucleus; perinuclear endoplasmic reticulum lumen
unfolded protein binding
Mesocricetus auratus
Chaperone Cytoplasm Cytoplasmic vesicle Developmental protein Differentiation Disulfide bond Endoplasmic reticulum Glycoprotein Membrane Microsome Mitochondrion Nucleus Phosphoprotein Reference proteome Secreted Spermatogenesis Ubl conjugation
NRRPHFLYPK
NRRPHFLYPKSRLIRSLLPPPHYGPLSFHDMFQPFLEMIHQAQQAMDVQFHSPAFQFPDMDLLREGEDDRAVCKEIRHNSTGCLKMKGQCEKCQEILSVDCSANNPAQAHLRQELNDSLQVAERLTQRYNELLHSLQTKMLNTSSLLEQLNEQFNWVSQLANLTQGEDQYYLRVSTVTTHSSDSEVPSRVT
cell differentiation immune complex clearance negative regulation of amyloid fibril formation positive regulation of apoptotic process positive regulation of receptor-mediated endocytosis protein stabilization regulation of cell population proliferation spermatogenesis chromaffin granule; cytoplasm; cytosol; extracellu...
poly-hydroxybutyrate biosynthetic process
cytoplasm
acetoacetyl-CoA reductase activity
Cupriavidus necator
3D-structure Cytoplasm NADP Oxidoreductase PHB biosynthesis Reference proteome
MTQRIAYVTG
MTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIVNISSVNGQKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLHMG
poly-hydroxybutyrate biosynthetic process cytoplasm acetoacetyl-CoA reductase activity Cupriavidus necator 3D-structure Cytoplasm NADP Oxidoreductase PHB biosynthesis Reference proteome MTQRIAYVTG MTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQ...
inflammatory response interleukin-33-mediated signaling pathway macrophage differentiation negative regulation of cell population proliferation negative regulation of T-helper 1 type immune response negative regulation of type II interferon production positive regulation of chemokine production positive regulation of i...
cell surface; cytosol; external side of plasma membrane; extracellular space; focal adhesion; plasma membrane
interleukin-1 receptor activity interleukin-33 binding interleukin-33 receptor activity NAD(P)+ nucleosidase activity NAD+ nucleotidase, cyclic ADP-ribose generating
Mus musculus
3D-structure Alternative splicing Cell membrane Disulfide bond Glycoprotein Hydrolase Immunoglobulin domain Isopeptide bond Membrane NAD Phosphoprotein Receptor Reference proteome Repeat Secreted Signal Transmembrane Transmembrane helix Ubl conjugation
MIDRQRMGLW
MIDRQRMGLWALAILTLPMYLTVTEGSKSSWGLENEALIVRCPQRGRSTYPVEWYYSDTNESIPTQKRNRIFVSRDRLKFLPARVEDSGIYACVIRSPNLNKTGYLNVTIHKKPPSCNIPDYLMYSTVRGSDKNFKITCPTIDLYNWTAPVQWFKNCKALQEPRFRAHRSYLFIDNVTHDDEGDYTCQFTHAENGTNYIVTATRSFTVEEKGFSMFPVITNPPYNHTMEVEIGKPASIACSACFGKGSHFLADVLWQINKTVVGNFGEARIQEEEGRNESSSNDMDCLTSVLRITGVTEKDLSLEYDCLALNLHGMIRHT...
inflammatory response interleukin-33-mediated signaling pathway macrophage differentiation negative regulation of cell population proliferation negative regulation of T-helper 1 type immune response negative regulation of type II interferon production positive regulation of chemokine production positive regulation of i...
heterochromatin formation nuclear envelope organization nuclear migration nuclear pore localization protein localization to nuclear envelope
intermediate filament; nuclear envelope; nuclear lamina
structural constituent of cytoskeleton
Gallus gallus
Acetylation Coiled coil Intermediate filament Lipoprotein Methylation Nucleus Phosphoprotein Prenylation Reference proteome
MAAAVAPLSP
MAAAVAPLSPQPRGAAASAALSPTRISRLQEKEELRQLNDRLAVYIDKVRSLETENSALQRRVSEREQVCGREISGLKELFETELADARKTLDDTARERAKLQIELGKLRAEHEQVLSSYAKKDSDLNAAQVKLREFEAALNAKEAALATALGDKRSQEEELEDLRDQIAQLEVSLAAAKKELADETLQKVDLENRCQSLIEDLEFRKNVYEEEIKETRRKHETRLVEVDSGRQIEYEYKLAQALKEIREQHDAQVKLYKEELEQTYSSKLENIRQSSEMHSCTANTVREELHESRMRIETLSSHIADIQKESRAWQDRV...
heterochromatin formation nuclear envelope organization nuclear migration nuclear pore localization protein localization to nuclear envelope intermediate filament; nuclear envelope; nuclear lamina structural constituent of cytoskeleton Gallus gallus Acetylation Coiled coil Intermediate filament Lipoprotein Methylation ...
heterochromatin formation nuclear envelope organization nuclear migration nuclear pore localization protein localization to nuclear envelope
intermediate filament; nuclear envelope; nuclear lamina
structural constituent of cytoskeleton
Gallus gallus
Acetylation Coiled coil Intermediate filament Lipoprotein Methylation Nucleus Phosphoprotein Prenylation Reference proteome
MSGTPIRGTP
MSGTPIRGTPGGTPLSPTRISRLQEKEELRQLNDRLAVYIDRVRALELENDRLLVKISEKEEVTTREVSGIKNLYESELADARRVLDETAKERARLQIEIGKLRAELEEFNKSYKKKDADLSVAQGRIKDLEVLFHRSEAELNTVLNEKRSLEAEVADLRAQLAKAEDGHAVAKKQLEKETLMRVDLENRCQSLQEDLDFRKNVFEEEIRETRKRHEHRLVEVDTSRQQEYENKMAQALEDLRNQHDEQVKLYKMELEQTYQAKLENAILASDQNDKAAGAAREELKEARMRIESLSHQLSGLQKQASATEDRIRELKET...
heterochromatin formation nuclear envelope organization nuclear migration nuclear pore localization protein localization to nuclear envelope intermediate filament; nuclear envelope; nuclear lamina structural constituent of cytoskeleton Gallus gallus Acetylation Coiled coil Intermediate filament Lipoprotein Methylation ...
cellular response to L-glutamate heterochromatin formation nuclear envelope organization nuclear migration nuclear pore localization positive regulation of G2/M transition of mitotic cell cycle positive regulation of JNK cascade protein localization to nuclear envelope
lamin filament; nuclear envelope; nuclear inner membrane; nuclear lamina; nuclear matrix; nuclear membrane; nuclear periphery; nucleoplasm; nucleus
double-stranded DNA binding JUN kinase binding phospholipase binding sequence-specific double-stranded DNA binding structural constituent of cytoskeleton
Mus musculus
Acetylation Coiled coil Direct protein sequencing Disulfide bond Intermediate filament Isopeptide bond Lipoprotein Methylation Nucleus Phosphoprotein Prenylation Reference proteome Ubl conjugation
MATATPVQQQ
MATATPVQQQRAGSRASAPATPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSALQLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKLQIELGKFKAEHDQLLLNYAKKESDLSGAQIKLREYEAALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLSAAKKQLADETLLKVDLENRCQSLTEDLEFRKNMYEEEINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLE...
cellular response to L-glutamate heterochromatin formation nuclear envelope organization nuclear migration nuclear pore localization positive regulation of G2/M transition of mitotic cell cycle positive regulation of JNK cascade protein localization to nuclear envelope lamin filament; nuclear envelope; nuclear inner me...
anatomical structure morphogenesis cell differentiation determination of adult lifespan DNA endoreduplication ecdysone-mediated induction of salivary gland cell autophagic cell death endoderm formation insulin receptor signaling pathway Malpighian tubule morphogenesis negative regulation of apoptotic process negative r...
nucleus
DNA-binding transcription factor activity, RNA polymerase II-specific protein domain specific binding RNA polymerase II cis-regulatory region sequence-specific DNA binding RNA polymerase II transcription regulatory region sequence-specific DNA binding
Drosophila melanogaster
Developmental protein DNA-binding Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation
MQKLYAEPPP
MQKLYAEPPPSSAPVSMASSGGGGPPSGGGGGGGGGGGGGPPPPSNNNPNPTSNGGSMSPLARSAYTMNSMGLPVGGMSSVSPQAAATFSSSVLDSAAAVASMSASMSASMSASMNASMNGSMGAAAMNSMGGNCMTPSSMSYASMGSPLGNMGGCMAMSAASMSAAGLSGTYGAMPPGSREMETGSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKS...
anatomical structure morphogenesis cell differentiation determination of adult lifespan DNA endoreduplication ecdysone-mediated induction of salivary gland cell autophagic cell death endoderm formation insulin receptor signaling pathway Malpighian tubule morphogenesis negative regulation of apoptotic process negative r...
amyloid-beta clearance amyloid-beta clearance by cellular catabolic process amyloid-beta metabolic process antigen processing and presentation of endogenous peptide antigen via MHC class I bradykinin catabolic process hormone catabolic process insulin catabolic process insulin metabolic process insulin receptor signali...
basolateral plasma membrane; cell surface; cytoplasm; cytosol; external side of plasma membrane; extracellular exosome; extracellular space; mitochondrion; nucleus; peroxisomal matrix; peroxisome
ATP binding endopeptidase activity identical protein binding insulin binding metalloendopeptidase activity peptide binding protein homodimerization activity ubiquitin-dependent protein binding virus receptor activity zinc ion binding
Homo sapiens
3D-structure Allosteric enzyme Alternative splicing ATP-binding Cell membrane Cytoplasm Direct protein sequencing Host cell receptor for virus entry Host-virus interaction Hydrolase Membrane Metal-binding Metalloprotease Nucleotide-binding Protease Receptor Reference proteome Secreted Zinc
MRYRLAWLLH
MRYRLAWLLHPALPSTFRSVLGARLPPPERLCGFQKKTYSKMNNPAIKRIGNHITKSPEDKREYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPFQEEHLKQLYKIVPIKDIRNLYVTFPIP...
amyloid-beta clearance amyloid-beta clearance by cellular catabolic process amyloid-beta metabolic process antigen processing and presentation of endogenous peptide antigen via MHC class I bradykinin catabolic process hormone catabolic process insulin catabolic process insulin metabolic process insulin receptor signali...
DNA topological change mismatch repair negative regulation of transcription by RNA polymerase II nucleotide-excision repair nucleotide-excision repair, DNA damage recognition proteasome-mediated ubiquitin-dependent protein catabolic process
cytoplasm; cytosol; nucleotide-excision repair factor 2 complex; nucleus; XPC complex
damaged DNA binding single-strand break-containing DNA binding single-stranded DNA binding
Saccharomyces cerevisiae
3D-structure Cytoplasm DNA damage DNA repair DNA-binding Nucleus Reference proteome
MNEDLPKEYF
MNEDLPKEYFELIRKALNEKEAEKAPLSRRRRVRRKNQPLPDAKKKFKTGLNELPRESVVTVNLDSSDDGVVTVPTDDSVEEIQSSEEDYDSEEFEDVTDGNEVAGVEDISVEIKPSSKRNSDARRTSRNVCSNEERKRRKYFHMLYLVCLMVHGFIRNEWINSKRLSRKLSNLVPEKVFELLHPQKDEELPLRSTRKLLDGLKKCMELWQKHWKITKKYDNVGLYMRTWKEIEMSANNKRKFKTLKRSDFLRAVSKGHGDPDISVQGFVAMLRACNVNARLIMSCQPPDFTNMKIDTSLNGNNAYKDMVKYPIFWCEVW...
DNA topological change mismatch repair negative regulation of transcription by RNA polymerase II nucleotide-excision repair nucleotide-excision repair, DNA damage recognition proteasome-mediated ubiquitin-dependent protein catabolic process cytoplasm; cytosol; nucleotide-excision repair factor 2 complex; nucleus; XPC c...
aggregation of unicellular organisms cell adhesion
extracellular region
fibrinogen binding fibronectin binding
Staphylococcus aureus
3D-structure Cell adhesion Cell wall Peptidoglycan-anchor Reference proteome Repeat Secreted Signal Virulence
MKNNLRYGIR
MKNNLRYGIRKHKLGAASVFLGTMIVVGMGQDKEAAASEQKTTTVEENGNSATDNKTSETQTTATNVNHIEETQSYNATVTEQPSNATQVTTEEAPKAVQAPQTAQPANIETVKEEVVKEEAKPQVKETTQSQDNSGDQRQVDLTPKKATQNQVAETQVEVAQPRTASESKPRVTRSADVAEAKEASNAKVETGTDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQGDYFDFTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAELEINLFIDPKTVQTNGNQTI...
aggregation of unicellular organisms cell adhesion extracellular region fibrinogen binding fibronectin binding Staphylococcus aureus 3D-structure Cell adhesion Cell wall Peptidoglycan-anchor Reference proteome Repeat Secreted Signal Virulence MKNNLRYGIR MKNNLRYGIRKHKLGAASVFLGTMIVVGMGQDKEAAASEQKTTTVEENGNSATDNKTSETQTTATN...
B-1a B cell differentiation behavioral fear response cell adhesion endothelial cell migration locomotory exploration behavior negative regulation of extracellular matrix disassembly negative regulation of neutrophil chemotaxis positive regulation of cell population proliferation positive regulation of natural killer ce...
apical plasma membrane; cell surface; endocytic vesicle; extracellular region; intercellular canaliculus; lamellipodium; lamellipodium membrane; membrane raft; plasma membrane
aminopeptidase activity chemorepellent activity collagen binding dipeptidyl-peptidase activity identical protein binding peptide binding protease binding protein homodimerization activity serine-type endopeptidase activity serine-type peptidase activity signaling receptor binding virus receptor activity
Rattus norvegicus
3D-structure Aminopeptidase Cell adhesion Cell junction Cell membrane Cell projection Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Membrane Protease Reference proteome Secreted Serine protease Signal-anchor Transmembrane Transmembrane helix
MKTPWKVLLG
MKTPWKVLLGLLGVAALVTIITVPVVLLNKDEAAADSRRTYTLADYLKNTFRVKSYSLRWVSDSEYLYKQENNILLFNAEHGNSSIFLENSTFEIFGDSISDYSVSPDRLFVLLEYNYVKQWRHSYTASYSIYDLNKRQLITEEKIPNNTQWITWSQEGHKLAYVWKNDIYVKIEPHLPSHRITSTGKENVIFNGINDWVYEEEIFGAYSALWWSPNGTFLAYAQFNDTGVPLIEYSFYSDESLQYPKTVWIPYPKAGAVNPTVKFFIVNTDSLSSTTTTIPMQITAPASVTTGDHYLCDVAWVSEDRISLQWLRRIQNY...
B-1a B cell differentiation behavioral fear response cell adhesion endothelial cell migration locomotory exploration behavior negative regulation of extracellular matrix disassembly negative regulation of neutrophil chemotaxis positive regulation of cell population proliferation positive regulation of natural killer ce...
cytoplasmic translational initiation positive regulation of cellular response to amino acid starvation regulation of translational initiation translational initiation
cytosol; eukaryotic translation initiation factor 2B complex; guanyl-nucleotide exchange factor complex
enzyme regulator activity translation initiation factor activity
Saccharomyces cerevisiae
3D-structure Acetylation Activator Cytoplasm Initiation factor Phosphoprotein Protein biosynthesis Reference proteome Repressor Translation regulation
MSEFNITETY
MSEFNITETYLRFLEEDTEMTMPIAAIEALVTLLRIKTPETAAEMINTIKSSTEELIKSIPNSVSLRAGCDIFMRFVLRNLHLYGDWENCKQHLIENGQLFVSRAKKSRNKIAEIGVDFIADDDIILVHGYSRAVFSLLNHAANKFIRFRCVVTESRPSKQGNQLYTLLEQKGIPVTLIVDSAVGAVIDKVDKVFVGAEGVAESGGIINLVGTYSVGVLAHNARKPFYVVTESHKFVRMFPLSSDDLPMAGPPLDFTRRTDDLEDALRGPTIDYTAQEYITALITDLGVLTPSAVSEELIKMWYD
cytoplasmic translational initiation positive regulation of cellular response to amino acid starvation regulation of translational initiation translational initiation cytosol; eukaryotic translation initiation factor 2B complex; guanyl-nucleotide exchange factor complex enzyme regulator activity translation initiation ...
N-terminal peptidyl-glycine N-myristoylation
cytoplasm; cytosol
glycylpeptide N-tetradecanoyltransferase activity
Saccharomyces cerevisiae
3D-structure Acyltransferase Cytoplasm Direct protein sequencing Reference proteome Transferase
MSEEDKAKKL
MSEEDKAKKLENLLKLLQLNNDDTSKFTQEQKKAMKDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPD...
N-terminal peptidyl-glycine N-myristoylation cytoplasm; cytosol glycylpeptide N-tetradecanoyltransferase activity Saccharomyces cerevisiae 3D-structure Acyltransferase Cytoplasm Direct protein sequencing Reference proteome Transferase MSEEDKAKKL MSEEDKAKKLENLLKLLQLNNDDTSKFTQEQKKAMKDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPL...
cell adhesion regulation of lamellipodium morphogenesis wound healing, spreading of cells
apical plasma membrane; cell projection; extracellular region; lamellipodium membrane; microvillus; plasma membrane
hyaluronic acid binding
Papio hamadryas
Cell adhesion Cell membrane Cell projection Direct protein sequencing Disulfide bond Glycoprotein Membrane Phosphoprotein Proteoglycan Receptor Secreted Signal Transmembrane Transmembrane helix
MDKFWWRAAW
MDKFWWRAAWGLCLVQLSLAQIDLNITCRFEGIYHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPGEDCTSVTDLPNAFDGPITITIVNRDGTRYVKKGEYRTNPEDINPSSPTDDDVSSGSSSERSSTLGGYIFYNHFSTSPPIPDEDGPWITDSTDRTPATRDQGAFDPSGGSHTTHGSESAGHSHGSREGGANTTSGPLRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINNGNGAVEDRKSSGLN...
cell adhesion regulation of lamellipodium morphogenesis wound healing, spreading of cells apical plasma membrane; cell projection; extracellular region; lamellipodium membrane; microvillus; plasma membrane hyaluronic acid binding Papio hamadryas Cell adhesion Cell membrane Cell projection Direct protein sequencing Disu...
calcineurin-mediated signaling cellular response to pheromone fungal-type cell wall organization intracellular monoatomic ion homeostasis positive regulation of DNA-templated transcription regulation of cell morphogenesis
calcineurin complex; cytoplasm
calmodulin binding calmodulin-dependent protein phosphatase activity metal ion binding myosin phosphatase activity
Saccharomyces cerevisiae
Calmodulin-binding Hydrolase Iron Metal-binding Phosphoprotein Protein phosphatase Reference proteome Zinc
MSSDAIRNTE
MSSDAIRNTEQINAAIKIIENKTERPQSSTTPIDSKASTVAAANSTATETSRDLTQYTLDDGRVVSTNRRIMNKVPAITSHVPTDEELFQPNGIPRHEFLRDHFKREGKLSAAQAARIVTLATELFSKEPNLISVPAPITVCGDIHGQYFDLLKLFEVGGDPATTSYLFLGDYVDRGSFSFECLIYLYSLKLNFNDHFWLLRGNHECKHLTSYFTFKNEMLHKYNLDIYEKCCESFNNLPLAALMNGQYLCVHGGISPELNSLQDINNLNRFREIPSHGLMCDLLWADPIEEYDEVLDKDLTEEDIVNSKTMVPHHGKMA...
calcineurin-mediated signaling cellular response to pheromone fungal-type cell wall organization intracellular monoatomic ion homeostasis positive regulation of DNA-templated transcription regulation of cell morphogenesis calcineurin complex; cytoplasm calmodulin binding calmodulin-dependent protein phosphatase activit...
brain development cardiac muscle tissue morphogenesis cytokine-mediated signaling pathway decidualization heart development heart morphogenesis hemopoiesis negative regulation of neuron apoptotic process negative regulation of nitric oxide biosynthetic process positive regulation of cell population proliferation positi...
cell surface; external side of plasma membrane; extracellular region; nuclear speck; plasma membrane
erythropoietin receptor activity identical protein binding
Mus musculus
3D-structure Alternative splicing Cell membrane Disulfide bond Glycoprotein Host-virus interaction Isopeptide bond Membrane Phosphoprotein Receptor Reference proteome Secreted Signal Transmembrane Transmembrane helix Ubl conjugation
MDKLRVPLWP
MDKLRVPLWPRVGPLCLLLAGAAWAPSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDPLILTLSLILVLISLLLTVLALLSHRRTLQQKIWPGIPSPESEFEGLFTTHKGNFQLWLLQRDGCLWWSPGS...
brain development cardiac muscle tissue morphogenesis cytokine-mediated signaling pathway decidualization heart development heart morphogenesis hemopoiesis negative regulation of neuron apoptotic process negative regulation of nitric oxide biosynthetic process positive regulation of cell population proliferation positi...
fatty acid metabolic process
cytosol
L-gulonate 3-dehydrogenase activity NAD+ binding protein homodimerization activity structural constituent of eye lens
Oryctolagus cuniculus
3D-structure Acetylation Cytoplasm Direct protein sequencing Eye lens protein NAD Oxidoreductase Phosphoprotein Reference proteome
MASPAAGDVL
MASPAAGDVLIVGSGLVGRSWAMLFASGGFRVKLYDIEPRQITGALENIRKEMKSLQQSGSLKGSLSAEEQLSLISSCTNLAEAVEGVVHIQECVPENLDLKRKIFAQLDSIVDDRVVLSSSSSCLLPSKLFTGLAHVKQCIVAHPVNPPYYIPLVELVPHPETSPATVDRTHALMRKIGQSPVRVLKEIDGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSDGLGMRYAFIGPLETMHLNAEGMLSYCDRYSEGMKRVLKSFGSIPEFSGATVEKVNQAMCKKVPADPEHLAARREWRDECLKRLAKLKRQMQPQ
fatty acid metabolic process cytosol L-gulonate 3-dehydrogenase activity NAD+ binding protein homodimerization activity structural constituent of eye lens Oryctolagus cuniculus 3D-structure Acetylation Cytoplasm Direct protein sequencing Eye lens protein NAD Oxidoreductase Phosphoprotein Reference proteome MASPAAGDVL M...
bacterial-type flagellum-dependent swarming motility protein secretion by the type II secretion system protein transport by the Sec complex proteolysis single-species biofilm formation
extracellular region
endopeptidase activity metal ion binding metalloendopeptidase activity
Pseudomonas aeruginosa
3D-structure Autocatalytic cleavage Calcium Direct protein sequencing Disulfide bond Hydrolase Metal-binding Metalloprotease Protease Reference proteome Secreted Signal Virulence Zinc Zymogen
MKKVSTLDLL
MKKVSTLDLLFVAIMGVSPAAFAADLIDVSKLPSKAAQGAPGPVTLQAAVGAGGADELKAIRSTTLPNGKQVTRYEQFHNGVRVVGEAITEVKGPGKSVAAQRSGHFVANIAADLPGSTTAAVSAEQVLAQAKSLKAQGRKTENDKVELVIRLGENNIAQLVYNVSYLIPGEGLSRPHFVIDAKTGEVLDQWEGLAHAEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFG...
bacterial-type flagellum-dependent swarming motility protein secretion by the type II secretion system protein transport by the Sec complex proteolysis single-species biofilm formation extracellular region endopeptidase activity metal ion binding metalloendopeptidase activity Pseudomonas aeruginosa 3D-structure Autocat...
carbohydrate metabolic process lipid glycosylation protein glycosylation
Golgi apparatus; Golgi cisterna; Golgi cisterna membrane; vesicle
glycosyltransferase activity metal ion binding N-acetyllactosaminide 3-alpha-galactosyltransferase activity
Bos taurus
3D-structure Glycoprotein Glycosyltransferase Golgi apparatus Manganese Membrane Metal-binding Reference proteome Signal-anchor Transferase Transmembrane Transmembrane helix
MNVKGKVILS
MNVKGKVILSMLVVSTVIVVFWEYIHSPEGSLFWINPSRNPEVGGSSIQKGWWLPRWFNNGYHEEDGDINEEKEQRNEDESKLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDESHL...
carbohydrate metabolic process lipid glycosylation protein glycosylation Golgi apparatus; Golgi cisterna; Golgi cisterna membrane; vesicle glycosyltransferase activity metal ion binding N-acetyllactosaminide 3-alpha-galactosyltransferase activity Bos taurus 3D-structure Glycoprotein Glycosyltransferase Golgi apparatus ...
coenzyme A metabolic process ecdysis, chitin-based cuticle embryonic heart tube development germ cell attraction germ cell migration gonad development isoprenoid biosynthetic process locomotory behavior pole cell migration positive regulation of Ras protein signal transduction sterol biosynthetic process
endoplasmic reticulum membrane; peroxisomal membrane
hydroxymethylglutaryl-CoA reductase (NADPH) activity NADP binding
Drosophila melanogaster
Endoplasmic reticulum Glycoprotein Isoprene biosynthesis Membrane NADP Oxidoreductase Reference proteome Transmembrane Transmembrane helix
MIGRLFRAHG
MIGRLFRAHGEFCASHPWEVIVALLTITACMLTVDKNNTLDASSGLGTATASAAAAGGSGSGAGSGASGTIPPSSMGGSATSSRHRPCHGWSQSCDGLEAEYNAADVILMTIVRCTAVLYCYYQFCSLHRLGSKYVLGIAGLFTVFSSFIFTTAIIKFLGSDISELKDALFFLLLVIDLSNSGRLAQLALSGSNQAEVTQNIARGLELLGPAISLDTIVEVLLVGVGTLSGVQRLEVLCMFAVLSVLVNYVVFMTFYPACLSLIFDLSRSGVDMSVVREKAKGSLLLKSLTEEEQKANPVLQRVKLIMTTGLMAVHIYSR...
coenzyme A metabolic process ecdysis, chitin-based cuticle embryonic heart tube development germ cell attraction germ cell migration gonad development isoprenoid biosynthetic process locomotory behavior pole cell migration positive regulation of Ras protein signal transduction sterol biosynthetic process endoplasmic re...
cell surface receptor signaling pathway immune response inflammatory response interleukin-1-mediated signaling pathway positive regulation of interleukin-1-mediated signaling pathway positive regulation of neutrophil extravasation positive regulation of T-helper 1 cell cytokine production positive regulation of type II...
external side of plasma membrane; extracellular region; membrane; plasma membrane
interleukin-1 binding interleukin-1 receptor activity interleukin-1, type I, activating receptor activity NAD(P)+ nucleosidase activity NAD+ nucleotidase, cyclic ADP-ribose generating platelet-derived growth factor receptor binding protease binding transmembrane signaling receptor activity
Homo sapiens
3D-structure Cell membrane Disulfide bond Glycoprotein Hydrolase Immunoglobulin domain Inflammatory response Membrane NAD Phosphoprotein Receptor Reference proteome Repeat Secreted Signal Transmembrane Transmembrane helix
MKVLLRLICF
MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGI...
cell surface receptor signaling pathway immune response inflammatory response interleukin-1-mediated signaling pathway positive regulation of interleukin-1-mediated signaling pathway positive regulation of neutrophil extravasation positive regulation of T-helper 1 cell cytokine production positive regulation of type II...
cytokine-mediated signaling pathway immunoglobulin mediated immune response interleukin-15-mediated signaling pathway interleukin-2-mediated signaling pathway negative regulation of apoptotic process positive regulation of phagocytosis protein-containing complex assembly signal transduction
cell surface; cytosol; endosome; external side of plasma membrane; interleukin-2 receptor complex; membrane; plasma membrane
coreceptor activity cytokine receptor activity interleukin-15 receptor activity interleukin-2 binding interleukin-2 receptor activity
Homo sapiens
3D-structure Cell membrane Disease variant Disulfide bond Glycoprotein Host-virus interaction Membrane Receptor Reference proteome Signal Transmembrane Transmembrane helix
MAAPALSWRL
MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDTIPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDVQKWLSSPFPSSSFSPGGLAP...
cytokine-mediated signaling pathway immunoglobulin mediated immune response interleukin-15-mediated signaling pathway interleukin-2-mediated signaling pathway negative regulation of apoptotic process positive regulation of phagocytosis protein-containing complex assembly signal transduction cell surface; cytosol; endos...
asymmetric neuroblast division mitotic cell cycle mitotic cell cycle phase transition mitotic sister chromatid segregation positive regulation of stem cell differentiation regulation of chromatin binding regulation of exit from mitosis regulation of mitotic cell cycle, embryonic regulation of mitotic nuclear division s...
cyclin A2-CDK2 complex; cytoplasm; cytosol; fusome; male germ cell nucleus; nucleus; spectrosome; synapse
cyclin-dependent protein serine/threonine kinase regulator activity
Drosophila melanogaster
Alternative splicing Cell cycle Cell division Cyclin Mitosis Reference proteome
MASFQIHQDM
MASFQIHQDMSNKENPGIKIPAGVKNTKQPLAVIGGKAEKNALAPRANFAVLNGNNNVPRPAGKVQVFRDVRNLNVDENVEYGAKKSNVVPVVEQFKTFSVYEDNNDTQVAPSGKSLASLVDKENHDVKFGAGQKELVDYDLDSTPMSVTDVQSPMSVDRSILGVIQSSDISVGTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQVLRME...
asymmetric neuroblast division mitotic cell cycle mitotic cell cycle phase transition mitotic sister chromatid segregation positive regulation of stem cell differentiation regulation of chromatin binding regulation of exit from mitosis regulation of mitotic cell cycle, embryonic regulation of mitotic nuclear division s...
peptidoglycan catabolic process protein secretion by the type II secretion system protein transport by the Sec complex proteolysis septum digestion after cytokinesis
extracellular space
endopeptidase activity metal ion binding metalloendopeptidase activity
Pseudomonas aeruginosa
3D-structure Direct protein sequencing Disulfide bond Hydrolase Metal-binding Metalloprotease Protease Reference proteome Secreted Signal Virulence Zinc Zymogen
MQHKRSRAMA
MQHKRSRAMASPRSPFLFVLLALAVGGTANAHDDGLPAFRYSAELLGQLQLPSVALPLNDDLFLYGRDAEAFDLEAYLALNAPALRDKSEYLEHWSGYYSINPKVLLTLMVMQSGPLGAPDERALAAPLGRLSAKRGFDAQVRDVLQQLSRRYYGFEEYQLRQAAARKAVGEDGLNAASAALLGLLREGAKVSAVQGGNPLGAYAQTFQRLFGTPAAELLQPSNRVARQLQAKAALAPPSNLMQLPWRQGYSWQPNGAHSNTGSGYPYSSFDASYDWPRWGSATYSVVAAHAGTVRVLSRCQVRVTHPSGWATNYYHMDQ...
peptidoglycan catabolic process protein secretion by the type II secretion system protein transport by the Sec complex proteolysis septum digestion after cytokinesis extracellular space endopeptidase activity metal ion binding metalloendopeptidase activity Pseudomonas aeruginosa 3D-structure Direct protein sequencing D...
heme catabolic process heme oxidation response to oxidative stress
endoplasmic reticulum membrane
heme binding heme oxygenase (decyclizing) activity metal ion binding
Gallus gallus
Direct protein sequencing Endoplasmic reticulum Heme Iron Membrane Metal-binding Oxidoreductase Reference proteome Transmembrane Transmembrane helix
METSQPHNAE
METSQPHNAESMSQDLSELLKEATKEVHEQAENTPFMKNFQKGQVSLHEFKLVTASLYFIYSALEEEIERNKDNPVYAPVYFPMELHRKAALEKDLEYFYGSNWRAEIPCPEATQKYVERLHVVGKKHPELLVAHAYTRYLGDLSGGQVLKKIAQKALQLPSTGEGLAFFTFDGVSNATKFKQLYRSRMNALEMDHATKKRVLEEAKKAFLLNIQVFEALQKLVSKSQENGHAVQPKAELRTRSVNKSHENSPAAGKESERTSRMQADMLTTSPLVRWLLALGFIATTVAVGLFAM
heme catabolic process heme oxidation response to oxidative stress endoplasmic reticulum membrane heme binding heme oxygenase (decyclizing) activity metal ion binding Gallus gallus Direct protein sequencing Endoplasmic reticulum Heme Iron Membrane Metal-binding Oxidoreductase Reference proteome Transmembrane Transmembr...
apoptotic signaling pathway calcium ion transport growth plate cartilage chondrocyte differentiation mitochondrial calcium ion homeostasis monoatomic ion transmembrane transport negative regulation of sequestering of calcium ion neural crest cell migration plasma membrane repair regulation of muscle contraction
apical plasma membrane; collagen-containing extracellular matrix; cytoplasm; cytosol; focal adhesion; intercalated disc; late endosome membrane; lysosomal membrane; melanosome; membrane; mitochondrion; perinuclear region of cytoplasm; protein-containing complex; sarcolemma
actin filament binding calcium channel activity calcium ion binding calcium-dependent phospholipid binding calcium-dependent protein binding cholesterol binding chondroitin sulfate binding GTP binding identical protein binding ligand-gated monoatomic ion channel activity lipid binding phosphatidylserine binding protein...
Mus musculus
Acetylation Annexin Calcium Calcium/phospholipid-binding Cytoplasm Direct protein sequencing Phosphoprotein Reference proteome Repeat
MAKIAQGAMY
MAKIAQGAMYRGSVHDFPEFDANQDAEALYTAMKGFGSDKESILELITSRSNKQRQEICQNYKSLYGKDLIEDLKYELTGKFERLIVNLMRPLAYCDAKEIKDAISGVGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLESDIIGDTSGHFQKMLVVLLQGTRENDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVSRSELDMLDIREIFRTKYEKSLYSMIKNDTSGEYKKALLKL...
apoptotic signaling pathway calcium ion transport growth plate cartilage chondrocyte differentiation mitochondrial calcium ion homeostasis monoatomic ion transmembrane transport negative regulation of sequestering of calcium ion neural crest cell migration plasma membrane repair regulation of muscle contraction apical ...
ascospore formation cellular response to starvation DNA damage response negative regulation of meiotic nuclear division positive regulation of meiotic nuclear division protein folding protein metabolic process protein transport
cytoplasm; mitochondrial intermembrane space; mitochondrion; nucleus; Set3 complex
cyclosporin A binding mRNA binding peptidyl-prolyl cis-trans isomerase activity
Saccharomyces cerevisiae
3D-structure Acetylation Cytoplasm Direct protein sequencing Isomerase Isopeptide bond Mitochondrion Nucleus Phosphoprotein Protein transport Reference proteome Rotamase Transport Ubl conjugation
MSQVYFDVEA
MSQVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSPSGATKARIVVAKSGEL
ascospore formation cellular response to starvation DNA damage response negative regulation of meiotic nuclear division positive regulation of meiotic nuclear division protein folding protein metabolic process protein transport cytoplasm; mitochondrial intermembrane space; mitochondrion; nucleus; Set3 complex cyclospor...
photosynthesis protein stabilization
plasma membrane-derived thylakoid membrane; plasma membrane-derived thylakoid photosystem II
phosphate ion binding
Synechocystis sp.
3D-structure Direct protein sequencing Membrane Photosynthesis Photosystem II Reference proteome Thylakoid Transmembrane Transmembrane helix
MAQRTRLGDI
MAQRTRLGDILRPLNSEYGKVVPGWGTTPVMGVFMALFLVFLLIILQIYNSSLILEGFSVDWAG
photosynthesis protein stabilization plasma membrane-derived thylakoid membrane; plasma membrane-derived thylakoid photosystem II phosphate ion binding Synechocystis sp. 3D-structure Direct protein sequencing Membrane Photosynthesis Photosystem II Reference proteome Thylakoid Transmembrane Transmembrane helix MAQRTRLGD...
cellular response to hydrogen peroxide cellular response to oxidative stress defense response embryo implantation eye development male gonad development negative regulation of blood vessel remodeling negative regulation of collagen catabolic process negative regulation of elastin catabolic process negative regulation o...
axon; basement membrane; cell projection; contractile fiber; cytoplasm; extracellular region; extracellular space; Golgi apparatus; multivesicular body; neuronal cell body; nuclear membrane; perinuclear region of cytoplasm; plasma membrane; vesicle
amyloid-beta binding cysteine-type endopeptidase inhibitor activity endopeptidase inhibitor activity identical protein binding peptidase inhibitor activity protease binding
Rattus norvegicus
Direct protein sequencing Disulfide bond Glycoprotein Protease inhibitor Reference proteome Secreted Signal Thiol protease inhibitor
MASPLRSLML
MASPLRSLMLLLAVLAVAWAGTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQIYSVPWKGTHTLTKSSCKNA
cellular response to hydrogen peroxide cellular response to oxidative stress defense response embryo implantation eye development male gonad development negative regulation of blood vessel remodeling negative regulation of collagen catabolic process negative regulation of elastin catabolic process negative regulation o...
acute-phase response cellular response to calcium ion complement activation, classical pathway innate immune response negative regulation of lipid storage negative regulation of macrophage derived foam cell differentiation negative regulation of mononuclear cell proliferation negative regulation of superoxide anion gen...
extracellular space; filopodium; growth cone
calcium ion binding cholesterol binding complement component C1q complex binding identical protein binding low-density lipoprotein particle binding low-density lipoprotein particle receptor binding
Mus musculus
Acute phase Calcium Disulfide bond Metal-binding Reference proteome Secreted Signal
MEKLLWCLLI
MEKLLWCLLIMISFSRTFGHEDMFKKAFVFPKESDTSYVSLEAESKKPLNTFTVCLHFYTALSTVRSFSVFSYATKKNSNDILIFWNKDKQYTFGVGGAEVRFMVSEIPEAPTHICASWESATGIVEFWIDGKPKVRKSLHKGYTVGPDASIILGQEQDSYGGDFDAKQSLVGDIGDVNMWDFVLSPEQISTVYVGGTLSPNVLNWRALNYKAQGDVFIKPQLWS
acute-phase response cellular response to calcium ion complement activation, classical pathway innate immune response negative regulation of lipid storage negative regulation of macrophage derived foam cell differentiation negative regulation of mononuclear cell proliferation negative regulation of superoxide anion gen...
activation of protein kinase B activity apoptotic process cell adhesion molecule production cellular response to oxidative stress endothelial cell activation leukocyte chemotaxis negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway negative regulation of protein K48-linked ubiquitinatio...
cytoplasm; cytosol; extracellular region; midbody; nucleus
cyclosporin A binding heparan sulfate binding integrin binding peptidyl-prolyl cis-trans isomerase activity
Cricetulus griseus
Acetylation Apoptosis Cytoplasm Glycoprotein Isomerase Isopeptide bond Nucleus Phosphoprotein Rotamase Secreted Ubl conjugation
MVNPTVFFDI
MVNPTVFFDISADGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL
activation of protein kinase B activity apoptotic process cell adhesion molecule production cellular response to oxidative stress endothelial cell activation leukocyte chemotaxis negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway negative regulation of protein K48-linked ubiquitinatio...
cellular respiration mitochondrial electron transport, cytochrome c to oxygen substantia nigra development
mitochondrial inner membrane; mitochondrial membrane; mitochondrial respiratory chain complex IV; mitochondrion; respiratory chain complex IV
cytochrome-c oxidase activity
Homo sapiens
3D-structure Acetylation Disease variant Disulfide bond Membrane Mitochondrion Mitochondrion inner membrane Primary mitochondrial disease Reference proteome
MAEDMETKIK
MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
cellular respiration mitochondrial electron transport, cytochrome c to oxygen substantia nigra development mitochondrial inner membrane; mitochondrial membrane; mitochondrial respiratory chain complex IV; mitochondrion; respiratory chain complex IV cytochrome-c oxidase activity Homo sapiens 3D-structure Acetylation Dis...
negative regulation of DNA-templated transcription positive regulation of miRNA transcription positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II
chromatin; endoplasmic reticulum; intracellular membrane-bounded organelle; nucleoplasm; nucleus; RNA polymerase II transcription regulator complex
DNA binding DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity, RNA polymerase II-specific identical protein binding RNA polymerase II cis-regulatory region sequence-specific DNA binding RNA polymerase II core promoter sequence-specific DNA binding sequenc...
Homo sapiens
3D-structure Activator Alternative splicing DNA-binding Homeobox Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation
MNNPSETSKP
MNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQPIQIAQDLQQLQQLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQGLLQAQNLLTQLPQQSQANLLQSQPSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGND...
negative regulation of DNA-templated transcription positive regulation of miRNA transcription positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II chromatin; endoplasmic reticulum; intracellular membrane-bounded organelle; nucleoplasm; nucleus; RNA polymerase II tra...
mRNA processing negative regulation of DNA-templated transcription regulation of alternative mRNA splicing, via spliceosome regulation of RNA splicing RNA processing
chromatin; cytoplasm; extracellular exosome; membrane; nucleoplasm; nucleus; ribonucleoprotein complex; ribonucleoprotein granule
mRNA binding pre-mRNA intronic binding RNA binding transcription cis-regulatory region binding
Homo sapiens
3D-structure Acetylation Alternative splicing Cytoplasm Direct protein sequencing Isopeptide bond Methylation Nucleus Phosphoprotein Reference proteome Repeat Ribonucleoprotein RNA-binding Ubl conjugation
MSRRLLPRAE
MSRRLLPRAEKRRRRLEQRQQPDEQRRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGP...
mRNA processing negative regulation of DNA-templated transcription regulation of alternative mRNA splicing, via spliceosome regulation of RNA splicing RNA processing chromatin; cytoplasm; extracellular exosome; membrane; nucleoplasm; nucleus; ribonucleoprotein complex; ribonucleoprotein granule mRNA binding pre-mRNA in...
chloride transmembrane transport gamma-aminobutyric acid signaling pathway inhibitory synapse assembly regulation of postsynaptic membrane potential synaptic transmission, GABAergic
chloride channel complex; cytoplasmic vesicle membrane; dendrite membrane; GABA receptor complex; GABA-A receptor complex; GABA-ergic synapse; neuron projection; plasma membrane; postsynapse; postsynaptic membrane; synapse
GABA-A receptor activity GABA-gated chloride ion channel activity inhibitory extracellular ligand-gated monoatomic ion channel activity transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
Homo sapiens
3D-structure Cell membrane Chloride Chloride channel Cytoplasmic vesicle Disease variant Disulfide bond Epilepsy Glycoprotein Ion channel Ion transport Ligand-gated ion channel Membrane Postsynaptic cell membrane Receptor Reference proteome Signal Synapse Transmembrane Transmembrane helix Transport
MRKSPGLSDC
MRKSPGLSDCLWAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVC...
chloride transmembrane transport gamma-aminobutyric acid signaling pathway inhibitory synapse assembly regulation of postsynaptic membrane potential synaptic transmission, GABAergic chloride channel complex; cytoplasmic vesicle membrane; dendrite membrane; GABA receptor complex; GABA-A receptor complex; GABA-ergic syna...
aspartyl-tRNA aminoacylation protein-containing complex assembly translation
aminoacyl-tRNA synthetase multienzyme complex; cytoplasm; cytosol; extracellular exosome; membrane; synapse
aminoacylase activity aspartate-tRNA ligase activity ATP binding RNA binding
Homo sapiens
3D-structure Acetylation Alternative splicing Aminoacyl-tRNA synthetase ATP-binding Cytoplasm Disease variant Ligase Nucleotide-binding Phosphoprotein Protein biosynthesis Reference proteome
MPSASASRKS
MPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRVRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYHEVMEEIADTMVQIFKGLQER...
aspartyl-tRNA aminoacylation protein-containing complex assembly translation aminoacyl-tRNA synthetase multienzyme complex; cytoplasm; cytosol; extracellular exosome; membrane; synapse aminoacylase activity aspartate-tRNA ligase activity ATP binding RNA binding Homo sapiens 3D-structure Acetylation Alternative splicing...
cellular response to cAMP cellular response to interleukin-4 cellular response to phorbol 13-acetate 12-myristate cellular response to Thyroid stimulating hormone cytoplasmic translation lactation response to selenium ion ribosome biogenesis
cytoplasm; cytoplasmic ribonucleoprotein granule; cytosol; cytosolic large ribosomal subunit; cytosolic ribosome; dendrite; endoplasmic reticulum; nucleus; postsynapse; postsynaptic density; ribonucleoprotein complex; synapse
large ribosomal subunit rRNA binding peptide binding structural constituent of ribosome
Mus musculus
3D-structure Cytoplasm Direct protein sequencing Isopeptide bond Nucleus Phosphoprotein Reference proteome Ribonucleoprotein Ribosomal protein Ubl conjugation
MPREDRATWK
MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLIIQQVFDNGSIYNPEVLDITEQALHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETEYTFPLTEKVKAFLADPSAFAAAAPAAAATTAAPAAAAAPAKAEAKEESEESDEDMGFGLFD
cellular response to cAMP cellular response to interleukin-4 cellular response to phorbol 13-acetate 12-myristate cellular response to Thyroid stimulating hormone cytoplasmic translation lactation response to selenium ion ribosome biogenesis cytoplasm; cytoplasmic ribonucleoprotein granule; cytosol; cytosolic large rib...
amino acid catabolic process fatty acid catabolic process
catalytic complex; mitochondrial matrix; mitochondrion
ATP binding enzyme binding metal ion binding propionyl-CoA carboxylase activity
Rattus norvegicus
Acetylation ATP-binding Biotin Direct protein sequencing Ligase Lipid degradation Lipid metabolism Magnesium Manganese Metal-binding Mitochondrion Nucleotide-binding Phosphoprotein Reference proteome Transit peptide
MAGLWVRTVA
MAGLWVRTVALLAARRHWRRSSQQLLWTLKRAPRSSQQLLWTLKRAPVYSQQCLVVSRSLSSVEYEPKEKTFDKILIANRGEIACRVIKTCRKMGIRTVAIHSDVDASSVHVKMADEAVCVGPAPTSKSYLNMDAIMEAIKKTGAQAVHPGYGFLSENKEFAKCLAAEDVTFIGPDTHAIQAMGDKIESKLLAKRAKVNTIPGFDGVLKDADEAVRIAREIGYPVMIKASAGGGGKGMRIPWDDEETRDGFRFSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLGDKHGNALWLNERECSIQRRNQKVVEEAPSIFLDPE...
amino acid catabolic process fatty acid catabolic process catalytic complex; mitochondrial matrix; mitochondrion ATP binding enzyme binding metal ion binding propionyl-CoA carboxylase activity Rattus norvegicus Acetylation ATP-binding Biotin Direct protein sequencing Ligase Lipid degradation Lipid metabolism Magnesium ...
coenzyme A metabolic process isopentenyl diphosphate biosynthetic process, mevalonate pathway isoprenoid biosynthetic process sterol biosynthetic process
endoplasmic reticulum; endoplasmic reticulum membrane
hydroxymethylglutaryl-CoA reductase (NADPH) activity
Arabidopsis thaliana
3D-structure Alternative initiation Direct protein sequencing Endoplasmic reticulum Glycoprotein Isoprene biosynthesis Membrane NADP Oxidoreductase Phosphoprotein Reference proteome Transmembrane Transmembrane helix
MDLRRRPPKP
MDLRRRPPKPPVTNNNNSNGSFRSYQPRTSDDDHRRRATTIAPPPKASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRYNTPLHVVTITELGAIIALIASFIYLLGFFGIDFVQSFISRASGDAWDLADTIDDDDHRLVTCSPPTPIVSVAKLPNPEPIVTESLPEEDEEIVKSVIDGVIPSYSLESRLGDCKRAASIRREALQRVTGRSIEGLPLDGFDYESILGQCCEMPVGYIQIPVGIAGPLLLDGYEYSVPMATTEGCLVASTNRGCKAMFISGGATSTVLKDGMTRAPVVRFASARRASELKFFLENPEN...
coenzyme A metabolic process isopentenyl diphosphate biosynthetic process, mevalonate pathway isoprenoid biosynthetic process sterol biosynthetic process endoplasmic reticulum; endoplasmic reticulum membrane hydroxymethylglutaryl-CoA reductase (NADPH) activity Arabidopsis thaliana 3D-structure Alternative initiation Di...
cell cycle cell division cell wall organization peptidoglycan biosynthetic process regulation of cell shape
cytoplasm
ATP binding identical protein binding UDP-N-acetylmuramoylalanine-D-glutamate ligase activity
Escherichia coli
3D-structure ATP-binding Cell cycle Cell division Cell shape Cell wall biogenesis/degradation Cytoplasm Direct protein sequencing Ligase Nucleotide-binding Peptidoglycan synthesis Reference proteome
MADYQGKNVV
MADYQGKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGLDKLPEAVERHTGSLNDEWLMAADLIVASPGIALAHPSLSAAADAGIEIVGDIELFCREAQAPIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDDECELYVLELSSFQLETTSSLQAVAATILNVTEDHMDRYPFGLQQYRAAKLRIYENAKVCVVNADDALTMPIRGADERCVSFGVNMGDYHLNHQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALADAAGLPRASSLKALTTFTGLPHRFEVVLEHNGVRWINDSK...
cell cycle cell division cell wall organization peptidoglycan biosynthetic process regulation of cell shape cytoplasm ATP binding identical protein binding UDP-N-acetylmuramoylalanine-D-glutamate ligase activity Escherichia coli 3D-structure ATP-binding Cell cycle Cell division Cell shape Cell wall biogenesis/degradati...
de novo' NAD biosynthetic process from tryptophan female pregnancy inflammatory response kynurenic acid biosynthetic process multicellular organismal response to stress negative regulation of interleukin-10 production negative regulation of T cell apoptotic process negative regulation of T cell proliferation positive r...
cytoplasm; cytosol; smooth muscle contractile fiber; stereocilium bundle
electron transfer activity heme binding indoleamine 2,3-dioxygenase activity metal ion binding tryptophan 2,3-dioxygenase activity
Homo sapiens
3D-structure Cytoplasm Dioxygenase Direct protein sequencing Heme Immunity Iron Metal-binding Oxidoreductase Reference proteome Tryptophan catabolism
MAHAMENSWT
MAHAMENSWTISKEYHIDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLIESGQLRERVEKLNMLSIDHLTDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPNKPLTYENMDVLFSFRDGDCSKGFFLVSLLVEIAAASAIKVIPTVFKAMQMQERDTLLKALLEIASCLEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWEDPKEFAGGSAGQSSVFQCFDVLLGIQQTAGGGHAAQFLQDMRRYMPPAHRNFLCSLESNPSVREFV...
de novo' NAD biosynthetic process from tryptophan female pregnancy inflammatory response kynurenic acid biosynthetic process multicellular organismal response to stress negative regulation of interleukin-10 production negative regulation of T cell apoptotic process negative regulation of T cell proliferation positive r...
cytoplasm to vacuole transport by the Cvt pathway protein transport proteolysis
Cvt complex; cytoplasm; fungal-type vacuole
identical protein binding metalloaminopeptidase activity zinc ion binding
Saccharomyces cerevisiae
3D-structure Aminopeptidase Direct protein sequencing Glycoprotein Hydrolase Metal-binding Metalloprotease Phosphoprotein Protease Protein transport Reference proteome Transport Vacuole Zinc Zymogen
MEEQREILEQ
MEEQREILEQLKKTLQMLTVEPSKNNQIANEEKEKKENENSWCILEHNYEDIAQEFIDFIYKNPTTYHVVSFFAELLDKHNFKYLSEKSNWQDSIGEDGGKFYTIRNGTNLSAFILGKNWRAEKGVGVIGSHVDALTVKLKPVSFKDTAEGYGRIAVAPYGGTLNELWLDRDLGIGGRLLYKKKGTNEIKSALVDSTPLPVCRIPSLAPHFGKPAEGPFDKEDQTIPVIGFPTPDEEGNEPPTDDEKKSPLFGKHCIHLLRYVAKLAGVEVSELIQMDLDLFDVQKGTIGGIGKHFLFAPRLDDRLCSFAAMIALICYAK...
cytoplasm to vacuole transport by the Cvt pathway protein transport proteolysis Cvt complex; cytoplasm; fungal-type vacuole identical protein binding metalloaminopeptidase activity zinc ion binding Saccharomyces cerevisiae 3D-structure Aminopeptidase Direct protein sequencing Glycoprotein Hydrolase Metal-binding Metal...
cytosol to endoplasmic reticulum transport post-translational protein targeting to endoplasmic reticulum membrane post-translational protein targeting to membrane, translocation SRP-dependent cotranslational protein targeting to membrane
endoplasmic reticulum; mitochondrion; nuclear inner membrane; rough endoplasmic reticulum membrane; Sec62/Sec63 complex; translocon complex
protein transmembrane transporter activity
Saccharomyces cerevisiae
3D-structure Chaperone Endoplasmic reticulum Membrane Nucleus Phosphoprotein Protein transport Reference proteome Repeat Transmembrane Transmembrane helix Transport
MPTNYEYDEA
MPTNYEYDEASETWPSFILTGLLMVVGPMTLLQIYQIFFGANAEDGNSGKSKEFNEEVFKNLNEEYTSDEIKQFRRKFDKNSNKKSKIWSRRNIIIIVGWILVAILLQRINSNDAIKDAATKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYESLTDELVRQNYLKYGHPDGPQSTSHGIALPRFLVDGSASPLLVVCYVALLGLILPYFVSRWWARTQSYTKKGIHNVTASNFVSNLVNYKPSEIVTTDLILHWLSFAHEFKQFFPDLQPTDFEKLLQDHINRRDSGKLNN...
cytosol to endoplasmic reticulum transport post-translational protein targeting to endoplasmic reticulum membrane post-translational protein targeting to membrane, translocation SRP-dependent cotranslational protein targeting to membrane endoplasmic reticulum; mitochondrion; nuclear inner membrane; rough endoplasmic re...
ncRNA export from nucleus NLS-bearing protein import into nucleus nucleocytoplasmic transport poly(A)+ mRNA export from nucleus protein import into nucleus ribosomal large subunit export from nucleus ribosomal small subunit export from nucleus RNA export from nucleus tRNA export from nucleus
nuclear envelope; nuclear membrane; nuclear periphery; nuclear pore; nuclear pore central transport channel; nuclear pore nuclear basket
molecular adaptor activity phospholipid binding structural constituent of nuclear pore
Saccharomyces cerevisiae
3D-structure Coiled coil Membrane mRNA transport Nuclear pore complex Nucleus Phosphoprotein Protein transport Reference proteome Repeat Translocation Transport
MNFNTPQQNK
MNFNTPQQNKTPFSFGTANNNSNTTNQNSSTGAGAFGTGQSTFGFNNSAPNNTNNANSSITPAFGSNNTGNTAFGNSNPTSNVFGSNNSTTNTFGSNSAGTSLFGSSSAQQTKSNGTAGGNTFGSSSLFNNSTNSNTTKPAFGGLNFGGGNNTTPSSTGNANTSNNLFGATANANKPAFSFGATTNDDKKTEPDKPAFSFNSSVGNKTDAQAPTTGFSFGSQLGGNKTVNEAAKPSLSFGSGSAGANPAGASQPEPTTNEPAKPALSFGTATSDNKTTNTTPSFSFGAKSDENKAGATSKPAFSFGAKPEEKKDDNSSKP...
ncRNA export from nucleus NLS-bearing protein import into nucleus nucleocytoplasmic transport poly(A)+ mRNA export from nucleus protein import into nucleus ribosomal large subunit export from nucleus ribosomal small subunit export from nucleus RNA export from nucleus tRNA export from nucleus nuclear envelope; nuclear m...
methylation mitochondrial transcription positive regulation of DNA-templated transcription, elongation transcription initiation at mitochondrial promoter
mitochondrial DNA-directed RNA polymerase complex; mitochondrial intermembrane space; mitochondrial matrix; mitochondrion
DNA binding methyltransferase activity mitochondrial transcription factor activity RNA binding
Saccharomyces cerevisiae
3D-structure Direct protein sequencing DNA-binding Methyltransferase Mitochondrion Reference proteome RNA-binding S-adenosyl-L-methionine Transcription Transcription regulation Transferase
MSVPIPGIKD
MSVPIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQSAIFYNKYCPRQYSLLEKRSSLYKFLNAKFEGSPLQILKRDPYDWSTYSNLIDEERIFVPEVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKLLARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGKPIALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDLLKKCPIDLTNDEFIYLTKLFME...
methylation mitochondrial transcription positive regulation of DNA-templated transcription, elongation transcription initiation at mitochondrial promoter mitochondrial DNA-directed RNA polymerase complex; mitochondrial intermembrane space; mitochondrial matrix; mitochondrion DNA binding methyltransferase activity mitoc...
urea catabolic process
urease complex
nickel cation binding urease activity
Helicobacter pylori
3D-structure Cytoplasm Direct protein sequencing Hydrolase Reference proteome Virulence
MKLTPKELDK
MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE
urea catabolic process urease complex nickel cation binding urease activity Helicobacter pylori 3D-structure Cytoplasm Direct protein sequencing Hydrolase Reference proteome Virulence MKLTPKELDK MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGK...
D-alanine catabolic process D-amino acid catabolic process D-serine catabolic process D-serine metabolic process digestion dopamine biosynthetic process proline catabolic process
cytoplasm; cytosol; peroxisomal matrix
D-amino-acid oxidase activity FAD binding identical protein binding
Homo sapiens
3D-structure FAD Flavoprotein Oxidoreductase Peroxisome Reference proteome Schizophrenia
MRVVVIGAGV
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPRELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGGIFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGPSNTEVIHNYGHGGYGLTIHW...
D-alanine catabolic process D-amino acid catabolic process D-serine catabolic process D-serine metabolic process digestion dopamine biosynthetic process proline catabolic process cytoplasm; cytosol; peroxisomal matrix D-amino-acid oxidase activity FAD binding identical protein binding Homo sapiens 3D-structure FAD Flav...
cell motility immune response negative regulation of cell cycle negative regulation of cell population proliferation PML body organization positive regulation of angiogenesis positive regulation of blood vessel endothelial cell migration positive regulation of DNA-templated transcription positive regulation of endothel...
chromatin; cytoplasm; nucleoplasm; nucleus
DNA binding DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific identical protein binding nuclear receptor coactivator activity nucleic acid binding RNA polymerase II cis-regulatory regio...
Homo sapiens
3D-structure Acetylation Alternative splicing Cytoplasm DNA-binding Immunity Isopeptide bond Nucleus Phosphoprotein Proto-oncogene Reference proteome Transcription Transcription regulation Ubl conjugation
MKAAVDLKPT
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPV...
cell motility immune response negative regulation of cell cycle negative regulation of cell population proliferation PML body organization positive regulation of angiogenesis positive regulation of blood vessel endothelial cell migration positive regulation of DNA-templated transcription positive regulation of endothel...
chromatin remodeling hyperosmotic response negative regulation of DNA-templated transcription negative regulation of transcription by RNA polymerase II positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II
nucleus; transcription repressor complex
chromatin DNA binding histone deacetylase binding RNA polymerase II cis-regulatory region sequence-specific DNA binding transcription coactivator activity transcription corepressor activity
Saccharomyces cerevisiae
Amyloid Nucleus Phosphoprotein Prion Reference proteome Repeat Repressor TPR repeat Transcription Transcription regulation
MNPGGEQTIM
MNPGGEQTIMEQPAQQQQQQQQQQQQQQQQAAVPQQPLDPLTQSTAETWLSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYILPQPPAPLQEWDIWFQLGSVLESMGEWQGAKEAYEHVLAQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQ...
chromatin remodeling hyperosmotic response negative regulation of DNA-templated transcription negative regulation of transcription by RNA polymerase II positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II nucleus; transcription repressor complex chromatin DNA bindin...
bundle of His cell-Purkinje myocyte adhesion involved in cell communication canonical Wnt signaling pathway cell migration cell-cell adhesion cellular response to indole-3-methanol desmosome assembly detection of mechanical stimulus endothelial cell-cell adhesion negative regulation of blood vessel endothelial cell mig...
adherens junction; catenin complex; cell-cell junction; cornified envelope; cytoplasm; cytoplasmic side of plasma membrane; cytoskeleton; cytosol; desmosome; extracellular exosome; extracellular region; ficolin-1-rich granule lumen; focal adhesion; gamma-catenin-TCF7L2 complex; intercalated disc; intermediate filament;...
alpha-catenin binding cadherin binding cell adhesion molecule binding cell adhesive protein binding involved in bundle of His cell-Purkinje myocyte communication cytoskeletal protein-membrane anchor activity DNA-binding transcription factor binding protein homodimerization activity protein phosphatase binding structura...
Homo sapiens
3D-structure Acetylation Cardiomyopathy Cell adhesion Cell junction Cytoplasm Cytoskeleton Direct protein sequencing Disease variant Glycoprotein Membrane Palmoplantar keratoderma Phosphoprotein Reference proteome Repeat
MEVMNLMEQP
MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTTYTQGVPPSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQRLAEPSQLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQALVQIMR...
bundle of His cell-Purkinje myocyte adhesion involved in cell communication canonical Wnt signaling pathway cell migration cell-cell adhesion cellular response to indole-3-methanol desmosome assembly detection of mechanical stimulus endothelial cell-cell adhesion negative regulation of blood vessel endothelial cell mig...
fatty acid primary amide biosynthetic process heart development lactation limb development long-chain fatty acid metabolic process maternal process involved in female pregnancy mitotic chromosome condensation ovulation cycle process peptide amidation peptide metabolic process regulation of actin cytoskeleton organizati...
cell surface; chromatin; condensed chromosome; extracellular region; extracellular space; neuronal cell body; perikaryon; perinuclear region of cytoplasm; secretory granule; trans-Golgi network; transport vesicle membrane
calcium ion binding chromatin binding copper ion binding identical protein binding L-ascorbic acid binding peptidylamidoglycolate lyase activity peptidylglycine monooxygenase activity protein kinase binding zinc ion binding
Rattus norvegicus
3D-structure Alternative splicing Calcium Cleavage on pair of basic residues Copper Cytoplasmic vesicle Direct protein sequencing Disulfide bond Glycoprotein Lipid metabolism Lyase Membrane Metal-binding Monooxygenase Multifunctional enzyme Oxidoreductase Phosphoprotein Reference proteome Repeat Signal Sulfation Transm...
MAGRARSGLL
MAGRARSGLLLLLLGLLALQSSCLAFRSPLSVFKRFKETTRSFSNECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIM...
fatty acid primary amide biosynthetic process heart development lactation limb development long-chain fatty acid metabolic process maternal process involved in female pregnancy mitotic chromosome condensation ovulation cycle process peptide amidation peptide metabolic process regulation of actin cytoskeleton organizati...
cellular response to lithium ion glutathione metabolic process response to herbicide response to nicotine response to zinc ion xenobiotic metabolic process
cytoplasm
glutathione transferase activity identical protein binding organic cyclic compound binding protein homodimerization activity toxic substance binding
Rattus norvegicus
Acetylation Cytoplasm Direct protein sequencing Reference proteome Transferase
MEVKPKLYYF
MEVKPKLYYFQGRGRMESIRWLLATAGVEFEEEFLETREQYEKLQKDGCLLFGQVPLVEIDGMLLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIIGAPFKAPQEKEESLALAVKRAKNRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEAILMVEEVSAPVLSDFPLLQAFKTRISNIPTIKKFLQPGSQRKPPPDGHYVDVVRTVLKF
cellular response to lithium ion glutathione metabolic process response to herbicide response to nicotine response to zinc ion xenobiotic metabolic process cytoplasm glutathione transferase activity identical protein binding organic cyclic compound binding protein homodimerization activity toxic substance binding Rattu...
lipid metabolic process
endoplasmic reticulum lumen
carboxylesterase activity
Oryctolagus cuniculus
Direct protein sequencing Disulfide bond Endoplasmic reticulum Glycoprotein Hydrolase Lipid metabolism Pyrrolidone carboxylic acid Reference proteome Serine esterase
QDSASPIRNT
QDSASPIRNTHTGQVRGSLVHVEGTDAGVHTFLGIPFAKPPLGPLRFAPPEPAEAWSGVRDGTSLPAMCLQNLAIMDQDVLLLHFTPPSIPMSEDCLYLNIYSPAHAREGSDLPVMVWIHGGGLTMGMASMYDGSALAAFEDVVVVTIQYRLGVLGFFSTGDQHATGNHGYLDQVAALRWVQKNIAHFGGNPGRVTIFGESAGGTSVSSHVLSPMSQGLFHGAIMESLVALLPGLITSSSEVVSTVVANLSRCGQVDSETLVRCLRAKSEEEMLAITQVFMLIPGVVDGVFLPRHPEELLALADFQPVPSIIGINNDEYG...
lipid metabolic process endoplasmic reticulum lumen carboxylesterase activity Oryctolagus cuniculus Direct protein sequencing Disulfide bond Endoplasmic reticulum Glycoprotein Hydrolase Lipid metabolism Pyrrolidone carboxylic acid Reference proteome Serine esterase QDSASPIRNT QDSASPIRNTHTGQVRGSLVHVEGTDAGVHTFLGIPFAKPPLG...
permeabilization of host organelle membrane involved in viral entry into host cell protein complex oligomerization viral entry via permeabilization of inner membrane viral penetration into host nucleus virion attachment to host cell virus-mediated pore formation in host cell membrane
host cell endoplasmic reticulum membrane; host cell nucleus; membrane; viral capsid
DNA binding monoatomic ion channel activity structural molecule activity
BK polyomavirus
Alternative initiation Alternative splicing Capsid protein DNA-binding Host endoplasmic reticulum Host membrane Host nucleus Host-virus interaction Ion channel Ion transport Late protein Lipoprotein Membrane Myristate Transmembrane Transmembrane helix Transport Viral attachment to host cell Viral ion channel Viral pene...
MGAALALLGD
MGAALALLGDLVASVSEAAAATGFSVAEIAAGEAAAAIEVQIASLATVEGITTTSEAIAAIGLTPQTYAVIAGAPGAIAGFAALIQTVTGISSLAQVGYRFFSDWDHKVSTVGLYQQSGMALELFNPDEYYDILFPGVNTFVNNIQYLDPRHWGPSLFATISQALWHVIRDDIPAITSQELQRRTERFFRDSLARFLEETTWTIVNAPINFYNYIQDYYSNLSPIRPSMVRQVAEREGTHVNFGHTYSIDNADSIEEVTQRMDLRNKESVHSGEFIEKTIAPGGANQRTAPQWMLPLLLGLYGTVTPALEAYEDGPNQKK...
permeabilization of host organelle membrane involved in viral entry into host cell protein complex oligomerization viral entry via permeabilization of inner membrane viral penetration into host nucleus virion attachment to host cell virus-mediated pore formation in host cell membrane host cell endoplasmic reticulum mem...
DNA catabolic process DNA restriction-modification system
endonuclease complex
ATP binding ATP hydrolysis activity DNA binding double-stranded methylated DNA binding endonuclease activity GTP binding GTPase activity hemi-methylated DNA-binding identical protein binding restriction endodeoxyribonuclease activity
Escherichia coli
3D-structure Alternative initiation Direct protein sequencing DNA-binding Endonuclease GTP-binding Hydrolase Nuclease Nucleotide-binding Reference proteome Restriction system
MESIQPWIEK
MESIQPWIEKFIKQAQQQRSQSTKDYPTSYRNLRVKLSFGYGNFTSIPWFAFLGEGQEASNGIYPVILYYKDFDELVLAYGISDTNEPHAQWQFSSDIPKTIAEYFQATSGVYPKKYGQSYYACSQKVSQGIDYTRFASMLDNIINDYKLIFNSGKSVIPPMSKTESYCLEDALNDLFIPETTIETILKRLTIKKNIILQGPPGVGKTFVARRLAYLLTGEKAPQRVNMVQFHQSYSYEDFIQGYRPNGVGFRRKDGIFYNFCQQAKEQPEKKYIFIIDEINRANLSKVFGEVMMLMEHDKRGENWSVPLTYSENDEERF...
DNA catabolic process DNA restriction-modification system endonuclease complex ATP binding ATP hydrolysis activity DNA binding double-stranded methylated DNA binding endonuclease activity GTP binding GTPase activity hemi-methylated DNA-binding identical protein binding restriction endodeoxyribonuclease activity Escheri...
carbohydrate metabolic process pentose-phosphate shunt pentose-phosphate shunt, non-oxidative branch
cytoplasm; nucleus
transaldolase activity
Saccharomyces cerevisiae
Acetylation Pentose shunt Reference proteome Schiff base Transferase
MSEPAQKKQK
MSEPAQKKQKVANNSLEQLKASGTVVVADTGDFGSIAKFQPQDSTTNPSLILAAAKQPTYAKLIDVAVEYGKKHGKTTEEQVENAVDRLLVEFGKEILKIVPGRVSTEVDARLSFDTQATIEKARHIIKLFEQEGVSKERVLIKIASTWEGIQAAKELEEKDGIHCNLTLLFSFVQAVACAEAQVTLISPFVGRILDWYKSSTGKDYKGEADPGVISVKKIYNYYKKYGYKTIVMGASFRSTDEIKNLAGVDYLTISPALLDKLMNSTEPFPRVLDPVSAKKEAGDKISYISDESKFRFDLNEDAMATEKLSEGIRKFSA...
carbohydrate metabolic process pentose-phosphate shunt pentose-phosphate shunt, non-oxidative branch cytoplasm; nucleus transaldolase activity Saccharomyces cerevisiae Acetylation Pentose shunt Reference proteome Schiff base Transferase MSEPAQKKQK MSEPAQKKQKVANNSLEQLKASGTVVVADTGDFGSIAKFQPQDSTTNPSLILAAAKQPTYAKLIDVAVEYG...
intracellular iron ion homeostasis iron import into cell siderophore-dependent iron import into cell
ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing; membrane; plasma membrane
iron chelate transmembrane transporter activity transmembrane transporter activity
Escherichia coli
Cell inner membrane Cell membrane Ion transport Iron Iron transport Membrane Reference proteome Transmembrane Transmembrane helix Transport
MKIALVIFIT
MKIALVIFITLALAGCALLSLHMGVIPVPWRALLTDWQAGHEHYYVLMEYRLPRLLLALFVGAALAVAGVLIQGIVRNPLASPDILGVNHAASLASVGALLLMPSLPVMVLPLLAFAGGMAGLILLKMLAKTHQPMKLALTGVALSACWASLTDYLMLSRPQDVNNALLWLTGSLWGRDWSFVKIAIPLMILFLPLSLSFCRDLDLLALGDARATTLGVSVPHTRFWALLLAVAMTSTGVAACGPISFIGLVVPHMMRSITGGRHRRLLPVSALTGALLLVVADLLARIIHPPLELPVGVLTAIIGAPWFVWLLVRMR
intracellular iron ion homeostasis iron import into cell siderophore-dependent iron import into cell ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing; membrane; plasma membrane iron chelate transmembrane transporter activity transmembrane transporter activity Escherichia coli Cell in...
intracellular iron ion homeostasis iron import into cell siderophore-dependent iron import into cell
ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing; membrane; plasma membrane
iron chelate transmembrane transporter activity transmembrane transporter activity
Escherichia coli
Cell inner membrane Cell membrane Ion transport Iron Iron transport Membrane Reference proteome Transmembrane Transmembrane helix Transport
MTAIKHPVLL
MTAIKHPVLLWGLPVAALIIIFWLSLFCYSAIPVSGADATRALLPGHTPTLPEALVQNLRLPRSLVAVLIGASLALAGTLLQTLTHNPMASPSLLGINSGAALAMALTSALSPTPIAGYSLSFIAACGGGVSWLLVMTAGGGFRHTHDRNKLILAGIALSAFCMGLTRITLLLAEDHAYGIFYWLAGGVSHARWQDVWQLLPVVVTAVPVVLLLANQLNLLNLSDSTAHTLGVNLTRLRLVINMLVLLLVGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLLGATLMLLADVLARALAFPGDLPAGAVLALIG...
intracellular iron ion homeostasis iron import into cell siderophore-dependent iron import into cell ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing; membrane; plasma membrane iron chelate transmembrane transporter activity transmembrane transporter activity Escherichia coli Cell in...
protein homotetramerization proteolysis
cytosol; protein-containing complex
aminopeptidase activity identical protein binding manganese ion binding metalloaminopeptidase activity metalloexopeptidase activity
Escherichia coli
3D-structure Aminopeptidase Cytoplasm Direct protein sequencing Hydrolase Manganese Metal-binding Metalloprotease Protease Reference proteome
MSEISRQEFQ
MSEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVR...
protein homotetramerization proteolysis cytosol; protein-containing complex aminopeptidase activity identical protein binding manganese ion binding metalloaminopeptidase activity metalloexopeptidase activity Escherichia coli 3D-structure Aminopeptidase Cytoplasm Direct protein sequencing Hydrolase Manganese Metal-bindi...
ectodermal cell fate commitment mesoderm development negative regulation of transcription by RNA polymerase II positive regulation of transcription by RNA polymerase II primitive streak formation regulation of transcription by RNA polymerase II skeletal system development
chromatin; cytosol; nucleoplasm; nucleus; plasma membrane
DNA binding DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific DNA-binding transcription repressor activity, RNA polymerase II-specific nuclear glucocorticoid receptor binding protein domain specific binding RNA polymerase II cis-regulatory region sequence-sp...
Homo sapiens
3D-structure DNA-binding Nucleus Phosphoprotein Proto-oncogene Reference proteome Transcription Transcription regulation
MNDFGIKNMD
MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSISHDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEENSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFPKSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHDSPENGADSFESSDSLLQSWNSQSSLLDVQRVPSFESFEDDCSQ...
ectodermal cell fate commitment mesoderm development negative regulation of transcription by RNA polymerase II positive regulation of transcription by RNA polymerase II primitive streak formation regulation of transcription by RNA polymerase II skeletal system development chromatin; cytosol; nucleoplasm; nucleus; plasm...
ectodermal cell fate commitment mesoderm development negative regulation of transcription by RNA polymerase II positive regulation of transcription by RNA polymerase II primitive streak formation regulation of transcription by RNA polymerase II
cytosol; nucleoplasm; nucleus; plasma membrane
DNA binding DNA-binding transcription factor activity, RNA polymerase II-specific DNA-binding transcription repressor activity, RNA polymerase II-specific nuclear glucocorticoid receptor binding protein domain specific binding RNA polymerase II cis-regulatory region sequence-specific DNA binding RNA polymerase II trans...
Mus musculus
DNA-binding Nucleus Phosphoprotein Proto-oncogene Reference proteome Transcription Transcription regulation
MNDFGIKNMD
MNDFGIKNMDQVAPVANSFRGTLKRQPAFDTFDGSLFAVLPSLSEDQTLQEVPTGLDSVSHDSASCELPLLTPCSKAVMSQALKATFSGFQKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLHQFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEENSHLNAVPHWINSNTLGFSMEQAPYGMQAPNYPKDNLLDSMCPPSATPAALGSELQMLPKSRLNTVNVNYCSISQDFPSSNVNLLNNNSGKPKDHDSPENGGDSFESSDSLLRSWNSQSSLLDVQRVPSFESFEEDCSQS...
ectodermal cell fate commitment mesoderm development negative regulation of transcription by RNA polymerase II positive regulation of transcription by RNA polymerase II primitive streak formation regulation of transcription by RNA polymerase II cytosol; nucleoplasm; nucleus; plasma membrane DNA binding DNA-binding tran...
base-excision repair, DNA ligation DNA ligation DNA replication
cytosol
DNA binding DNA ligase (NAD+) activity metal ion binding NAD+ binding
Escherichia coli
3D-structure Direct protein sequencing DNA damage DNA repair DNA replication Ligase Magnesium Metal-binding NAD Reference proteome Zinc
MESIEQQLTE
MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKNNEKVTWCCELKLDGLAVSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVFLPQAGFEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGELPDTHLGRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLAQQEQLGFVARAPRWAVAFKFPAQEQ...
base-excision repair, DNA ligation DNA ligation DNA replication cytosol DNA binding DNA ligase (NAD+) activity metal ion binding NAD+ binding Escherichia coli 3D-structure Direct protein sequencing DNA damage DNA repair DNA replication Ligase Magnesium Metal-binding NAD Reference proteome Zinc MESIEQQLTE MESIEQQLTELRTT...
DNA damage response DNA duplex unwinding DNA recombination DNA repair DNA replication SOS response
bacterial nucleoid; chromosome; cytoplasm; replisome; single-stranded DNA-dependent ATP-dependent DNA helicase complex
3'-5' DNA helicase activity ATP binding ATP hydrolysis activity ATP-dependent activity, acting on DNA DNA binding DNA helicase activity four-way junction helicase activity single-stranded DNA helicase activity transition metal ion binding zinc ion binding
Escherichia coli
3D-structure ATP-binding Direct protein sequencing DNA damage DNA recombination DNA repair DNA-binding Helicase Hydrolase Nucleotide-binding Reference proteome SOS response
MAQAEVLNLE
MAQAEVLNLESGAKQVLQETFGYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPALLLNGLTVVVSPLISLMKDQVDQLQANGVAAACLNSTQTREQQLEVMTGCRTGQIRLLYIAPERLMLDNFLEHLAHWNPVLLAVDEAHCISQWGHDFRPEYAALGQLRQRFPTLPFMALTATADDTTRQDIVRLLGLNDPLIQISSFDRPNIRYMLMEKFKPLDQLMRYVQEQRGKSGIIYCNSRAKVEDTAARLQSKGISAAAYHAGLENNVRADVQEKFQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESY...
DNA damage response DNA duplex unwinding DNA recombination DNA repair DNA replication SOS response bacterial nucleoid; chromosome; cytoplasm; replisome; single-stranded DNA-dependent ATP-dependent DNA helicase complex 3'-5' DNA helicase activity ATP binding ATP hydrolysis activity ATP-dependent activity, acting on DNA ...
enterobactin biosynthetic process
cytosol; protein-containing complex
2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase activity identical protein binding
Escherichia coli
3D-structure Direct protein sequencing Enterobactin biosynthesis NAD Oxidoreductase Reference proteome
MDFSGKNVWV
MDFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQAFTQEQYPFATEVMDVADAAQVAQVCQRLLAETERLDALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQRGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALSVGLELAGSGVRCNVVSPGSTDTDMQRTLWVSDDAEEQRIRGFGEQFKLGIPLGKIARPQEIANTILFLASDLASHITLQDIVVDGGSTLGA
enterobactin biosynthetic process cytosol; protein-containing complex 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase activity identical protein binding Escherichia coli 3D-structure Direct protein sequencing Enterobactin biosynthesis NAD Oxidoreductase Reference proteome MDFSGKNVWV MDFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFD...
cellular response to calcium ion gene expression negative regulation of transcription by RNA polymerase II osteoblast development positive regulation of macrophage activation positive regulation of osteoblast differentiation positive regulation of transcription by RNA polymerase II regulation of cell cycle regulation o...
nucleoplasm; nucleus; protein-containing complex; protein-DNA complex; RNA polymerase II transcription regulator complex; transcription factor AP-1 complex; transcription regulator complex; transcription repressor complex
DNA binding DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific double-stranded DNA binding enzyme binding nuclear receptor binding RNA polymerase II cis-regulatory region sequence-specif...
Mus musculus
Disulfide bond DNA-binding Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation
METPFYGEEA
METPFYGEEALSGLAAGASSVAGATGAPGGGGFAPPGRAFPGAPPTSSMLKKDALTLSLAEQGAAGLKPGSATAPSALRPDGAPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSTQFLYPKVAASEEQEFAEGFVKALEDLHKQSQLGAATAATSGAPAPPAPADLAATPGATETPVYANLSSFAGGAGPPGGAATVAFAAEPVPFPPPPGALGPPPPPHPPRLAALKDEPQTVPDVPSFGDSPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQ...
cellular response to calcium ion gene expression negative regulation of transcription by RNA polymerase II osteoblast development positive regulation of macrophage activation positive regulation of osteoblast differentiation positive regulation of transcription by RNA polymerase II regulation of cell cycle regulation o...
detection of chemical stimulus involved in sensory perception of bitter taste epidermal growth factor receptor signaling pathway Fc receptor signaling pathway immunoglobulin transcytosis in epithelial cells mediated by polymeric immunoglobulin receptor receptor clustering
extracellular space; plasma membrane; receptor complex; recycling endosome membrane; secretory IgA immunoglobulin complex
epidermal growth factor receptor binding polymeric immunoglobulin binding polymeric immunoglobulin receptor activity
Rattus norvegicus
Cell membrane Disulfide bond Glycoprotein Immunoglobulin domain Membrane Phosphoprotein Reference proteome Repeat Secreted Signal Transmembrane Transmembrane helix
MRLSLFALLV
MRLSLFALLVTVFSGVSTQSPIFGPQDVSSIEGNSVSITCYYPDTSVNRHTRKYWCRQGANGYCATLISSNGYLSKEYSGRASLINFPENSTFVINIAHLTQEDTGSYKCGLGTTNRGLFFDVSLEVSQVPEFPNDTHVYTKDIGRTVTIECRFKEGNAHSKKSLCKKRGEACEVVIDSTEYVDPSYKDRAILFMKGTSRDIFYVNISHLIPSDAGLYVCQAGEGPSADKNNADLQVLEPEPELLYKDLRSSVTFECDLGREVANDAKYLCRKNKETCDVIINTLGKRDPAFEGRILLTPRDDNGRFSVLITGLRKEDAG...
detection of chemical stimulus involved in sensory perception of bitter taste epidermal growth factor receptor signaling pathway Fc receptor signaling pathway immunoglobulin transcytosis in epithelial cells mediated by polymeric immunoglobulin receptor receptor clustering extracellular space; plasma membrane; receptor ...
leukotriene metabolic process proteolysis proteolysis involved in protein catabolic process response to cadmium ion
extracellular space
metallocarboxypeptidase activity zinc ion binding
Homo sapiens
3D-structure Carboxypeptidase Direct protein sequencing Disulfide bond Hydrolase Metal-binding Metalloprotease Protease Reference proteome Secreted Signal Zinc Zymogen
MRGLLVLSVL
MRGLLVLSVLLGAVFGKEDFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYETMIEDVQSLLDEEQEQMFAFRSRARSTDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKT...
leukotriene metabolic process proteolysis proteolysis involved in protein catabolic process response to cadmium ion extracellular space metallocarboxypeptidase activity zinc ion binding Homo sapiens 3D-structure Carboxypeptidase Direct protein sequencing Disulfide bond Hydrolase Metal-binding Metalloprotease Protease R...
proteolysis
cytoplasmic vesicle; extracellular space
carboxypeptidase activity metallocarboxypeptidase activity zinc ion binding
Homo sapiens
3D-structure Carboxypeptidase Cytoplasmic vesicle Direct protein sequencing Disulfide bond Hydrolase Metal-binding Metalloprotease Protease Reference proteome Secreted Signal Zinc Zymogen
MLALLVLVTV
MLALLVLVTVALASAHHGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQIKPHSTVDFRVKAEDTVTVENVLKQNELQYKVLISNLRNVVEAQFDSRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYLLKVGKAGQNKPAIFMDCGFHAREWISPAFCQWFVREAVRTYGREIQVTELLDKLDFYVLPVLNIDGYIYTWTKSRFWRKTRSTHTGSSCIGTDPNRNFDAGWCEIGASRNPCDETYCGPAAESEKETKALADFIRNKLSSIKAYLTIHSYSQMMIYPYSYAYKL...
proteolysis cytoplasmic vesicle; extracellular space carboxypeptidase activity metallocarboxypeptidase activity zinc ion binding Homo sapiens 3D-structure Carboxypeptidase Cytoplasmic vesicle Direct protein sequencing Disulfide bond Hydrolase Metal-binding Metalloprotease Protease Reference proteome Secreted Signal Zin...
cardiac left ventricle morphogenesis enkephalin processing insulin processing negative regulation of branching morphogenesis of a nerve peptide catabolic process peptide hormone processing peptide hormone secretion peptide metabolic process protein localization to membrane protein localization to secretory granule prot...
dendrite; dense core granule; extracellular region; extracellular space; Golgi apparatus; neuronal cell body; perikaryon; secretory granule; secretory granule membrane; synaptic membrane; transport vesicle membrane
carboxypeptidase activity cell adhesion molecule binding cobalt ion binding metallocarboxypeptidase activity neurexin family protein binding protein domain specific binding zinc ion binding
Rattus norvegicus
Carboxypeptidase Cleavage on pair of basic residues Cytoplasmic vesicle Glycoprotein Hydrolase Membrane Metal-binding Metalloprotease Protease Reference proteome Secreted Signal Zinc Zymogen
MAGRGGRVLL
MAGRGGRVLLALCAALVAGGWLLAAEAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQRGNETIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNLKKIVDQNSKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGTAHEYSSCPDDAIFQSLARAYSSFNPVMSDPNRPPCRKNDDDSSFVDGTTNGGAWY...
cardiac left ventricle morphogenesis enkephalin processing insulin processing negative regulation of branching morphogenesis of a nerve peptide catabolic process peptide hormone processing peptide hormone secretion peptide metabolic process protein localization to membrane protein localization to secretory granule prot...
angiotensin maturation proteolysis
collagen-containing extracellular matrix; extracellular region; extracellular space; secretory granule; transport vesicle
metallocarboxypeptidase activity zinc ion binding
Homo sapiens
Carboxypeptidase Cytoplasmic vesicle Direct protein sequencing Disulfide bond Hydrolase Metal-binding Metalloprotease Protease Reference proteome Signal Zinc Zymogen
MRLILPVGLI
MRLILPVGLIATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHVAANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYNNWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNERRKAIFTDCGIHAREWVSPAFCQWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKNQNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQMLLFPYGYTSKL...
angiotensin maturation proteolysis collagen-containing extracellular matrix; extracellular region; extracellular space; secretory granule; transport vesicle metallocarboxypeptidase activity zinc ion binding Homo sapiens Carboxypeptidase Cytoplasmic vesicle Direct protein sequencing Disulfide bond Hydrolase Metal-bindin...
brown fat cell differentiation cellular response to lithium ion cellular response to tumor necrosis factor cholesterol homeostasis fatty acid transport long-chain fatty acid transport negative regulation of DNA-templated transcription positive regulation of cold-induced thermogenesis positive regulation of inflammatory...
cytoplasm; cytosol; extracellular exosome; lipid droplet; nucleus
fatty acid binding hormone receptor binding long-chain fatty acid binding long-chain fatty acid transporter activity
Homo sapiens
3D-structure Acetylation Cytoplasm Direct protein sequencing Lipid-binding Nucleus Phosphoprotein Reference proteome Transport
MCDAFVGTWK
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA
brown fat cell differentiation cellular response to lithium ion cellular response to tumor necrosis factor cholesterol homeostasis fatty acid transport long-chain fatty acid transport negative regulation of DNA-templated transcription positive regulation of cold-induced thermogenesis positive regulation of inflammatory...
behavioral response to ethanol blood vessel remodeling dopamine catabolic process fear response glucose homeostasis homoiothermy leukocyte mediated immunity leukocyte migration locomotory behavior maternal behavior memory norepinephrine biosynthetic process octopamine biosynthetic process positive regulation of cold-in...
centriolar satellite; chromaffin granule lumen; chromaffin granule membrane; endoplasmic reticulum; extracellular space; secretory granule lumen; secretory granule membrane; transport vesicle membrane
copper ion binding dopamine beta-monooxygenase activity L-ascorbic acid binding
Bos taurus
Catecholamine biosynthesis Copper Cytoplasmic vesicle Direct protein sequencing Disulfide bond Glycoprotein Membrane Metal-binding Monooxygenase Oxidoreductase Reference proteome Signal-anchor Transmembrane Transmembrane helix Vitamin C
MQVPSPSVRE
MQVPSPSVREAASMYGTAVAVFLVILVAALQGSAPAESPFPFHIPLDPEGTLELSWNISYAQETIYFQLLVRELKAGVLFGMSDRGELENADLVVLWTDRDGAYFGDAWSDQKGQVHLDSQQDYQLLRAQRTPEGLYLLFKRPFGTCDPNDYLIEDGTVHLVYGFLEEPLRSLESINTSGLHTGLQRVQLLKPSIPKPALPADTRTMEIRAPDVLIPGQQTTYWCYVTELPDGFPRHHIVMYEPIVTEGNEALVHHMEVFQCAAEFETIPHFSGPCDSKMKPQRLNFCRHVLAAWALGAKAFYYPEEAGLAFGGPGSSRF...
behavioral response to ethanol blood vessel remodeling dopamine catabolic process fear response glucose homeostasis homoiothermy leukocyte mediated immunity leukocyte migration locomotory behavior maternal behavior memory norepinephrine biosynthetic process octopamine biosynthetic process positive regulation of cold-in...
angiogenesis glutamine biosynthetic process protein palmitoylation regulation of endothelial cell migration regulation of sprouting angiogenesis
cytoplasm; cytosol; endoplasmic reticulum; mitochondrion; plasma membrane
ATP binding glutamine synthetase activity metal ion binding protein-cysteine S-palmitoyltransferase activity
Bos taurus
3D-structure Acetylation Angiogenesis ATP-binding Cell membrane Cytoplasm Endoplasmic reticulum Ligase Lipoprotein Magnesium Manganese Membrane Metal-binding Microsome Mitochondrion Nucleotide-binding Palmitate Phosphoprotein Reference proteome Transferase Ubl conjugation
MATSASSHLN
MATSASSHLNKGIKQVYMALPQGDKVQAMYIWIDGTGEGLRCKTRTLDSEPKCIEELPEWNFDGSSTFQSEGSNSDMYLVPAAMFRDPFRKDPNKLVFCEVFKYNRKPAETNLRHTCKRIMDMVSNQRPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGIKIGGTNAEVMPAQWEFQIGPCEGIDMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRG...
angiogenesis glutamine biosynthetic process protein palmitoylation regulation of endothelial cell migration regulation of sprouting angiogenesis cytoplasm; cytosol; endoplasmic reticulum; mitochondrion; plasma membrane ATP binding glutamine synthetase activity metal ion binding protein-cysteine S-palmitoyltransferase a...
angiogenesis cell population proliferation cellular response to starvation glutamate catabolic process glutamine biosynthetic process protein palmitoylation regulation of endothelial cell migration regulation of protein localization to nucleolus regulation of sprouting angiogenesis response to glucose ribosome biogenes...
cell body; cytoplasm; cytosol; endoplasmic reticulum; extracellular exosome; glial cell projection; mitochondrion; nucleus; plasma membrane
ATP binding glutamine synthetase activity identical protein binding metal ion binding protein-cysteine S-palmitoyltransferase activity
Homo sapiens
3D-structure Acetylation Angiogenesis ATP-binding Cell membrane Cytoplasm Disease variant Endoplasmic reticulum Ligase Lipoprotein Magnesium Manganese Membrane Metal-binding Microsome Mitochondrion Nucleotide-binding Palmitate Phosphoprotein Reference proteome Transferase Ubl conjugation
MTTSASSHLN
MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRS...
angiogenesis cell population proliferation cellular response to starvation glutamate catabolic process glutamine biosynthetic process protein palmitoylation regulation of endothelial cell migration regulation of protein localization to nucleolus regulation of sprouting angiogenesis response to glucose ribosome biogenes...
ammonia assimilation cycle angiogenesis cell population proliferation cellular response to starvation glutamate metabolic process glutamine biosynthetic process positive regulation of epithelial cell proliferation positive regulation of insulin secretion positive regulation of synaptic transmission, glutamatergic prote...
axon terminus; cell body; cell projection; cytoplasm; cytosol; endoplasmic reticulum; glial cell projection; mitochondrion; myelin sheath; perikaryon; plasma membrane; protein-containing complex
ATP binding dynein light chain binding glutamate binding glutamine synthetase activity identical protein binding magnesium ion binding manganese ion binding nickel cation binding protein-cysteine S-palmitoyltransferase activity
Mus musculus
Acetylation Angiogenesis ATP-binding Cell membrane Cytoplasm Direct protein sequencing Endoplasmic reticulum Ligase Lipoprotein Magnesium Manganese Membrane Metal-binding Microsome Mitochondrion Nucleotide-binding Palmitate Phosphoprotein Reference proteome Transferase Ubl conjugation
MATSASSHLN
MATSASSHLNKGIKQMYMSLPQGEKVQAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSEGSNSDMYLHPVAMFRDPFRKDPNKLVLCEVFKYNRKPAETNLRHICKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVKITGTNAEVMPAQWEFQIGPCEGIRMGDHLWIARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKCIEEAIDKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRG...
ammonia assimilation cycle angiogenesis cell population proliferation cellular response to starvation glutamate metabolic process glutamine biosynthetic process positive regulation of epithelial cell proliferation positive regulation of insulin secretion positive regulation of synaptic transmission, glutamatergic prote...
box C/D snoRNP assembly cellular response to heat proteasome assembly protein folding protein stabilization response to oxygen levels telomere maintenance
cytoplasm; cytosol; mitochondrion; perinuclear region of cytoplasm; plasma membrane; protein-containing complex
ATP binding ATP hydrolysis activity ATP-dependent protein folding chaperone unfolded protein binding
Saccharomyces cerevisiae
3D-structure ATP-binding Chaperone Coiled coil Cytoplasm Direct protein sequencing Mitochondrion Nucleotide-binding Phosphoprotein Reference proteome Repeat Stress response
MAGETFEFQA
MAGETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQALSDPKQLETEPDLFIRITPKPEEKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKNNEDEQYIWESNAGGSFTVTLDEVNERIGRGTVLRLFLKDDQLEYLEEKRIKEVIKRHSEFVAYPIQLLVTKEVEKEVPIPEEEKKDEEKKDEDDKKPKLEEVDEEEEEKKPKTKKVKEEVQELEELNKTKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIP...
box C/D snoRNP assembly cellular response to heat proteasome assembly protein folding protein stabilization response to oxygen levels telomere maintenance cytoplasm; cytosol; mitochondrion; perinuclear region of cytoplasm; plasma membrane; protein-containing complex ATP binding ATP hydrolysis activity ATP-dependent pro...
C21-steroid hormone biosynthetic process carbohydrate metabolic process cellular hyperosmotic salinity response daunorubicin metabolic process doxorubicin metabolic process epithelial cell maturation fructose biosynthetic process L-ascorbic acid biosynthetic process metanephric collecting duct development negative regu...
cytosol; extracellular exosome; extracellular space; nucleoplasm
alditol:NADP+ 1-oxidoreductase activity allyl-alcohol dehydrogenase activity electron transfer activity glyceraldehyde oxidoreductase activity glycerol dehydrogenase activity L-glucuronate reductase activity NADP-retinol dehydrogenase activity prostaglandin H2 endoperoxidase reductase activity retinal dehydrogenase ac...
Homo sapiens
3D-structure Acetylation Cytoplasm Direct protein sequencing Lipid metabolism NADP Oxidoreductase Phosphoprotein Reference proteome
MASRLLLNNG
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
C21-steroid hormone biosynthetic process carbohydrate metabolic process cellular hyperosmotic salinity response daunorubicin metabolic process doxorubicin metabolic process epithelial cell maturation fructose biosynthetic process L-ascorbic acid biosynthetic process metanephric collecting duct development negative regu...
retinoid metabolic process
cytoplasm
alditol:NADP+ 1-oxidoreductase activity allyl-alcohol dehydrogenase activity glycerol dehydrogenase activity NADP-retinol dehydrogenase activity prostaglandin H2 endoperoxidase reductase activity retinal dehydrogenase activity
Oryctolagus cuniculus
Acetylation Cytoplasm Lipid metabolism NADP Oxidoreductase Reference proteome
MATHLVLYNG
MATHLVLYNGAKMPILGLGTWKSPPGQVTEAVKTAIDLGYRHIDCAHVYQNENEVGVALQEKLKEQVVKREELFIVSKLWCTSHDKSLVKGACQKTLNDLKLDYLDLYLIHWPTGFKHGSEYFPLDAAGNVIPSDTDFLDTWEAMEGLVDEGLVKSIGVSNFNHLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIQYCHSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIADKHKKTTAQVLIRFPMQRNLVVIPKSVTPARIAENFQVFDFELSSEDMTTLLSYNRNWRVCALVSCASHKDYPFHAEF
retinoid metabolic process cytoplasm alditol:NADP+ 1-oxidoreductase activity allyl-alcohol dehydrogenase activity glycerol dehydrogenase activity NADP-retinol dehydrogenase activity prostaglandin H2 endoperoxidase reductase activity retinal dehydrogenase activity Oryctolagus cuniculus Acetylation Cytoplasm Lipid metab...
biphenyl metabolic process
endoplasmic reticulum membrane
aromatase activity heme binding heterocyclic compound binding iron ion binding monooxygenase activity
Rattus norvegicus
Direct protein sequencing Endoplasmic reticulum Heme Iron Membrane Metal-binding Microsome Monooxygenase Oxidoreductase Reference proteome
MVLNFLSPSL
MVLNFLSPSLSRLGLWASVVILMVIVLKLFSLLLRRQKLARAMDSFPGPPTHWLFGHALEIQKLGSLDKVVSWAQQFPHAHPLWFGQFVGFLNIYEPDYAKAVYSRGDPKAADVYDFFLQWIGKGLLVLDGPKWFQHRKLLTPGFHYDVLKPYVAIFAESTRMMLDKWEKKASENKSFDIFCDVGHMALDTLMKCTFGKGDSGLGHRDNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWLTPHGRRFLRACKIAHDHTDEVIRQRKAALQDEKERKKIQQRRHLDFLDILLGVRDESGIKLSDAELRAEVDTFMFEGHDTT...
biphenyl metabolic process endoplasmic reticulum membrane aromatase activity heme binding heterocyclic compound binding iron ion binding monooxygenase activity Rattus norvegicus Direct protein sequencing Endoplasmic reticulum Heme Iron Membrane Metal-binding Microsome Monooxygenase Oxidoreductase Reference proteome MVL...
angiogenesis cell differentiation peptide catabolic process proteolysis
cytoplasm; endoplasmic reticulum-Golgi intermediate compartment; external side of plasma membrane; extracellular exosome; extracellular space; lysosomal membrane; plasma membrane; secretory granule membrane
aminopeptidase activity metalloaminopeptidase activity metallopeptidase activity peptide binding signaling receptor activity virus receptor activity zinc ion binding
Homo sapiens
3D-structure Aminopeptidase Angiogenesis Cell membrane Developmental protein Differentiation Direct protein sequencing Disulfide bond Glycoprotein Host cell receptor for virus entry Host-virus interaction Hydrolase Membrane Metal-binding Metalloprotease Protease Receptor Reference proteome Signal-anchor Sulfation Trans...
MAKGFYISKS
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHPKDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLIRIWARPSAIAAGHGDYALNV...
angiogenesis cell differentiation peptide catabolic process proteolysis cytoplasm; endoplasmic reticulum-Golgi intermediate compartment; external side of plasma membrane; extracellular exosome; extracellular space; lysosomal membrane; plasma membrane; secretory granule membrane aminopeptidase activity metalloaminopepti...
angiogenesis cell differentiation peptide catabolic process proteolysis
cytoplasm; plasma membrane
metalloaminopeptidase activity peptide binding virus receptor activity zinc ion binding
Sus scrofa
3D-structure Aminopeptidase Angiogenesis Cell membrane Developmental protein Differentiation Direct protein sequencing Disulfide bond Glycoprotein Host cell receptor for virus entry Host-virus interaction Hydrolase Membrane Metal-binding Metalloprotease Protease Receptor Reference proteome Signal-anchor Sulfation Trans...
MAKGFYISKA
MAKGFYISKALGILGILLGVAAVATIIALSVVYAQEKNKNAEHVPQAPTSPTITTTAAITLDQSKPWNRYRLPTTLLPDSYNVTLRPYLTPNADGLYIFKGKSIVRLLCQEPTDVIIIHSKKLNYTTQGHMVVLRGVGDSQVPEIDRTELVELTEYLVVHLKGSLQPGHMYEMESEFQGELADDLAGFYRSEYMEGNVKKVLATTQMQSTDARKSFPCFDEPAMKATFNITLIHPNNLTALSNMPPKGSSTPLAEDPNWSVTEFETTPVMSTYLLAYIVSEFQSVNETAQNGVLIRIWARPNAIAEGHGMYALNVTGPIL...
angiogenesis cell differentiation peptide catabolic process proteolysis cytoplasm; plasma membrane metalloaminopeptidase activity peptide binding virus receptor activity zinc ion binding Sus scrofa 3D-structure Aminopeptidase Angiogenesis Cell membrane Developmental protein Differentiation Direct protein sequencing Dis...
coumarin metabolic process epoxygenase P450 pathway xenobiotic metabolic process
cytoplasm; endoplasmic reticulum membrane; intracellular membrane-bounded organelle
arachidonic acid epoxygenase activity aromatase activity heme binding iron ion binding oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen steroid hydroxylase activity
Rattus norvegicus
Direct protein sequencing Endoplasmic reticulum Heme Iron Membrane Metal-binding Microsome Monooxygenase Oxidoreductase Reference proteome
MLDTGLLLVV
MLDTGLLLVVILASLSVMFLVSLWQQKIRERLPPGPTPLPFIGNYLQLNMKDVYSSITQLSERYGPVFTIHLGPRRIVVLYGYDAVKEALVDQAEEFSGRGELPTFNILFKGYGFSLSNVEQAKRIRRFTIATLRDFGVGKRDVQECILEEAGYLIKTLQGTCGAPIDPSIYLSKTVSNVINSIVFGNRFDYEDKEFLSLLEMIDEMNIFAASATGQLYDMFHSVMKYLPGPQQQIIKVTQKLEDFMIEKVRQNHSTLDPNSPRNFIDSFLIRMQEEKYVNSEFHMNNLVMSSLGLLFAGTGSVSSTLYHGFLLLMKHPD...
coumarin metabolic process epoxygenase P450 pathway xenobiotic metabolic process cytoplasm; endoplasmic reticulum membrane; intracellular membrane-bounded organelle arachidonic acid epoxygenase activity aromatase activity heme binding iron ion binding oxidoreductase activity, acting on paired donors, with incorporation...
aldosterone biosynthetic process cellular response to peptide hormone stimulus cholesterol metabolic process cortisol metabolic process glucocorticoid biosynthetic process
mitochondrial inner membrane
corticosterone 18-monooxygenase activity heme binding iron ion binding steroid 11-beta-monooxygenase activity
Bos taurus
Direct protein sequencing Heme Iron Lipid metabolism Membrane Metal-binding Mitochondrion Mitochondrion inner membrane Monooxygenase Oxidoreductase Reference proteome Steroid metabolism Steroidogenesis Transit peptide
MALWAKARVR
MALWAKARVRMAGPWLSLHEARLLGTRGAAAPKAVLPFEAMPRCPGNKWMRMLQIWKEQSSENMHLDMHQTFQELGPIFRYDVGGRHMVFVMLPEDVERLQQADSHHPQRMILEPWLAYRQARGHKCGVFLLNGPQWRLDRLRLNPDVLSLPALQKYTPLVDGVARDFSQTLKARVLQNARGSLTLDIAPSVFRYTIEASTLVLYGERLGLLTQQPNPDSLNFIHALEAMLKSTVQLMFVPRRLSRWMSTNMWREHFEAWDYIFQYANRAIQRIYQELALGHPWHYSGIVAELLMRADMTLDTIKANTIDLTAGSVDTTA...
aldosterone biosynthetic process cellular response to peptide hormone stimulus cholesterol metabolic process cortisol metabolic process glucocorticoid biosynthetic process mitochondrial inner membrane corticosterone 18-monooxygenase activity heme binding iron ion binding steroid 11-beta-monooxygenase activity Bos tauru...
heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules homophilic cell adhesion via plasma membrane adhesion molecules positive regulation of natural killer cell mediated cytotoxicity positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target susceptibility ...
adherens junction; cell surface; cytoplasm; extracellular space; focal adhesion; membrane; plasma membrane
cell adhesion molecule binding signaling receptor activity virus receptor activity
Homo sapiens
3D-structure Alternative splicing Cell adhesion Cell membrane Disulfide bond Glycoprotein Host cell receptor for virus entry Host-virus interaction Immunoglobulin domain Membrane Phosphoprotein Receptor Reference proteome Repeat Secreted Signal Transmembrane Transmembrane helix
MARAMAAAWP
MARAMAAAWPLLLVALLVLSWPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGA...
heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules homophilic cell adhesion via plasma membrane adhesion molecules positive regulation of natural killer cell mediated cytotoxicity positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target susceptibility ...
actin filament organization bone resorption cell projection assembly chemotaxis erythrocyte enucleation G protein-coupled receptor signaling pathway lymphocyte aggregation mast cell proliferation positive regulation of lamellipodium assembly positive regulation of mast cell proliferation positive regulation of neutroph...
cytosol; endoplasmic reticulum membrane; extracellular exosome; focal adhesion; lamellipodium; mitochondrial outer membrane; NADPH oxidase complex; nuclear envelope; phagocytic vesicle membrane; plasma membrane
GTP binding GTPase activity protein kinase regulator activity
Homo sapiens
3D-structure Acetylation ADP-ribosylation Cytoplasm Direct protein sequencing Disease variant Glycoprotein GTP-binding Lipoprotein Methylation Nucleotide-binding Prenylation Reference proteome
MQAIKCVVVG
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL
actin filament organization bone resorption cell projection assembly chemotaxis erythrocyte enucleation G protein-coupled receptor signaling pathway lymphocyte aggregation mast cell proliferation positive regulation of lamellipodium assembly positive regulation of mast cell proliferation positive regulation of neutroph...
collagen catabolic process proteolysis
extracellular region
metal ion binding metalloendopeptidase activity toxin activity
Crotalus atrox
3D-structure Calcium Collagen degradation Direct protein sequencing Disulfide bond Hemorrhagic toxin Hemostasis impairing toxin Hydrolase Metal-binding Metalloprotease Protease Pyrrolidone carboxylic acid Secreted Signal Toxin Zinc Zymogen
MIEVLLVTIC
MIEVLLVTICLAVFPYQGSSIILESGNVNDYEVVYPRKVTALPKGAVQPKYEDAMQYELKVNGEPVVLHLEKNKELFSKDYSETHYSPDGRKITTNPSVEDHCYYRGRIENDADSTASISACNGLKGHFKLQGEMYLIEPLELSDSEAHAVFKLENVEKEDEAPKMCGVTQNWESYEPIKKASDLNLNPDQQNLPQRYIELVVVADHRVFMKYNSDLNTIRTRVHEIVNFINGFYRSLNIHVSLTDLEIWSNEDQINIQSASSDTLNAFAEWRETDLLNRKSHDNAQLLTAIELDEETLGLAPLGTMCDPKLSIGIVQDH...
collagen catabolic process proteolysis extracellular region metal ion binding metalloendopeptidase activity toxin activity Crotalus atrox 3D-structure Calcium Collagen degradation Direct protein sequencing Disulfide bond Hemorrhagic toxin Hemostasis impairing toxin Hydrolase Metal-binding Metalloprotease Protease Pyrro...
bradykinin catabolic process peptide metabolic process protein catabolic process protein processing response to glucocorticoid
extracellular region; extracellular space
metallocarboxypeptidase activity zinc ion binding
Homo sapiens
3D-structure Carboxypeptidase Direct protein sequencing Disease variant Disulfide bond Glycoprotein Hydrolase Metal-binding Metalloprotease Protease Reference proteome Secreted Signal Zinc
MSDLLSVFLH
MSDLLSVFLHLLLLFKLVAPVTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEEL...
bradykinin catabolic process peptide metabolic process protein catabolic process protein processing response to glucocorticoid extracellular region; extracellular space metallocarboxypeptidase activity zinc ion binding Homo sapiens 3D-structure Carboxypeptidase Direct protein sequencing Disease variant Disulfide bond G...
G1/S transition of mitotic cell cycle nuclear-transcribed mRNA catabolic process, nonsense-mediated decay protein methylation regulation of translational termination translation translational termination
cytoplasm; cytosol; cytosolic ribosome; translation release factor complex
GTP binding GTPase activity RNA binding translation release factor activity
Homo sapiens
3D-structure Alternative splicing GTP-binding Hydrolase Nonsense-mediated mRNA decay Nucleotide-binding Protein biosynthesis Reference proteome
MELSEPIVEN
MELSEPIVENGETEMSPEESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKPKSVVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVLGK...
G1/S transition of mitotic cell cycle nuclear-transcribed mRNA catabolic process, nonsense-mediated decay protein methylation regulation of translational termination translation translational termination cytoplasm; cytosol; cytosolic ribosome; translation release factor complex GTP binding GTPase activity RNA binding t...
cell cycle cellular response to estradiol stimulus cellular response to growth factor stimulus cellular response to lithium ion cellular response to tumor necrosis factor muscle cell fate commitment negative regulation of cell population proliferation ossification positive regulation of muscle atrophy positive regulati...
chromatin; nucleoplasm; nucleus; protein-DNA complex; transcription regulator complex
chromatin DNA binding DNA-binding transcription activator activity DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific E-box binding protein dimerization activity RNA polymerase II cis-re...
Homo sapiens
Activator Cell cycle Developmental protein Differentiation DNA-binding Myogenesis Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation
MELYETSPYF
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN
cell cycle cellular response to estradiol stimulus cellular response to growth factor stimulus cellular response to lithium ion cellular response to tumor necrosis factor muscle cell fate commitment negative regulation of cell population proliferation ossification positive regulation of muscle atrophy positive regulati...
lysyl-tRNA aminoacylation
cytoplasm; cytosol
ATP binding lysine-tRNA ligase activity mRNA binding tRNA binding
Saccharomyces cerevisiae
3D-structure Acetylation Aminoacyl-tRNA synthetase ATP-binding Cytoplasm Direct protein sequencing Isopeptide bond Ligase Nucleotide-binding Phosphoprotein Protein biosynthesis Reference proteome Ubl conjugation
MSQQDNVKAA
MSQQDNVKAAAEGVANLHLDEATGEMVSKSELKKRIKQRQVEAKKAAKKAAAQPKPASKKKTDLFADLDPSQYFETRSRQIQELRKTHEPNPYPHKFHVSISNPEFLAKYAHLKKGETLPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYCDPDSYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYE...
lysyl-tRNA aminoacylation cytoplasm; cytosol ATP binding lysine-tRNA ligase activity mRNA binding tRNA binding Saccharomyces cerevisiae 3D-structure Acetylation Aminoacyl-tRNA synthetase ATP-binding Cytoplasm Direct protein sequencing Isopeptide bond Ligase Nucleotide-binding Phosphoprotein Protein biosynthesis Refere...
disruption by virus of host JAK-STAT cascade via inhibition of STAT1 activity disruption by virus of host JAK-STAT cascade via inhibition of STAT2 activity microtubule-dependent intracellular transport of viral material towards nucleus suppression by virus of host toll-like receptor signaling pathway suppression by vir...
host cell cytoplasm; host cell nucleus; virion component
RNA-dependent RNA polymerase activity
Rabies virus
3D-structure Alternative initiation Chaperone Cytoplasmic inwards viral transport Host cytoplasm Host nucleus Host-virus interaction Inhibition of host innate immune response by virus Inhibition of host interferon signaling pathway by virus Inhibition of host STAT1 by virus Inhibition of host STAT2 by virus Inhibition ...
MSKIFVNPSA
MSKIFVNPSAIRAGLADLEMAEETVDLINRNIEDNDAHLQGEPIEVDNLPEDMKRLHLDDEKSSNLGEMVRVGEGKYREDFQMDEGEDPNLLFQSYLDNVGVQIVRQMRSGERFLKIWSQTVEEIVSYVTVNFPNPPRRSSEDKSTQTTGRELKKETTSAFSQRESQPSKARMVAQVAPGPPALEWSATNEEDDLSVEAEIAHQIAESFSKKYKFPSRSSGIFLYNFEQLKMNLDDIVKEAKNVPGVTRLAHDGSKIPLRCVLGWVALANSKKFQLLVEADKLSKIMQDDLNRYTSC
disruption by virus of host JAK-STAT cascade via inhibition of STAT1 activity disruption by virus of host JAK-STAT cascade via inhibition of STAT2 activity microtubule-dependent intracellular transport of viral material towards nucleus suppression by virus of host toll-like receptor signaling pathway suppression by vir...
hydrogen peroxide catabolic process response to hydrogen peroxide response to reactive oxygen species
cytoplasm; mitochondrial matrix; mitochondrion; peroxisomal matrix; peroxisome
catalase activity heme binding metal ion binding
Saccharomyces cerevisiae
3D-structure Acetylation Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase Peroxisome Reference proteome
MSKLGQEKNE
MSKLGQEKNEVNYSDVREDRVVTNSTGNPINEPFVTQRIGEHGPLLLQDYNLIDSLAHFNRENIPQRNPHAHGSGAFGYFEVTDDITDICGSAMFSKIGKRTKCLTRFSTVGGDKGSADTVRDPRGFATKFYTEEGNLDWVYNNTPVFFIRDPSKFPHFIHTQKRNPQTNLRDADMFWDFLTTPENQVAIHQVMILFSDRGTPANYRSMHGYSGHTYKWSNKNGDWHYVQVHIKTDQGIKNLTIEEATKIAGSNPDYCQQDLFEAIQNGNYPSWTVYIQTMTERDAKKLPFSVFDLTKVWPQGQFPLRRVGKIVLNENPL...
hydrogen peroxide catabolic process response to hydrogen peroxide response to reactive oxygen species cytoplasm; mitochondrial matrix; mitochondrion; peroxisomal matrix; peroxisome catalase activity heme binding metal ion binding Saccharomyces cerevisiae 3D-structure Acetylation Heme Hydrogen peroxide Iron Metal-bindi...
cell-cell junction organization detection of hypoxia face morphogenesis negative regulation of cell population proliferation negative regulation of macrophage cytokine production positive regulation of cell division positive regulation of cell population proliferation positive regulation of collagen biosynthetic proces...
extracellular matrix; extracellular space
cytokine activity growth factor activity identical protein binding transforming growth factor beta binding type I transforming growth factor beta receptor binding type II transforming growth factor beta receptor binding type III transforming growth factor beta receptor binding
Sus scrofa
Cleavage on pair of basic residues Disulfide bond Extracellular matrix Glycoprotein Growth factor Mitogen Reference proteome Secreted Signal
MHLQRALVVL
MHLQRALVVLALLNFATVSLSMSTCTTLDFDHIKRKRVEAIRGQILSKLRLTSPPDPSMLANIPTQVLDLYNSTRELLEEVHGERGDDCTQENTESEYYAKEIYKFDMIQGLEEHNDLAVCPKGITSKIFRFNVSSVEKNETNLFRAEFRVLRMPNPSSKRSEQRIELFQILQPDEHIAKQRYIDGKNLPTRGAAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIQEVMEIKFKGVDSEDDPGRGDLGRLKKKKEHSPHLILMMIPPDRLDNPGLGAQRKKRALDTNYCFRNLEENCCVRPLYID...
cell-cell junction organization detection of hypoxia face morphogenesis negative regulation of cell population proliferation negative regulation of macrophage cytokine production positive regulation of cell division positive regulation of cell population proliferation positive regulation of collagen biosynthetic proces...
positive regulation of DNA-templated transcription
nucleus
nuclear receptor activity nuclear retinoid X receptor binding nuclear thyroid hormone receptor binding protein heterodimerization activity protein homodimerization activity sequence-specific DNA binding thyroid hormone binding zinc ion binding
Xenopus laevis
DNA-binding Metal-binding Nucleus Receptor Reference proteome Transcription Transcription regulation Zinc Zinc-finger
MDQNLSGLDC
MDQNLSGLDCLSEPDEKRWPDGKRKRKNSQCMGKSGMSGDSLVSLPSAGYIPSYLDKDEPCVVCSDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYDGCCIIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEENRQRRRKEEMIKTLQQRPEPSSEEWELIRIVTEAHRSTNAQGSHWKQRRKFLPEDIGQSPMASMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELTCEDQIILLKGCCMEIMSLRAAVRYDPDSETLTLSGEMAVKREQLKNGGLGVVSDAIFDLGRSLAAFNLD...
positive regulation of DNA-templated transcription nucleus nuclear receptor activity nuclear retinoid X receptor binding nuclear thyroid hormone receptor binding protein heterodimerization activity protein homodimerization activity sequence-specific DNA binding thyroid hormone binding zinc ion binding Xenopus laevis DN...
defense response to fungus killing of cells of another organism
extracellular region
sodium channel inhibitor activity toxin activity
Tityus serrulatus
3D-structure Amidation Antimicrobial Direct protein sequencing Disulfide bond Fungicide Ion channel impairing toxin Neurotoxin Secreted Signal Toxin Voltage-gated sodium channel impairing toxin
MKGMILFISC
MKGMILFISCLLLIGIVVECKEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKCGKK
defense response to fungus killing of cells of another organism extracellular region sodium channel inhibitor activity toxin activity Tityus serrulatus 3D-structure Amidation Antimicrobial Direct protein sequencing Disulfide bond Fungicide Ion channel impairing toxin Neurotoxin Secreted Signal Toxin Voltage-gated sodiu...
B cell differentiation B cell proliferation immunoglobulin mediated immune response positive regulation of cell growth positive regulation of interleukin-5 production regulation of peptidyl-tyrosine phosphorylation regulation of receptor signaling pathway via JAK-STAT
extracellular space
cytokine activity growth factor activity interleukin-9 receptor binding
Mus musculus
3D-structure Cytokine Direct protein sequencing Glycoprotein Growth factor Pyrrolidone carboxylic acid Reference proteome Secreted Signal
MLVTYILASV
MLVTYILASVLLFSSVLGQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP
B cell differentiation B cell proliferation immunoglobulin mediated immune response positive regulation of cell growth positive regulation of interleukin-5 production regulation of peptidyl-tyrosine phosphorylation regulation of receptor signaling pathway via JAK-STAT extracellular space cytokine activity growth factor...