Split (1)

train · ~24M rows (showing the first 1.04M)

Document stringlengths 87 1.67M	Source stringclasses 5 values
Hotcha (company) Hotcha was a take-away restaurant chain that serves Chinese cuisine. The chain was founded by James Liang and Andy Chan in 2011, and is headquartered in Bristol, England. In 2014, it was reported that Hotcha was the largest Chinese takeaway chain in Britain provided by the Tsang Corporation. Hotcha went into administration on 18 October 2017. History Hotcha was founded in 2011 by James Liang and Andy Chan, the two met in college and previously ran an import business until economic conditions forced them out of the market. The pair chose to start a Chinese cuisine takeaway after learning that there was no national brand occupying the market. In 2014, after opening ten corporate locations, the company announced that it planned to use a combination of franchising and company owned locations to expand its reach in the future. Hotcha generated sales of £4.5 million and began expanding into the Liverpool area in 2015. In October 2016, the company received a £7.5m investment from the Tsang Corporation to help fund further expansion. Hotcha also announced it planned on opening four new sites by year end 2016. That same year, the company was included on the Sunday Times Fast Track 100 list and its founder was included on Debrett's 500 list of entrepreneurs. In January 2017, Hotcha opened its 13th location and announced it planned to open as many as 20 additional locations by year end. The company announced that it would move its headquarters, food preparation and distribution centre to a single Bristol location in March 2017. In October 2017 it was reported that officers from HMRC had raided a number of Hotcha's business locations as part of an investigation into the suspected laundering of 35 million pounds. Hotcha went into administration on 18 October 2017.	WIKI
Foreign tables with Foreign Data Wrappers in PostgreSQL Anna Bellandi Anna Bellandi This short article explains briefly how to access to data stored in external PostgreSQL servers through the native postgres_fdw module. PostgreSQL has an useful feature called Foreign Data Wrappers (FDW), introduced since version 9.3. The Foreign Data Wrapper allows access to data hosted on an external database as if it were kept on a normal local table. The postgres_fdw extension is an evolution of the dblink extension, but provides more transparent and standards-compliant syntax for accessing remote tables, and can give better performance in many cases. You can indeed create foreign tables as described in SQL/MED (Management of External Data). This short guide refers to version 11 of PostgreSQL and later, but the content also applies to previous versions (especially since PostgreSQL 9.6, where the latest improvements were applied). A Small Example Let’s have a look at a simple example of how to use a FDW. Suppose we have two PostgreSQL 11 databases in two different servers: • woody • IP: 192.168.33.10 • Database: source • Owner: user01 • buzz • IP: 192.168.33.11 • Database: destination • Owner: user02 As first thing, we connect to the source database as user01 and create a few test tables useful for this demonstration: CREATE TABLE test1 AS SELECT id, md5(random()::text) FROM generate_series(1,5) id; CREATE TABLE test2 AS SELECT id, md5(random()::text) FROM generate_series(6,10) id; CREATE TABLE test3 AS SELECT id, md5(random()::text) FROM generate_series(11,15) id; Now, suppose we want to access the data stored in woody from buzz. Configuration To configure the remote access using postgres_fdw we have to simply connect to buzz and follow the steps below as database superuser (i.e. postgres). 1. Install the postgres_fdw extension: \c destination CREATE EXTENSION postgres_fdw; 1. Create a foreign server object to represent each remote database you want to connect to: CREATE SERVER woody_server FOREIGN DATA WRAPPER postgres_fdw OPTIONS ( host '192.168.33.10', port '5432', dbname 'source' ); 1. GRANT the USAGE permission on the foreign server to the owner user of the destination database: GRANT USAGE ON FOREIGN SERVER woody_server TO user02; 1. Create a user mapping for each database user that must access this foreign server: CREATE USER MAPPING FOR user02 SERVER woody_server OPTIONS ( user 'user_fdw', password 'eThah5ae'); Note: As a solution to CVE-2007-6601 and CVE-2007-3278, postgres_fdw requires that connections by non-superusers specify a password in the user mapping, and that the server actually uses that password when authenticating the user. Check the related KB article. In order to actually use the user_fdw user from the buzz instance we need to connect to the woody server, create the user_fdw user and GRANT it the SELECT permission (at least): CREATE USER user_fdw; \password user_fdw Enter new password: Enter it again: Note: You must specify the same password you used in the CREATE USER MAPPING statement. Then, as owner of the source database (user01), GRANT to user_fdw user the SELECT permission on those tables: GRANT SELECT ON TABLE test1 TO user_fdw; GRANT SELECT ON TABLE test2 TO user_fdw; GRANT SELECT ON TABLE test3 TO user_fdw; Now we have to be sure that pg_hba.conf in the woody server allows access as user_fdw user to the source database and only from the buzz server (192.168.33.11): host source user_fdw 192.168.33.11/32 md5 Note: For the sake of simplicity of this example we have set an unencrypted connection (without SSL) with the md5 authentication method. We strongly recommend to use SSL connections between different servers and use the scram-sha-256 authentication method for real use case. Then, as the postgres user, reload the PostgreSQL server configuration from the command line on woody: psql -c 'SELECT pg_reload_conf()' Access to Foreign Data Now we have two possible choices: 1. create a foreign table for each remote table you want access using CREATE FOREIGN TABLE as user02: CREATE FOREIGN TABLE test1_ft ( id integer, md5 text) SERVER woody_server OPTIONS ( table_name 'test1'); We can now compare the content of the two test tables on the respective servers. On the woody server: source=# SELECT * FROM test1; id \| md5 1 \| b2862260a8471c95cca19a7e9a299d62 2 \| fd4a2bfe9e30ad249087ce5a532386d9 3 \| 5af85340ff971fe2c5e7cdcb354eb73e 4 \| b44014541daedd1044e02a746a017b99 5 \| ac604607259fe7adf680f40af0494a9e (5 rows) And on the buzz server: destination=# SELECT * FROM test1_ft ; id \| md5 1 \| b2862260a8471c95cca19a7e9a299d62 2 \| fd4a2bfe9e30ad249087ce5a532386d9 3 \| 5af85340ff971fe2c5e7cdcb354eb73e 4 \| b44014541daedd1044e02a746a017b99 5 \| ac604607259fe7adf680f40af0494a9e (5 rows) 1. Alternatively, since PostgreSQL 9.5, we can use IMPORT FOREIGN SCHEMA which allows importing an entire schema from an external data source avoiding to specify the structure of each table. On the destination database, as the owner user (user02), issue the following statements: CREATE SCHEMA imported_schema; IMPORT FOREIGN SCHEMA public FROM SERVER woody_server INTO imported_schema; Let’s make a quick inspection of all the tables on the target database to observe the outcome of the schema import: destination=# \dE . List of relations Schema \| Name \| Type \| Owner imported_schema \| test1 \| foreign table \| postgres imported_schema \| test2 \| foreign table \| postgres imported_schema \| test3 \| foreign table \| postgres (3 rows) If it is not necessary to import an entire schema, it is possible to use the LIMIT TO clause to import only a list of tables we are interested in (e.g. test2 table): IMPORT FOREIGN SCHEMA public LIMIT TO (test2) FROM SERVER woody_server INTO imported_schema; On the other hand, if we want to exclude certain tables from the schema, it is possible to filter them using the EXCEPT clause (e.g. excluding test3 table): IMPORT FOREIGN SCHEMA public EXCEPT (test3) FROM SERVER woody_server INTO imported_schema; Conclusions Thanks to this feature, data and schema migrations become increasingly simpler and quicker. The Foreign Data Wrappers provided natively with the PostgreSQL distribution are postgres_fdw and file_fdw, giving access to external Postgres databases and text files respectively. Note finally that there are several unofficial PostgreSQL foreign data wrappers for accessing other kinds of databases. Was this article helpful? 0 out of 0 found this helpful	ESSENTIALAI-STEM
Wikipedia:Articles for deletion/List of Malayalam film actors (3rd nomination) The result was delete. At first glance, this could be a "no consensus", but I'm going with delete. A difficult one in light of the lack of participation, but i found the arguments that it duplicates a category rather convincing. This is just a list of names with no real content or clearly defined inclusion criteria. There are also WP:BLP concerns to consider- by placing a person in this list, they are labelled as belonging to a group, but no sources at all are provided to prove that they belong in said group. The other policy consideration is WP:INDISCRIMINATE- Wikipedia is not an indiscriminate collection of information and this list is little more than that. HJ Mitchell \| Penny for your thoughts? 03:17, 1 August 2010 (UTC) List of Malayalam film actors AfDs for this article: * – ( View AfD View log • ) This list is not comprehensive and does not provide any useful information. This article just has a list which is difficult to maintain and is just a subset of the Category:Malayali actors. Sreejith K (talk) 18:15, 17 July 2010 (UTC) Delete per nom and WP:NOTLINK. — Parent5446 ☯ ([ msg] email) 20:35, 17 July 2010 (UTC) Delete per nom, pointless list. JBsupreme ( talk ) ✄ ✄ ✄ 18:42, 17 July 2010 (UTC) * Keep - Looking more closely at the notability guidelines for lists of people, and observing the fact that numerous other articles quite similar to this one already exist, I am changing my vote to Keep. — Parent5446 ☯ ([ msg] email) 15:59, 18 July 2010 (UTC) Please add new comments below this notice. Thanks, Ron Ritzman (talk) 00:01, 24 July 2010 (UTC) * Note: This debate has been included in the list of India-related deletion discussions. -- • Gene93k (talk) 23:48, 17 July 2010 (UTC) * Note: This debate has been included in the list of Lists of people-related deletion discussions. -- • Gene93k (talk) 23:48, 17 July 2010 (UTC) * Keep Perfectly fine inclusion criteria of a notable topic. Lists and categories go hand-in-hand, per WP:CLN. Part of the bigger scheme Category:Lists of actors by nationality. Lugnuts (talk) 08:38, 18 July 2010 (UTC) * Strong Delete Per nomination.-- LAA Fan '' 01:53, 21 July 2010 (UTC) * Relisted to generate a more thorough discussion so consensus may be reached. * Delete The sad thing about an indiscriminate list is the waste of an opportunity. This tells us nothing about any of the persons mentioned, and essentially reflects that the authors never actually cared about Malayalam film actors. Turns out that Adoor Bhasi is a comedian, and Babu Antony often portrays villains, but no, I don't want to click on the links to find out about the rest of the persons on this list of names in alphabetical order. If you can't want to do anything more than parroting a category, don't even bother, you're wasting your time and ours too. Mandsford 02:30, 24 July 2010 (UTC) * Keep as it stands, its really a lousy list, and i hate lousy lists. the lede is possibly incorrect (malayalam is the language not the people), and doesnt elaborate on the criteria. the list should have some hidden text telling people not to add redlinks or unlinked names without references. each name SHOULD ideally have one other piece of info: birth date, birth province, other notable facts like whether they are also directors, writers etc. however, since its entirely reasonable to say that a list of malayalam/malayi actors is possible, i think on principle it should stand and not just exist as a category. I know, no one is probably ever going to fix it, and its horrible. If it passes afd i will add some of what i list here.Mercurywoodrose (talk) 02:54, 24 July 2010 (UTC)	WIKI
This documentation is archived and is not being maintained. How to: Specify Events and Data Columns for a Trace File (SQL Server Profiler) This topic describes how to specify event classes and data columns for traces by using SQL Server Profiler. 1. On the Trace Properties or Trace Template Properties dialog box, click the Events Selection tab. The Events Selection tab contains a grid control. The grid control is a table that contains each of the traceable event classes. The table contains one row for each event class. The event classes can differ slightly depending on the type and version of server to which you are connected. The event classes are identified in the Events column of the grid and are grouped by event category. The remaining columns list the data columns that can be returned for each event class. 2. On the Events Selection tab, use the grid control to add or remove events and data columns from the trace file. 3. To remove events from the trace, clear the check box in the Events column for each event class. 4. To include events in a trace, check the box in the Events column for each event class, or check a data column that corresponds to an event. ms188674.note(en-US,SQL.90).gifImportant: If the trace is going be correlated with System Monitor or Performance Monitor data, both Start Time and End Time data columns must be included in the trace. When you include an event class, every associated data column is also included to the trace, if you have checked the box corresponding to an event. If you checked the box for a particular column, only that column is included in the trace. Show:	ESSENTIALAI-STEM
Donald Trump and the GOP, see you in two years \| TheHill Last night, a minority of voters, potentially aided by the deliberate weakening of the Voting Rights Act, disproportionately favored by our arcane and pointless electoral college system, and for the second time in five elections, handed the White House to a man the majority of voters rejected. I feel like Leia watching as her home of Alderaan is vaporized by the Death Star. Utterly helpless as the home I knew and fought for disappears. My daughter will turn five just a few days after the inauguration. I had hoped that her first political memory would be of the first female President being sworn into office. Instead, we’ve picked a man to lead us who considers her and all other women to be either ugly pigs worthy of nothing but scorn and public shaming, or objectified sex toys that exist purely for his own personal gratification. Two years. That’s how long we have to survive this unmitigated disaster before we have another shot at fixing it. And a disaster it will be. For civil rights, healthcare, the economy, global stability and peace, and the future health and sustainability of the Earth herself. Monday, I had made the bold claim that regardless of outcome, this year’s election would be the last one the GOP would participate in as a viable national party, and I stand by that claim. In some ways, Trump’s victory may have only strengthened the argument. Once all the votes are tallied, Trump will have lost every demographic except older white Americans. This constituency will continue to die off at a natural rate, but Latinos, blacks, immigrants, Muslims, women, LGTBQI, and the young will only grow. And in the intervening years, everything that goes wrong, all of our compounding disasters, will rest squarely and exclusively on the shoulders of the GOP on Capitol Hill. They will have absolutely no one to blame but themselves, and the public will quickly grow tired of their excuses. Trump will not win a second term, if his attention span allows him to serve out his entire term in the first place. Which brings us to the 2018 midterms. Once more, the entire House will be up for reelection, as well as a third of the Senate, although Democrats have more to defend. In the meantime, a very helpful Republican minority party starting in 2009 laid out the template for the sort of blockade the Democrats will have to employ in Congress for the next two years to blunt the worst of Trump’s domestic agenda. Two years. We need a Gandalf to stand astride the Bridge of Khazad Dum. The Balrog is coming, and I fear it is beyond any of us. Tomlinson is an author and regular contributor to the Hill on state, local and national politics. Follow him on Twitter @stealthygeek. The views expressed by Contributors are their own and are not the views of The Hill. View the discussion thread. Contributor's Signup The Hill 1625 K Street, NW Suite 900 Washington DC 20006 \| 202-628-8500 tel \| 202-628-8503 fax The contents of this site are ©2019 Capitol Hill Publishing Corp., a subsidiary of News Communications, Inc.	NEWS-MULTISOURCE
Transcendence measures of certain numbers whose transcendency was proved by A. Baker Compositio Mathematica, Volume 28 (1974) no. 2, p. 179-194 @article{CM_1974__28_2_179_0, author = {Cijsouw, Pieter}, title = {Transcendence measures of certain numbers whose transcendency was proved by A. Baker}, journal = {Compositio Mathematica}, publisher = {Noordhoff International Publishing}, volume = {28}, number = {2}, year = {1974}, pages = {179-194}, zbl = {0284.10014}, mrnumber = {347745}, language = {en}, url = {http://www.numdam.org/item/CM_1974__28_2_179_0} } Cijsouw, P. L. Transcendence measures of certain numbers whose transcendency was proved by A. Baker. Compositio Mathematica, Volume 28 (1974) no. 2, pp. 179-194. http://www.numdam.org/item/CM_1974__28_2_179_0/ [1] A. Baker: Linear forms in the logarithms of algebraic numbers III. Mathematika 14 (1967) 220-228. \| MR 220680 \| Zbl 0161.05301 [2] A. Baker: A central theorem in transcendence theory, Diophantine approximations and its applications (edited by Charles F. Osgood). Academic Press, New York and London 1973, pp. 1-23. \| MR 354568 \| Zbl 0262.10022 [3] P.L. Cijsouw: Transcendence measures, thesis. University of Amsterdam, 1972. \| MR 349596 \| Zbl 0252.10031 [4] P.L. Cijsouw: Transcendence measures of exponentials and logarithms of algebraic numbers Comp. Math. 28 (2) (1974) 163-178. \| Numdam \| MR 347744 \| Zbl 0284.10013 [5] N.I. Fel'Dman: Estimate for a linear form of logarithms of algebraic numbers (Russian). Mat. Sbornik (N.S.) 76 (118) (1968) 304-319.English translation: Math. USSR Sbornik 5 (1968) 291-307. \| MR 228445 \| Zbl 0195.33701 [6] N.I. Fel'Dman: Improved estimate for a linear form of the logarithms of algebraic numbers (Russian). Mat. Sbornik (N.S.) 77 (119) (1968) 423-436.English translation: Math. USSR Sbornik 6 (1968) 393-406. \| MR 232736 \| Zbl 0235.10018 [7] A.A. Smelev: The approximation of a certain class of transcendental numbers (Russian). Mat. Zametki 5 (1) (1969) 117-128.English translation: Math. Notes 5 (1969) 73-79. \| MR 238769 \| Zbl 0278.10033	ESSENTIALAI-STEM
Talk:Mercury Cougar 1968 Sunroof Since ASC's first OEM sunroof job was on the 1968 Cougar XR-7 doesn't that mean that it was the first American car with an OEM sunroof? I would add it but I'm not 100% sure and the 1967-1973 section looks like a big blob of text.--Capnchicken 04:26, 18 August 2006 (UTC) Merge proposal:Ford Cougar>Mercury Cougar Keep: Don't merge the two articles; from a European persepctive, if I look for Ford Cougar and find the Mercury Cougar Page, I'm going to be very, very confused. Da-rb 17:26, 28 May 2006 (UTC) Merge, but have Ford Cougar point to the Mercury Cougar page - can it go right to the 1999-2002 Cougar section (which would then clearly delineate that these are essentially the same car)? --Rmarquet 16:52, 7 June 2006 (UTC) Strong Keep - The Ford Cougar is notable enough to warrant its own page - the Mercury Cougar is a long-running Amercian car name from the 1960s, and from a European perspective, the Ford model is only the 1999 onwards version, which has its own background (of a planned replacement for the Capri, etc). Redirects cannot go to a particular section of an article, so this is likely to cause confusion. Also, the newest Cougar is ultimately based on the European Ford Mondeo chassis, anyway. Bob 13:33, 20 June 2006 (UTC) Strong Keep - As a European, I'd consider "our" Cougar (the post '99 Ford Mondeo-based Ford Probe replacement) to be worlds apart from the Mercury. I'd be very unimpressed if a search for the Ford Mondeo-based coupé brought me here. -- DeLarge 16:02, 20 June 2006 (UTC) Why do you think they're "worlds apart"? The US Cougar is based on the same Mondeo platform, has the same engine and drivetrain options, same body panels, etc. The only differences I know of are that the European versions are right-hand drive (of course), have more lighting (such as the rear fogs and parking sidelights), have a better climate control system, and have different taillights (amber turn signals). Rmarquet 02:06, 30 September 2006 (UTC) * And all Cougars were built in the USA. * But I see no urgent need to merge. —The preceding unsigned comment was added by <IP_ADDRESS> (talk) 11:14, 20 November 2006 Keep - Ford Focus is split. Reginmund 18:47, 13 August 2007 (UTC) Accuracy request 1980-1988 section infobox: PLEASE check this for accuracy; there were a LOT of combinations, and it might make more sense to do infoboxes by "sub-year" (1980-1982, 1983-1986, 1987-1988) instead of the big one I did - I would've done this but I ran out of energy. I wasn't able to find some specs on the 1980-1982 Cougars. I used http://www.coolcats.net/fox/ and the text of the article (nicely, they seem to agree) to figure out the engine options. Also used that site as the source of the length, width, curb weight, etc. information (in both the 1980-1988 and the 1989-1997 sections). --Rmarquet 20:14, 10 June 2006 (UTC) Accuracy request Ford Cougar (Export) Export Ford Cougar Main article: Ford Cougar '''With the exception of Ford Blue Oval badging replacing Cougar emblems on the exterior and interior, both Ford and Mercury versions are essentially identical. Export Cougars also have clear marker light lenses (in place of amber) and amber rear turn signals. In the United States, the Ford Cougar was built in both left and right-hand drive, with the latter allowing for its sale in the UK and Australia'''. --This is misleading as the Europe/Australia models have many features not available on the US cars such as automatic climate control. Different suspension packages were available, many vacuum based systems were replaced with electronic ones, lock systems use completely different types of keys and there are several different headlights depending on what year and where the car was sold including self leveling ones. It is more than just a logo swap... — Preceding unsigned comment added by <IP_ADDRESS> (talk) 06:05, 6 December 2020 (UTC) Revival They need to revive the Cougar. They have the new Mustang bodystyle to work with, they could just give it the "prowling cougar" logo from the original. We need the Cougar. —The preceding unsigned comment was added by <IP_ADDRESS> (talk) 16:36, 5 October 2006 A sentence I can't make heads or tails of this sentence: Aside from the base model and the luxurious XR-7, only one trim package was available for either model: the sporty GT. - super βεε cat 00:47, 22 July 2007 (UTC) what the crap? This has overlapping year sections and duplicated content. This neads a cleanup badly - super βεε cat 00:50, 22 July 2007 (UTC) * No it doesn't - there are larger headings for the major body years, then subheadings within the years. I don't see any overlap at all. Look in the "Contents" box, for example. Rmarquet 12:16, 30 July 2007 (UTC) Fair use rationale for Image:CougarHoodOrnament.png Image:CougarHoodOrnament.png is being used on this article. I notice the image page specifies that the image is being used under fair use but there is no explanation or rationale as to why its use in this Wikipedia article constitutes fair use. In addition to the boilerplate fair use template, you must also write out on the image description page a specific explanation or rationale for why using this image in each article is consistent with fair use. BetacommandBot (talk) 21:41, 13 February 2008 (UTC) Mercury Cougar This sentence needs to be removed "according to their official website they will be continuing the 'Cougar' name with the 'Ford Kuga' in 2008" from the ford cougar section. This is incorrect, Yes the named a crossover SUV Kuga but its not related in any way to the Mercury/Ford Cougar and in fact the work Kuga means "plaque" in Slavic. The link makes no mention that they are conitnuing the name as they are unrelated. —Preceding unsigned comment added by <IP_ADDRESS> (talk) 21:52, 7 March 2008 (UTC) Point of View "Some consider these to be the last true American muscle cars, but they're not." <IP_ADDRESS> (talk) 06:28, 1 April 2008 (UTC) No Cougar S ever made? In Canada, I remember going to a Ford dealer and getting a Cougar brouchure in around 2001 (by which time the Cougar was sold under the Ford brand name) and it listed the Cougar S as one of the available models. I also recall the Cougar S being listed in the Motor Trend and Carguide buyer's guides. Are we absolutely sure it was never made? Ensign Q (talk) 15:27, 19 January 2009 (UTC) External links modified (January 2018) Hello fellow Wikipedians, I have just modified one external link on Mercury Cougar. Please take a moment to review my edit. If you have any questions, or need the bot to ignore the links, or the page altogether, please visit this simple FaQ for additional information. I made the following changes: * Added archive https://web.archive.org/web/20150402090154/http://oldcarbrochures.org/NA/Mercury/1981_Mercury/1981_Mercury_Cougar_Brochure to http://oldcarbrochures.org/NA/Mercury/1981_Mercury/1981_Mercury_Cougar_Brochure Cheers.— InternetArchiveBot (Report bug) 02:40, 26 January 2018 (UTC)	WIKI
Talk:Steam rocket Poor article quality This article is poorly written and needs to be revised and possibly intergrated into the Water rocket article. —Preceding unsigned comment added by <IP_ADDRESS> (talk • contribs) * I have made substantial changes to it, and added two references/citations. If you believe it should be incorporated into Water rocket, add a Merge tag. --Jatkins (talk - contribs) 17:12, 6 October 2007 (UTC) * I agree here. This article is in desperate need of...Wikification, I think they call it. Indeed; I found this article by an internal link through Water rocket; and I also voice the opinion of merging the two articles. Danny Sepley 17:34, 4 November 2007 (UTC) —Preceding unsigned comment added by Danny sepley (talk • contribs) * It's not a water rocket though. Water rockets emit... water. Hot water rockets emit steam.WolfKeeper 18:30, 4 November 2007 (UTC) * I agree. The term "hot water rocket" makes them sound amateur; whilst very uncommon, they are entirely different rockets - indeed, as you noted, they emit water vapor, not liquid water. --Jatkins (talk - contribs) 18:33, 5 November 2007 (UTC) Where the article says mass fraction, perhaps it should say mass ratio instead? A high propellant mass fraction is a bad thing; a high mass ratio a good thing. -- <IP_ADDRESS> (talk) 13:52, 18 June 2009 (UTC) * Careful here, it depends what you're optimising for. If you're optimising for absolute performance, everything else being equal, a high mass fraction is highly desirable; you want to stuff as much propellant in as possible.- (User) Wolfkeeper (Talk) 14:01, 18 June 2009 (UTC) The article suggests that 'a modern hydrogen engines' (sic) can produce an Isp of 465 seconds. I assume the author is referring to liquid hydrogen/ liquid oxygen engines so 465s is too high. In reality it's more like 405s in vacuum, and slightly less than 400s in atmosphere. 465s Isp is reserved for engines using rather more exotic (and toxic) propellants. — Preceding unsigned comment added by <IP_ADDRESS> (talk) 15:27, 17 December 2013 (UTC)	WIKI
W3cubDocs /SVG <feConvolveMatrix> The <feConvolveMatrix> SVG filter primitive applies a matrix convolution filter effect. A convolution combines pixels in the input image with neighboring pixels to produce a resulting image. A wide variety of imaging operations can be achieved through convolutions, including blurring, edge detection, sharpening, embossing and beveling. A matrix convolution is based on an n-by-m matrix (the convolution kernel) which describes how a given pixel value in the input image is combined with its neighboring pixel values to produce a resulting pixel value. Each result pixel is determined by applying the kernel matrix to the corresponding source pixel and its neighboring pixels. The basic convolution formula which is applied to each color value for a given pixel is: COLORX,Y = ( SUM I=0 to [orderY-1] { SUM J=0 to [orderX-1] { SOURCE X-targetX+J, Y-targetY+I * kernelMatrixorderX-J-1, orderY-I-1 } } ) / divisor + bias * ALPHAX,Y where "orderX" and "orderY" represent the X and Y values for the ‘order’ attribute, "targetX" represents the value of the ‘targetX’ attribute, "targetY" represents the value of the ‘targetY’ attribute, "kernelMatrix" represents the value of the ‘kernelMatrix’ attribute, "divisor" represents the value of the ‘divisor’ attribute, and "bias" represents the value of the ‘bias’ attribute. Note in the above formulas that the values in the kernel matrix are applied such that the kernel matrix is rotated 180 degrees relative to the source and destination images in order to match convolution theory as described in many computer graphics textbooks. To illustrate, suppose you have a input image which is 5 pixels by 5 pixels, whose color values for one of the color channels are as follows: 0 20 40 235 235 100 120 140 235 235 200 220 240 235 235 225 225 255 255 255 225 225 255 255 255 and you define a 3-by-3 convolution kernel as follows: 1 2 3 4 5 6 7 8 9 Let's focus on the color value at the second row and second column of the image (source pixel value is 120). Assuming the simplest case (where the input image's pixel grid aligns perfectly with the kernel's pixel grid) and assuming default values for attributes ‘divisor’, ‘targetX’ and ‘targetY’, then resulting color value will be: (9* 0 + 8* 20 + 7* 40 + 6100 + 5120 + 4140 + 3200 + 2220 + 1240) / (9+8+7+6+5+4+3+2+1) Usage context Categories Filter primitive element Permitted content Any number of the following elements, in any order: <animate>, <set> Attributes Global attributes Specific attributes DOM Interface This element implements the SVGFEConvolveMatrixElement interface. Example SVG <svg viewBox="0 0 200 200" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink"> <defs> <filter id="emboss"> <feConvolveMatrix kernelMatrix="3 0 0 0 0 0 0 0 -3"/> </filter> </defs> <image xlink:href="/files/12668/MDN.svg" x="0" y="0" height="200" width="200" style="filter:url(#emboss);" /> </svg> Result Specifications Browser compatibilityUpdate compatibility data on GitHub Desktop Chrome Edge Firefox Internet Explorer Opera Safari Basic support Yes Yes Yes Yes Yes ? bias ? ? ? ? ? ? divisor ? ? ? ? ? ? edgeMode ? ? ? ? ? ? in Yes Yes Yes Yes Yes ? kernelMatrix Yes Yes Yes Yes Yes ? kernelUnitLength ? ? ? ? ? ? order ? ? ? ? ? ? preserveAlpha ? ? ? ? ? ? targetX ? ? ? ? ? ? targetY ? ? ? ? ? ? Mobile Android webview Chrome for Android Edge Mobile Firefox for Android Opera for Android iOS Safari Samsung Internet Basic support ? Yes Yes Yes ? ? ? bias ? ? ? ? ? ? ? divisor ? ? ? ? ? ? ? edgeMode ? ? ? ? ? ? ? in ? Yes Yes Yes ? ? ? kernelMatrix ? Yes Yes Yes ? ? ? kernelUnitLength ? ? ? ? ? ? ? order ? ? ? ? ? ? ? preserveAlpha ? ? ? ? ? ? ? targetX ? ? ? ? ? ? ? targetY ? ? ? ? ? ? ? See also © 2005–2018 Mozilla Developer Network and individual contributors. Licensed under the Creative Commons Attribution-ShareAlike License v2.5 or later. https://developer.mozilla.org/en-US/docs/Web/SVG/Element/feConvolveMatrix	ESSENTIALAI-STEM
Lady Haeryangwon Lady Haeryangwon (lit. 'Lady of the Haeryang Courtyard') was the daughter of Seon-Pil who became the 30th wife of Taejo of Goryeo. Her father, Seon-Pil, helped Wang Geon in established the Goryeo dynasty while he served as a Silla's general. Then, he returned to Goryeo in 930 and Wang (a.k.a. Taejo) gave Seon-Pil special treatment. After that, Taejo then took his daughter as his consort.	WIKI
NORTHERN INDIANA COMMUTER TRANSPORTATION DISTRICT, Appellant (Plaintiff below), v. CHICAGO SOUTHSHORE AND SOUTH BEND RAILROAD, Appellee (Defendant below). No. 46S03-9703-CV-191. Supreme Court of Indiana. Sept. 8, 1997. Michael C. Harris, Chesterton, for Appellant. Stanley C. Fickle, Peter J. Rusthoven, Anne N. DePrez, Indianapolis, Michael J. Daley, Gregory C. Ward, Chicago, for Appel-lee. ON PETITION TO TRANSFER BOEHM, Justice. Arbitration presumably intended to resolve this dispute without resort to the courts has now produced lawsuits and appeals in two different states. As their contract provided, the parties submitted a dispute over its interpretation to arbitration. After an arbitration panel issued an award, both parties sued, one in Indiana to overturn the award and the other in Illinois to enforce it. We hold that because the Illinois court was the first to enter a judgment on the validity of the award, the Full Faith and Credit Clause of the United States Constitution requires Indiana courts to accord that judgment the same effect it would receive in an Illinois state court. Under Illinois law, a stay for a reasonable time pending appeal of the Illinois judgment is at least one appropriate action for a trial court to take before determining the res judicata effect of that judgment. Although under the peculiar facts of this case the Indiana court had jurisdiction over the claims presented to it, we reverse the trial court’s dismissal and direct that the Indiana proceedings be stayed for a reasonable time pending the outcome of the Illinois litigation. Factual and Procedural Background The parties to this lawsuit are Northern Indiana Commuter Transportation District (“NICTD”), an Indiana municipal corporation, and Chicago SouthShore and South Bend Railroad (“SouthShore”), an Indiana partnership engaged in the railway freight business. NICTD and SouthShore had an agreement whereby SouthShore operated its freight business over NICTD’s rails and agreed to pay a fee for the privilege. In 1992 a dispute arose between NICTD and SouthShore over the amount of the annual fee. It is undisputed that the Agreement initially set the fee for each year after 1990 at twelve per cent of SouthShore’s gross revenues for the prior year. However, the parties differed over whether a clause providing for mandatory renegotiation of the fee every third year to account for inflation applied to SouthShore itself, or only to a subsequent purchaser of SouthShore’s rights. The parties were unable to resolve their differences through mediation and in 1993 NICTD initiated a demand for arbitration. The Agreement stipulated that Indiana law governed and provided that (1) “all arbitration proceedings shall take place within the State of Indiana”; and (2) if either party believed an arbitration decision was based on an “error of law,” the aggrieved party could “institute an action at law within the State of Indiana to determine such legal issue.” These provisions notwithstanding, the parties agreed to hold the arbitration proceedings in Chicago for the convenience of the three Chicago-based attorneys who served as arbitrators. In the summer of 1994 an evi-dentiary hearing was held in the offices of a law firm in Chicago. On August 11, 1994, the arbitration panel ruled in a split decision that the inflation adjustment clause applied only to a subsequent purchaser of South-Shore, and not to SouthShore itself. Accordingly, the award set the annual fee at twelve per cent of SouthShore’s annual gross revenues for the prior year. On September 9, 1994, NICTD filed a declaratory judgment action in the Superior Court of LaPorte County, Indiana. Although not styled as a motion to vacate or modify the award, NICTD’s complaint essentially asked for a declaration that its interpretation of the Agreement was correct and in substance challenged the arbitration decision. On October 26, 1994, SouthShore moved to dismiss the complaint for lack of subject-matter jurisdiction, citing the Uniform Arbitration Act’s provision conferring jurisdiction to confirm the award on the courts of the State where the parties agreed to arbitrate. On October 28, 1994, South-Shore filed an application to confirm the arbitration award in the Circuit Court of Cook County, Illinois. On December 16, 1994, NICTD filed a “motion in lieu of answer” in Illinois contesting the jurisdiction of the Illinois court over the arbitration. On February 22, 1995, the Indiana trial court granted SouthShore’s motion to dismiss, agreeing with SouthShore that NICTD was attempting in effect to overturn the award and that only Illinois had jurisdiction because the arbitration took place there. On March 14, 1995, the Illinois trial court ruled that it had jurisdiction over SouthShore’s application to confirm the award and denied NICTD’s motion. On April 12,1995, NICTD moved in the Illinois case to vacate or modify the award. SouthShore responded with a motion to strike NICTD’s motion on the ground that NICTD had not filed within ninety days of the August 11, 1994 arbitration award, as required by the Illinois Uniform Arbitration Act. On September 6, 1995, the Illinois trial court granted South-Shore’s motion to strike, finding that the Act did not permit extension of the ninety day deadline. Finally, on December 20,1995, the Illinois court entered its judgment confirming the award. NICTD appealed that ruling in Illinois, as well as the earlier Illinois ruling holding that Illinois had subject-matter jurisdiction over the arbitration. Meanwhile, NICTD had initiated a timely appeal of the Indiana trial court’s dismissal of its suit in LaPorte County. On February 20, 1996, the Indiana Court of Appeals reversed the trial court’s dismissal. The court held that (1) Indiana had subject-matter jurisdiction because the Agreement, and not the place of arbitration, controlled the location of judicial review; and (2) the arbitrators’ interpretation of the contract was contrary to law. Northern Indiana Commuter Transp. Dist v. Chicago SouthShore and South Bend R.R., 661 N.E.2d 842 (Ind.Ct.App.1996). Even though the Indiana trial court’s ruling dealt only with SouthShore’s motion to dismiss on jurisdictional grounds, the Court of Appeals also ruled on the merits of NICTD’s complaint. The court held that the inflation adjustment clause applied to SouthShore as well as any successor and remanded the case to arbitration for purposes of determining the amount of the fee. The earlier ruling of the Illinois trial court, which postdated the Indiana trial court’s dismissal, had not been presented to the Indiana Court of Appeals at that point. SouthShore moved for rehearing in the Indiana Court of Appeals on March 21,1996. In the motion, SouthShore raised for the first time the December 20, 1995 Illinois trial court decision confirming the award. South-Shore contended that (1) the Full Faith and Credit Clause required Indiana courts to give that decision preclusive effect; and (2) the sua sponte ruling by the Court of Appeals on the merits of NICTD’s complaint had denied SouthShore due process of law because SouthShore had never been given the opportunity to answer the complaint on the merits. In denying rehearing, the Court of Appeals first observed that full faith and credit generally requires a state “to give to a judgment at least the res judicata effect which the judgment would be accorded in the State which rendered it.” Northern Indiana Commuter Transp. Dist. v. Chicago Southshore and South Bend R.R., 666 N.E.2d 447, 448 (Ind. Ct.App.1996) (citation omitted). However, noting that NICTD had appealed the Indiana dismissal before the Illinois court ruled that it had jurisdiction, the court held that Indiana was not required to give the Illinois judgment full faith and credit: “[Bjecause the Illinois court, as the second court, accepted jurisdiction before the issue regarding jurisdiction had been fully and fairly litigated and finally decided in the Indiana courts, we are not required to give full faith and credit to the Illinois decision to confirm the arbitration award.” Id. at 449 (footnote omitted). The court also rejected the claim that South-Shore had been denied due process because the court viewed the arguments SouthShore would have made on the merits — had it been allowed to answer NICTD’s complaint — as efforts to relitigate factual questions that were barred by the Agreement. Id. at 449-50. Armed with the opinion of the Indiana Court of Appeals, NICTD moved in the Illinois trial court to vacate the Illinois judgment and argued that the Full Faith and Credit Clause required Illinois to give preclu-sive effect to the Indiana appellate decision. On July 24, 1996, the Illinois court denied NICTD’s motion, observing that the Indiana Court of Appeals “certainly didn’t give full faith and credit to the courts of the state of Illinois.” SouthShore sought transfer from the Court of Appeals to this Court. We heard oral argument in this case on March 4, 1997, and granted transfer on March 11, 1997. Next, on June 18, 1997, the Appellate Court of Illinois affirmed the trial court’s decision exercising jurisdiction and confirming the award. Chicago SouthShore and South Bend R.R. v. Northern Indiana Commuter Transp. Dist., 289 Ill.App.3d 533, 224 Ill.Dec. 595, 682 N.E.2d 156 (1997), reh’g denied. Most recently, a “certificate of importance” was issued by the Appellate Court, which had the effect of requiring review by the Illinois Supreme Court. See Ill.S.Ct. Rule 316 and discussion infra note 10. For the reasons explained below, we order that the Indiana proceedings be stayed for a reasonable time pending the outcome of the appellate proceedings in Illinois. In broad brush, the parties’ contentions in this Court are as follows. SouthShore argues that (1) Indiana courts must give full faith and credit to the Illinois judgment confirming the arbitration award; and (2) the Illinois judgment is accorded res judicata effect in Illinois and therefore must be given the same effect here. NICTD responds that the Illinois judgment was rendered in violation of NICTD’s federal constitutional right to procedural due process. Specifically, NICTD contends that the Illinois court erred by not allowing NICTD to respond to the merits of SouthShore’s petition to confirm. According to NICTD, a judgment rendered in violation of due process need not be recognized in Indiana. NICTD also argues that exclusive jurisdiction has always existed in Indiana and that no deference is required to an Illinois judgment rendered by a court without jurisdiction over the matter. South-Shore replies that the jurisdictional issue was finally determined by the Illinois trial court and thus cannot be relitigated in Indiana. I. Full Faith and Credit This case largely turns on settled constitutional principles governing the preclusive effect to be accorded a judgment rendered by the courts of another state. The Full Faith and Credit Clause of the United States Constitution mandates that “[f]ull faith and credit shall be given in each state to the public acts, records, and judicial proceedings of every other state.” U.S. CONST, art. IV, § 1. The constitutional provision is implemented by an Indiana statute making explicit that “records and judicial proceedings” from courts in other states “shall have full faith and credit given to them in any court within this state, as by law or usage they have in the courts whence taken.” Ind.Code § 34-1-18-7 (1993). Full faith and credit has long meant that “the judgment of a state court should have the same credit, validity, and effect, in every other court of the United States, which it had in the state where it was pronounced.” Underwriters Nat’l Assurance Co. v. North Carolina Life and Accident and Health Ins. Guar. Ass’n, 455 U.S. 691, 704, 102 S.Ct. 1357, 1365, 71 L.Ed.2d 558 (1982) (internal quotation marks omitted) (citing Hampton v. McConnel, 16 U.S. (3 Wheat.) 234, 235, 4 L.Ed. 378, 379 (1818) (Marshall, C.J.)); accord Durfee v. Duke, 375 U.S. 106, 109, 84 S.Ct. 242, 244,11 L.Ed.2d 186 (1963). Nonetheless, “before a court is bound by the judgment rendered in another State, it may inquire into the jurisdictional basis of the foreign court’s decree. If that court did not have jurisdiction over the subject matter or the relevant parties, full faith and credit need not be given.” Underwriters Nat’l Assurance Co., 455 U.S. at 705, 102 S.Ct. at 1366 (citation omitted). This scope of review is a “limited” one, id. at 706, 102 S.Ct. at 1366-67, that does not entail de novo review of the jurisdictional issue by the second court. Rather, “the general rule [is] that a judgment is entitled to full faith and credit — even as to questions of jurisdiction— when the second court’s inquiry discloses that those questions have been fully and fairly litigated and finally decided in the court which rendered the original judgment.” Durfee, 375 U.S. at 111, 84 S.Ct. at 245. Preclusive effect must be given even where the first court’s conclusion as to jurisdiction was erroneous as a matter of law. Underwriters Nat’l Assurance Co., 455 U.S. at 714, 102 S.Ct. at 1370-71. In other words, if jurisdiction was “fully considered” and “finally determined” in the first state, that generally is the end of the matter. Id. at 707,102 5.Ct. at 1367. A ruling is entitled to full faith and credit — i.e., the same effect it is given in the state of issuance — even if it is not final under the law of that state. See Barber v. Barber, 323 U.S. 77, 86-88, 65 S.Ct. 137, 141-42, 89 L.Ed. 82 (1944) (Jackson, J„ concurring). Finally, certain dispute resolution mechanisms unquestionably do not constitute “judicial proceedings” for purposes of fidl faith and credit. See, e.g., McDonald v. City of West Branch, 466 U.S. 284, 104 S.Ct. 1799, 80 L.Ed.2d 302 (1984) (holding that unappealed arbitration award was not a “judicial proceeding” entitled to full faith and credit under 28 U.S.C. § 1738). However, the Illinois trial court judgment confirming the award and the intermediate appellate decision affirming that judgment are “judicial proceedings” within the meaning of the Full Faith and Credit Clause. Cf. Matsushita Elec. Indus. Co., Ltd. v. Epstein, 516 U.S. 367,-, 116 S.Ct. 873, 878, 134 L.Ed.2d 6, 17 (1996) (judgment of Delaware trial court affirmed by Delaware Supreme Court was a “judicial proceeding” within the meaning of 28 U.S.C. § 1738). II. Full Faith and Credit is Properly Preserved As a preliminary matter, NICTD contends that SouthShore waived its right to rely on the Full Faith and Credit Clause by not presenting the Illinois judgment in the Indiana Court of Appeals at the earliest opportunity. For this proposition, NICTD cites several Indiana appellate procedural cases holding that new claims or issues, including constitutional arguments and the defense of res judicata, cannot be presented for the first time in a petition for rehearing. See, e.g., City of Indianapolis v. Wynn, 239 Ind. 567, 159 N.E.2d 572 (1959). SouthShore responds that it did not raise the issue until rehearing because under the procedural posture of this appeal it would have been premature to do so earlier. This case was in the Indiana Court of Appeals on the trial court’s grant of SouthShore’s motion under Trial Rule 12 to dismiss for lack of subject-matter jurisdiction. The only issue before the Court of Appeals was the validity of that ruling. SouthShore argues that full faith and credit in essence raises the affirmative defense of res judicata, which must be pleaded in the defendant’s answer. Ind. Trial Rule 8(C). At the time the Court of Appeals issued its decision, no answer had been filed in the case. Accordingly, SouthShore contends it was not required to present the Illinois trial court ruling to the Indiana Court of Appeals. There are sound reasons for requiring a party to present all known arguments or claims to an appellate court before its decision is rendered. Rehearing opinions exhaust precious judicial resources that could be expended elsewhere. Decisions such as Wynn reflect the emphasis placed on judicial economy in deciding whether to consider an issue for the first time on rehearing. However, none of NICTD’s cited cases involved a litigant claiming deprivation of a federal constitutional right due to a surprising and unforeseeable result on appeal. The effect of the Court of Appeals’ ruling was to preclude SouthShore from making its arguments on the merits as to the construction of the Agreement, one of which is presumably based on full faith and credit. To be sure, SouthShore could have urged the Illinois judgment as an alternative ground for affirming the Indiana judgment of dismissal. However, we agree with SouthShore that the Court of Appeals’ disposing of the appeal on the merits could not have been anticipated and prevented SouthShore from feeling the need to raise its federal constitutional issue at an earlier time. Where a state court acts in an unanticipated way to deprive a party of the opportunity to make an argument or present a valid defense based on the Federal Constitution, the issue is not waived for purposes of review by the Supreme Court of the United States. Herndon v. Georgia, 295 U.S. 441, 443-44, 55 S.Ct. 794, 794-95, 79 L.Ed. 1530 (1935); Brinkerhoff-Faris Trust & Sav. Co. v. Hill, 281 U.S. 673, 677-78, 50 S.Ct. 451, 453, 74 L.Ed. 1107 (1930); Saunders v. Shaw, 244 U.S. 317, 320, 37 S.Ct. 638, 640, 61 L.Ed. 1163 (1917). As Justice Cardozo succinctly summarized in Herndon: “The settled doctrine is that when a constitutional privilege or immunity has been denied for the first time by a ruling made upon appeal, a litigant thus surprised may challenge the unexpected ruling by a motion for rehearing, and the challenge will be timely.” Herndon, 295 U.S. at 447, 55 S.Ct. at 796 (Cardozo, J., dissenting). This standard is met where the trial court disposed of the case on the basis of subject-matter jurisdiction and the appellate court not only reverses on that issue, but resolves the merits of the dispute without briefing or argument by the parties. Accordingly, this Court should entertain the issue as a matter of Indiana appellate procedure. Finding waiver here could needlessly present an incorrect decision on a matter of federal constitutional law to the Supreme Court of the United States. We are also mindful of the deference to the courts of a sister state that comity suggests even if the Full Faith and Credit Clause does not require it. To the extent SouthShore is responsible for not raising the issue sooner, the Illinois courts are not at fault. The Illinois trial court was the first to enter a judgment enforcing the arbitration award. If we held that SouthShore’s full faith and credit argument was waived and ruled in NICTD’s favor on the merits, the possibility of inconsistent judgments would arise. Under these circumstances, we decline to find waiver here. III. Litigation of the Jurisdictional Issue in Illinois Our first line of inquiry in assessing what credit, if any, to give the Illinois judgment is whether the Illinois court “fully considered” and “finally determined” the issue of its own jurisdiction over the subject matter and the person of the parties. Underwriters Nat’l Assurance Co., 455 U.S. at 707, 102 S.Ct. at 1367. The record reveals that these issues were fully briefed and argued and conclusively decided. In response to South-Shore’s application to confirm the award, on December 15,1994 NICTD filed a “motion in lieu of answer” vigorously contesting the jurisdiction of the Illinois trial court over the arbitration. NICTD also contended that it was an Indiana state agency not subject to personal jurisdiction in Illinois. On March 14,1995, that court ruled that NICTD’s parol agreement to arbitrate in Chicago — notwithstanding the Agreement’s written provisions to the contrary — had conferred personal and subject-matter jurisdiction on Illinois courts under Illinois common law. Under the relevant provisions of the Illinois Uniform Arbitration Act, which are substantively the same in this respect as Indiana’s, jurisdiction to enforce the award is conferred on the courts of the state specified in a written arbitration agreement between the parties. Compare 710 Ill.Comp.Stat. ANN. 5/1 & 5/16 (West 1992) with Ind.Code §§ 34-4r-2-l & 34-4-2-17 (1993). Although the Illinois trial court acknowledged that the Illinois Uniform Arbitration Act generally required a written agreement to confer jurisdiction on Illinois courts, the court concluded that in Illinois “the legal effect of a parol submission and award is the same as those in writing.” The court therefore squarely addressed one of NICTD’s principal arguments against subject-matter jurisdiction in Illinois — the lack of a written agreement so providing. According to the court, “NICTD clearly submitted to arbitration in Illinois” and, because of the explicit waiver, “the provision that arbitration proceedings shall occur in Indiana no longer exists.” We might agree with NICTD that the Illinois court’s construction places excessive weight on the physical presence of the arbitrators and ignores the apparent intent of the parties as expressed in the Agreement. We might also agree that the statutes of both states seem to emphasize a written agreement to confer jurisdiction and that none appears to be present in this record conferring jurisdiction on Illinois courts. However, the question of jurisdiction in Illinois was fully litigated and, as explained below, we are not free to second-guess an Illinois trial court as we may those of Indiana. Moreover, the subject-matter jurisdiction of the Illinois courts is a matter of Illinois law. The December 20, 1995 judgment confirming the award eliminates any doubt as to the decision of the Illinois trial court to exercise jurisdiction. Stoll v. Gottlieb, 305 U.S. 165, 171-72, 59 S.Ct. 134, 137, 83 L.Ed. 104 (1938) (“Every court in rendering a judgment tacitly, if not expressly, determines its jurisdiction over the parties and the subject matter.”) (footnote omitted). Both rulings — on jurisdiction and on the merits of SouthShore’s application — were issued before the Indiana Court of Appeals held in 1996 that Indiana courts had jurisdiction over the arbitration. In sum, the Illinois court was the first to render a judgment on the ultimate issue of the validity of the award. IY. Illinois Law of Res Judicata The effect Indiana must accord the Illinois judgment turns on the effect that judgment would be given in Illinois. Underwriters Nat’l Assurance Co., 455 U.S. at 704, 102 S.Ct. at 1365-66. The Illinois Supreme Court recently explained that “[f]or the doctrine of res judicata to apply, three requirements must be met: (1) there was a final judgment on the merits rendered by a court of competent jurisdiction; (2) there was an identity of cause of action; and (3) there was an identity of parties or their privies.” Rein v. David A. Noyes & Co., 172 Ill.2d 325, 216 Ill.Dec. 642, 647, 665 N.E.2d 1199, 1204 (1996) (citation omitted and italics deleted), reh’g denied; accord Leow v. A & B Freight Line, Inc., 175 Ill.2d 176, 222 Ill.Dec. 80, 81-82, 676 N.E.2d 1284, 1285-86 (1997). The December 20, 1995 order confirming the award was a judgment on the merits: “Upon the granting of an order confirming, modifying or correcting an [arbitration] award, judgment shall be entered in conformity therewith and be enforced as any other judgment.” 710 Ill.Comp.StatAnn. 5/14 (West 1992); Monmouth Public Schools v. Pullen, 141 Ill.App.3d 60, 95 Ill.Dec. 372, 378, 489 N.E.2d 1100, 1106 (1985) (“If the arbitration award is binding on the parties, any inquiry into the matters originally controverted is forever closed.”) (citation omitted); In re McNabola, 43 B.R. 362 (Bankr.N.D.Ill.1984) (giving preclusive effect to order confirming an arbitration award under the Act). The parties and cause of action are the same in this case as in the Illinois action. And, as noted, the jurisdiction of the Illinois court was also adjudicated in Illinois. The only troublesome question is whether Illinois regards the judgment as “final” and binding. There are no Illinois decisions elaborating the res judicata effect to be given a judgment confirming an arbitration award that is on appeal. However, the preclusive effect of such a ruling appears to be the same as any other judgment. The Illinois Uniform Arbitration Act provides that “[ajppeals may be taken in the same manner, upon the same terms, and with like effect as in civil cases.” 710 Ill.Comp.Stat. Ann. 5/18 (West 1992). A judgment that is not appealed is clearly final and binding on the parties for res judicata purposes. Debowski v. Shred Pax Corp., 45 Ill.App.3d 891, 3 Ill.Dec. 794, 799, 359 N.E.2d 204, 209 (1977). An appellate court judgment is also entitled to preclusive effect. People v. Mitchell, 95 Ill.App.3d 779, 51 Ill.Dec. 1, 10, 420 N.E.2d 415, 424 (1981). However, NICTD’s appeal is still pending in the Illinois courts. A judgment in a civil case that is reversed on appeal is not entitled to preclusive effect. Meeker v. Payne, 101 Ill.App.3d 723, 57 Ill.Dec. 64, 65-66, 428 N.E.2d 614, 615-16 (1981). Illinois law appears unsettled (or at least unclear) on the effect of a pending appeal on the finality of a judgment for purposes of res judicata. SouthShore relies on authority suggesting that a judgment is given res judicata effect even while it is being appealed. State Life Ins. Co. v. Board of Educ., 401 in. 252, 81 N.E.2d 877, 880 (1948); Village of Rosemont v. Lentin Lumber Co., 144 Ill.App.3d 651, 98 Ill.Dec. 470, 480, 494 N.E.2d 592, 602 (1986); Sixty-Third & Halsted Realty Co. v. Goldblatt Bros., 342 IlLApp. 389, 96 N.E.2d 838, 843 (1951), aff'd, 410 Ill. 468, 102 N.E.2d 749 (1951). NICTD offers no precedent to the contrary, but we have identified at least three intermediate appellate decisions holding that a trial court must upon request stay the second trial for a reasonable time pending the outcome of the appeal in the first case. Illinois Founders Ins. Co. v. Guidish, 248 Ill.App.3d 116, 187 Ill.Dec. 845, 848-49, 618 N.E.2d 436, 439-40 (1993); Shaw v. Citizens State Bank, 185 Ill.App.3d 79, 133 Ill.Dec. 266, 540 N.E.2d 1132 (1989); Wiseman v. Law Research Sen., Inc., 133 Ill.App.2d 790, 270 N.E.2d 77 (1971). At least one other case has held that a stay was within the trial court’s discretion due to “the potential for inconsistent judgments once the appeal [in the first ease] was final_” Golden Rule Ins. Co. v. Robezo, 194 Ill.App.3d 468, 141 Ill.Dec. 506, 509, 551 N.E.2d 693, 696 (1990). At one time the Iffinois Supreme Court painted with a broad brush in emphasizing the importance of finaUty: “The rule has been settled that where a judgment in one case has successfully been made the basis for the judgment in a second case, the second judgment will stand as res judicata, although the first judgment, be subsequently reversed.” State Life Ins. Co., 81 N.E.2d at 880 (citations omitted). Illinois Supreme Court eases of even older vintage appear to be in accord. See, e.g., People ex rel. Ams v. Rickert, 159 Ill. 496, 42 N.E. 884, 886 (1896) (“The appeal merely suspends the execution of the judgment or decree, and leaves it in full force as a bar to further prosecution for the same matters determined by it.”) (citation omitted). However, the Illinois Supreme Court has not made a definitive statement on the point since State Life. The more recent intermediate appellate decisions holding that a stay should issue pending the outcome of the appeal in the first case were decided several decades after the State Life litigation. Illinois Founders (1993), Shaw (1989), and Wiseman (1971) all reasoned that a stay was required because the second judgment, once rendered, would be final even if the first judgment upon which it was based was subsequently reversed. In that situation, the aggrieved party in the second case would be without a remedy even if it obtained appellate relief in the first case — the State Life scenario. Wiseman quoted the above language from State Life and purported to acknowledge the validity of its general rule, but held that a stay was required pending the outcome of the appeal in the first case. Wiseman, 270 N.E.2d at 79-80. Village of Rosemont attempted to narrow Wiseman’s scope, concluding that Wiseman “actually held that one should not be able to avoid the use of a judgment merely by taking an appeal.” Village of Rosemont, 98 Ill.Dec. at 480, 494 N.E.2d at 602. This effort to confine Wiseman (if it was that) was short lived. The more recent eases of Illinois Founders and Shaw relied explicitly on Wiseman and appear to have revived the requirement of a stay. Without citing Village of Rosemont, the more recent cases also acknowledged the Illinois Supreme Court’s directive in State Life, but held that a stay should be granted for a reasonable time pending the outcome of the appeal in the first case. Illinois Founders, 187 Ill. Dec. at 849, 618 N.E.2d at 440; Shaw, 133 Ill.Dec. at 269, 540 N.E.2d at 1135. We have used the term “res judicata” in this opinion to refer to “claim preclusion” and not in a generic sense. A further complication is introduced because Illinois appears to distinguish claim preclusion fi’om issue preclusion, or “collateral estoppel,” in determining the effect of a pending appeal. For collateral estoppel purposes a judgment is not final in Illinois until “the potential for appellate review [has] been exhausted.” Ballweg v. City of Springfield, 114 Ill.2d 107, 102 Ill.Dec. 360, 362, 499 N.E.2d 1373, 1375 (1986) (citation omitted). Despite laying down a clear rule, Ballweg has been met with some criticism; See Rogers v. In the decade following Ballweg, at least three decisions involving claim preclusion, some citing Ballweg and some not, have aUowed a second suit to proceed on the merits despite a prior judgment under pending appeal. West Suburban Bank v. Lattemann, 285 Ill.App.3d 313, 220 Ill.Dec. 878, 879, 674 N.E.2d 149, 150 (1996) (noting that complaint in second action had been reinstated and allowed to proceed in Illinois trial court where appeal from Illinois trial court decision in first action was still pending); Pelon v. Wall, 262 Ill.App.3d 131, 199 Ill.Dec. 546, 549, 634 N.E.2d 385, 388 (1994) (complaint in second action reinstated and case remanded for further proceedings consistent with the opinion); Luckett v. Human Rights Com’n, 210 Ill.App.3d 169,155 Ill.Dec. 6, 10, 569 N.E.2d 6, 10 (1989) (offering as an alternative holding that because decision of federal district court involving same issues and parties was on appeal, Illinois Appellate Court was free to reach own result on merits of same issues), appeal denied, 141 Ill.2d 543, 162 Ill.Dec. 491, 580 N.E.2d 117 (1991), cert. denied, 502 U.S. 1113, 112 S.Ct. 1220, 117 L.Ed.2d 4.56 (1992). Pelón and Luckett relied on Ballweg without discussing the potential distinction between issue and claim preclusion. Thus, some Illinois authority would arguably support allowing NICTD’s Indiana suit to go forward despite NICTD’s appeal in Illinois. In the face of all of this, the U.S. Court of Appeals for the Seventh Circuit recently observed: “To be blunt, we have no idea what the law of Illinois is on the question whether a pending appeal destroys the claim preclusive effect of a judgment.” Rogers, 58 F.3d at 302. In holding that a stay was the most “prudent course” for a federal court faced with a parallel state case, Rogers concluded that a federal judge confronted with duplicative litigation need not barge ahead on the off-chance of beating the state court to a conclusion. It is sensible to stay proceedings until an earlier-filed state ease has reached a conclusion, and then (but only then) to dismiss the suit outright on grounds of claim preclusion. Id. (citing Colorado River Water Conservar tion Dist. v. United States, 424 U.S. 800, 817-21, 96 S.Ct. 1236, 1246-48, 47 L.Ed.2d 483 (1976) and other cases). We reach a similar result here and conclude that full faith and credit under these circumstances requires a stay of the Indiana proceedings for a reasonable time to permit resolution of appellate proceedings in Illinois. To the extent current Illinois law of res judicata, which we are bound to follow under the Full Faith and Credit Clause, Underwriters Nat’l Assurance Co., 455 U.S. at 704, 102 S.Ct. at 1365-66, does not require this result, we reach the same conclusion on grounds of comity in light of our uncertainty as to the applicable Illinois law. A stay prevents the inequity that would arise if NICTD were to obtain a reversal or other relief in Illinois after conclusion of proceedings in Indiana predicated upon the Illinois trial court’s (overturned) judgment. This is at least consistent with, if not required by, several Illinois decisions that have recognized and sought to avoid this possible injustice as well as the possibility of inconsistent judgments. V. Alleged Flaws in the Illinois Proceedings NICTD attempts to repackage the Illinois judgment as a ruling grounded on NICTD’s procedural default and, therefore, not a judgment on the merits. However, the ruling that is critical here is not the holding that NICTD’s motion to vacate or modify the award came too late under the Illinois Uniform Arbitration Act. Rather, the essential holdings of the Illinois courts are: (1) the Illinois courts, not Indiana, had jurisdiction over a suit to confirm the award; and (2) the award was confirmed in accordance with Illinois practice. It is irrelevant that this ultimate result may have been driven by the fact that NICTD’s motion to vacate or modify the award was stricken due to Illinois procedural default. As its last line of defense, NICTD asserts that the general constitutional obligation to give full faith and credit to the Illinois judgment does not apply in this case because the judgment was allegedly rendered in violation of NICTD’s right to due process of law. Specifically, NICTD contends that it was denied due process because it was never able to present a challenge to the merits of SouthShore’s application to confirm. Assessing this claim' requires some understanding of the Illinois Uniform Arbitration Act. The Act imposes no time limits on the filing of an application to confirm an arbitration award. 710 Ill.Comp.Stat.Ann. 5/11 (West 1992); United Steelworkers v. Danly Mach. Corp., 658 F.Supp. 736, 737-38 (N.D.Ill.1987) (petition to confirm an award under the Act may be filed at any time). However, an application to vacate or modify the award, whether brought independently or in response to a motion to confirm, must be made within ninety days of the issuing of the award. 710 Ill.Comp.Stat.Ann. 5/12-13 (West 1992); Johnson v. Baumgardt, 216 Ill.App.3d 550, 159 Ill.Dec. 846, 850-51, 576 N.E.2d 515, 519-20 (1991). The Appellate Court of Illinois recently reaffirmed this proposition in NICTD’s appeal in the Illinois proceedings. Chicago SouthShore and South Bend R.R., 224 Ill.Dec. at 601, 682 N.E.2d at 162. Therefore, NICTD had until approximately November 11, 1994 to bring a motion to vacate or modify. It did not do so. According to NICTD, the dismissal of its motion to vacate or modify violated its due process right to be heard on the merits of SouthShore’s application to confirm. The extent to which conformity to due process is a prerequisite for a judgment to be given full faith and credit was dealt with tangentially in Kremer v. Chemical Constr. Corp., 456 U.S. 461, 102 S.Ct. 1883, 72 L.Ed.2d 262 (1982), a case decided shortly after Underwriters Nat’l Assurance Co. Kremer involved whether a federal court was required to give pre-clusive effect under 28 U.S.C. § 1738 to a New York judgment dealing with the same issues and parties. That statute, which parallels the Full Faith and Credit Clause, mandates that the acts, records, and judicial proceedings of a state be given the same credit in federal courts that they would receive in the courts of the issuing state. A federal litigant contended that a New York state court decision was not entitled to full faith and credit because New York’s procedures for adjudicating his claim allegedly failed to provide him a full and fair opportunity to litigate the merits. The Court held that 28 U.S.C. § 1738 required federal courts to accord a state judgment the same credit it would be given in its own courts so long as the state, in adjudicating to judgment, satisfied the “applicable requirements” of the Due Process Clause of. the Fourteenth Amendment. Id. at 482,102 S.Ct. at 1898. Noting that this was a relatively undeveloped area of the law, Kremer drew on Full Faith and Credit Clause jurisprudence: “[T]he Court’s decisions enforcing the Full Faith and Credit Clause ... suggest that what a full and fair opportunity to litigate entails is the procedural requirements of due process.” Id. at 483 n. 24, 102 S.Ct. at 1898 n. 24 (collecting cases). Although the Court explained that “no single model of procedural fairness” was required by the Due Process Clause, id. at 483, 102 S.Ct. at 1898-99, it is plain from its discussion that all that is required is an opportunity to fairly litigate the merits- — a word used no fewer than four times. Id. at 482-84, 102 S.Ct. at 1898-99. No case has squarely held that Kremer applies to claims under the Full Faith and Credit Clause but, because Kremer drew on full faith and credit doctrine, we conclude it applies to interstate as well as federal-state issues. Justice Ruth Bader Ginsburg’s concurring and dissenting opinion in Matsushita Elec. Indus. Co., Ltd. v. Epstein, 516 U.S. 367, -, 116 S.Ct. 873, 884-90, 134 L.Ed.2d 6, 26-33 (1996) further supports the conclusion that procedural due process, may be a prerequisite for according a state-court judgment full faith and credit. This usually arises in the form of a challenge to the first court’s jurisdiction over the person of the defendant sought to be bound. Matsushita involved a variant on that theme — the preclu-sive effect that a federal court must give to a settlement of a class-action lawsuit in a Delaware state court. Justice Ginsburg focused on whether absent members of the class had been adequately represented by the named plaintiffs and therefore -could be bound by the settlement. In stressing the “centrality of the procedural due process protection of adequate representation in class action lawsuits,” 516 U.S. at-, 116 S.Ct. at 890, 134 L.Ed.2d at 33, Justice Ginsburg cited Kremer for the proposition that, for purposes of conforming to 28 U.S.C. § 1738, “a state-court judgment generally is not entitled to full faith and credit unless it satisfies the requirements of the Fourteenth Amendment’s Due Process Clause.” Id. at- -, 116 S.Ct. at 884-85, 134 L.Ed.2d at 26. Parity of reasoning would suggest the same applies to full faith and credit analysis by a sister state as a matter of constitutional doctrine. Cf. Kremer, 456 U.S. at 483 n. 24,102 S.Ct. at 1898 n. 24 (“Section 1738 was enacted to implement the Full Faith and Credit Clause.... It is therefore reasonable that § 1738 be subject to no more restriction than the Full Faith and Credit Clause.”) (citations omitted). Assuming that a due process violation could strip the Illinois decision of its status under the Full Faith and Credit Clause, we see no due process violation in the Illinois proceedings. Procedural due process in this context requires only notice and a reasonable opportunity to be heard, not that the opportunity necessarily be seized or successful. NICTD does not contend that it was denied the opportunity to challenge the arbitration award within ninety days, as required by the Illinois Uniform Arbitration Act. Nor does NICTD assert that ninety days was constitutionally insufficient time to act to protect its rights in Illinois. Distilled to its essence, NICTD’s claim is that Illinois courts denied NICTD the opportunity to file an untimely response. This does not provide a basis for disregarding the Illinois judgment: “A party cannot escape the requirements of full faith and credit and res judicata by asserting its own failure to raise matters clearly within the scope of a prior proceeding.” Underwriters Nat’l Assurance Co., 455 U.S. at 710, 102 S.Ct. at 1369 (citation omitted). Finally, NICTD attempts to avoid the consequences of this delay in the Illinois action by pointing to the timeliness of its appeal in the Indiana case dealing with the same subject matter. That is no answer because, as already elaborated, the effect of the Illinois proceeding is the controlling concern here. VI. NICTD Cannot Relitigate the Jurisdictional Issue NICTD’s recourse is to exhaust appellate remedies in Illinois. If Illinois law is as described by the trial court, the appeal in this case amounts to a constitutionally impermissible collateral attack on the jurisdictional question NICTD lost in that forum. In a related context, the U.S. Supreme Court has indicated that the policy of finality applies with no less force to questions of jurisdiction: After a party has his day in court, with opportunity to present his evidence and his view of the law, a collateral attack upon the decision as to jurisdiction there rendered merely retries the issue previously determined. There is no reason to expect that the second decision will be more satisfactory than the first. Stoll, 305 U.S. at 172, 59 S.Ct. at 138 (construing res judicata effect of bankruptcy court’s ruling on jurisdiction on subsequent ease in Illinois state court). And any challenge to the merits of the Illinois decision here is equally unavailing: “[T]he fact that the rendering court may have made an error of law with respect to a particular question does not deprive its decision of the right to full faith and credit, so long as that court fully and fairly considered its jurisdiction to adjudicate the issue.” Underwriters Nat’l Assurance Co., 455 U.S. at 709 n. 16, 102 S.Ct. at 1368 n. 16 (citation omitted). These claims of error too must be challenged in the rendering state. Illinois might have concluded that as a matter of comity it should have stayed (or was required by the terms of the Agreement to stay) its consideration of SouthShore’s application to confirm until Indiana courts resolved the question of governing Indiana law. However, the decision to decline the exercise of jurisdiction, where it has already been found to exist, is a matter of grace and not of constitutional mandate. Chicago, Rock Island & Pacific Ry. Co. v. Schendel, 270 U.S. 611, 616, 46 S.Ct. 420, 422, 70 L.Ed. 757 (1926) (“Each court is free to proceed in its own way and in its own time, without reference to the proceedings in the other court.”) (citation and internal quotation marks omitted). Concisely stated, the constitutionally dispositive factor here is not who sued first, but who won the race to judgment. Id. at 616-17, 46 S.Ct. at 422-23. On this crucial point, the Court of Appeals erroneously relied on the absence of a full and fair hearing in Indiana. Northern Indiana Commuter Transp. Dist., 666 N.E.2d at 448-19. Controlling precedent makes abundantly clear that the preclusive effect of the judgment of the first state (Illinois) does not hinge on whether NICTD had a full and fair opportunity to litigate the jurisdictional question in the second state (Indiana). Rather, the issue is whether the first court to render a judgment on the merits, in this case the Illinois trial court, afforded this opportunity. Indeed, this case illustrates what can happen when the established rules on full faith and credit are not respected. If the opinion of the Court of Appeals were allowed to stand, the result, as in Underwriters Nat’l Assurance Co., would be “two state courts reaching mutually inconsistent judgments on the same issue. This is precisely the situation the Full Faith and Credit Clause was designed to prevent.” Underwriters Nat’l Assurance Co., 455 U.S. at 715, 102 S.Ct. at 1371. We hold that the constitutional obligation to give full faith and credit to another state’s judicial decisions requires that Indiana give the same effect to the Illinois decision as would an Illinois court. We conclude, although without conviction, that a second Illinois trial court would stay rather than dismiss NICTD’s complaint. Accordingly, that is the appropriate action for the Indiana trial court to take. We note that because the Full Faith and Credit Clause makes no reference to finality, some commentators have observed that a stay pending the outcome of an appeal might be the most appropriate disposition irrespective of the law of the issuing state: “If the appeal in the rendering forum does not operate to vacate the judgment under that forum’s law, the recognizing court may entertain an action on the judgment or, more usually, stay its recognition and enforcement proceedings pending the determination of the appeal.” Eugene F. SCOLES & PETER HAY, CONFLICT OF LAWS, § 24.28 at 991 n. 2 (2d ed. 1992); cf. Griffin v. Griffin, 327 U.S. 220, 247 n. 12, 66 S.Ct. 556, 569 n. 12, 90 L.Ed. 635 (1946) (Rutledge, J., dissenting) (“Even if the judgment were not sufficiently final for full faith and credit purposes, it nevertheless would be within the discretion of the [court] to give it effect on grounds of comity.”). Because Illinois recognizes the wisdom of this course, it presents no issue in this case. VII. Jurisdiction of the Indiana Trial Court Finally, this appeal originally focused on whether Indiana courts have subject-matter jurisdiction over this case. The Agreement initially stipulated that (1) Indiana law governs; (2) the parties may challenge an “error of law” by instituting “an action at law within the State of Indiana to determine such legal issue”; and (3) by explicit written agreement “all arbitration proceedings shall take place” in Indiana. The Indiana Uniform Arbitration Act prescribes that “[t]he making of an agreement described in section 1 providing for arbitration in this state confers jurisdiction on [an Indiana court] to enforce the agreement under this chapter and to enter judgment on an award thereunder.” Ind. Code § 34-4-2-17 (1993). An agreement “described in section 1” is a “written agreement.” Ind.Code § 34-4-2-1 (1993). Although the subject-matter jurisdiction of our courts is generally created by statute or constitutional provision, State ex rel. Hight v. Marion Superior Court, 547 N.E.2d 267, 269 (Ind.1989), these sections of the Act essentially enable the parties to control by contract whether an Indiana court may review an action to enforce or set aside the award. The original written agreement therefore effectively provided the basis for jurisdiction to be vested in Indiana courts. Although in most situations there will be only one state that qualifies for jurisdiction over the award under its version of the Uniform Act, the Indiana version does not purport to confer exclusive jurisdiction on Indiana if more than one state has jurisdiction pursuant to its own laws. In this case, SouthShore argues that the award is reviewable only in Illinois, irrespective of what the Agreement might have originally provided, because the arbitration took place there. NICTD responds that the physical location was purely for the convenience of the arbitrators and that the parties contemplated no reformation of the written agreement, which specified Indiana governing law and agreed to arbitration in Indiana. NICTD concedes that it waived the Agreement’s original stipulation that “all” arbitration proceedings take place in Indiana, but contends that this did not rise to the level of a waiver of the contract’s provision for arbitration in Indiana so as to confer jurisdiction on Indiana courts. Arbitration provisions can be waived and the existence of waiver depends upon the circumstances of each case. Kendrick Mew,’l Hosp., Inc. v. Totten, 408 N.E.2d 130, 134-35 (Ind.Ct.App.1980). Neither party directs us to any Indiana cases addressing the effect of a parol decision to arbitrate outside Indiana for apparent logistical convenience when the written agreement specifically provides for arbitration in Indiana. However, we agree with NICTD that these facts are too murky to constitute a basis for finding waiver of the original agreement to arbitrate in Indiana. Waiver of a contractual right requires an intentional relinquishment of a known right. Jackson v. DeFabis, 553 N.E.2d 1212, 1218 (Ind.Ct.App. 1990). At best there is a parol agreement here memorialized by the arbitrator that was found to be sufficient basis for jurisdiction in Illinois as a matter of Illinois law. Although NICTD waived the requirement that “all” arbitration proceedings occur in Indiana, the written agreement, indicating governing Indiana law and a right to sue in Indiana, remained intact. This is not sufficient, as a matter of Indiana law, to constitute a waiver of the explicit contractual right to seek judicial review in a court in Indiana. Nor is this an explicit written revision of the Agreement. It is of course true that conduct inconsistent with an arbitration agreement — notably filing a lawsuit in a court of competent jurisdiction — can effect a waiver of the right to arbitrate. See, e.g., McNall v. Farmers Ins. Group, 181 Ind.App. 501, 506, 392 N.E.2d 520, 528 (1979) (amendment to right to arbitration may be implied by acts, omissions, or conduct); Shahan v. Brinegar, 181 Ind.App. 39, 44-45, 390 N.E.2d 1036, 1041 (1979) (Court of Appeals would not order arbitration where parties had already litigated disputed issues in trial court). In that circumstance, however, the party filing suit has acted inconsistently with the arbitration agreement and has in effect abandoned it. There is nothing inherently inconsistent in agreeing to conduct arbitration in Chicago for convenience, but treating all other provisions of the Agreement as unaffected. Indeed, because Indiana law is specified as controlling, that is at least facially a wholly sensible approach. Accordingly, we conclude that the Indiana trial court had jurisdiction over the subject matter, even if it may be bound by full faith and credit to enter a judgment of dismissal upon final resolution of this matter in Illinois. Chicago, Rock Island & Pacific Ry. Co., 270 U.S. at 616-17, 46 S.Ct. at 422-23 (where two states had concurrent jurisdiction over the same claim, the first judgment reached had to be given full faith and credit in the second state, regardless of which lawsuit was filed first). Conclusion The judgment of the LaPorte Superior Court dismissing NICTD’s complaint is reversed. The case is remanded to the La-Porte Superior Court to enter a stay for a reasonable time pending final resolution of NICTD’s appellate review in Illinois. Depending on the resolution of that review, dismissal may or may not be appropriate. SHEPARD, C.J., and DICKSON, SULLIVAN and SELBY, JJ., concur. .NICTD was created by statute in 1977. See 1977 Ind. Acts, P.L. 229, § 1 (repealed and reco-dified in 1980); see new Ind.Code §§ 8-5-15-1 to 8-5-15-26 (1993 & Supp.1996). In 1984, the General Assembly gave NICTD the authority to own and operate a railroad between Chicago and several points in Indiana. See 1984 Ind. Acts, P.L. 64, §§ 1-15. In 1989, the "old” Chicago SouthShore declared bankruptcy and NICTD and Anacostia & Pacific Company, Inc. ("A & P”) joined forces to purchase its operating assets from the bankrupt estate. NICTD acquired the passenger business and A & P took over freight operations. The two entered into a Memorandum Agreement ("Agreement”) providing, among other things, that A & P would pay NICTD a maintenance-of-way fee for the use of NICTD’s rail lines. The "new” SouthShore, the party to this case, acquired all of A & P’s rights and liabilities under the Agreement later that year. . The agreement to arbitrate in Chicago was made orally, but was memorialized in a letter from the chair of the arbitrators to all counsel noting that "[t]he parties by counsel waived the requirement that 'All arbitration proceedings shall take place within the State of Indiana.’ ” . On November 18, 1994, NICTD filed an amended complaint in the Indiana action. In response, SouthShore renewed its motion to dismiss for lack of subject-matter jurisdiction and relied on its memorandum of law filed on October 26, 1994. . 710 Ill.Comp.Stat.Ann. 5/1-23 (West 1992). . As noted above, the Appellate Court of Illinois recently affirmed the decision of the Illinois trial court. In its discussion of the Full Faith and Credit Clause and, particularly, Nevada v. Hall, 440 U.S. 410, 99 S.Ct. 1182, 59 L.Ed.2d 416 (1979), the Appellate Court of Illinois stated that "a state’s recognition of another state's laws or judicial decisions is based on state policy, rather than a constitutional command.” Chicago SouthShore and South Bend R.R., 224 Ill.Dec. at 601, 682 N.E.2d at 162 (emphasis added). To the extent the court here meant to suggest that a state may decline to accord the same effect to a judgment rendered by the courts of another state that would be given in the rendering state, we believe this is a misreading of Hall and the precedents we discuss today. . NICTD does not maintain that its pending appeal in Illinois divests the Illinois trial court judgment of binding effect for purposes of the Full Faith and Credit Clause. Nor would any contention along these lines be viable. In its most recent pronouncement on full faith and credit doctrine, the Supreme Court of the United States reiterated that the Full Faith and Credit Act, 28 U.S.C. § 1738 — which mandates that the "judicial proceedings” of any state "shall have the same full faith and credit” in federal courts as they have in the rendering state — "directs all [federal] courts to treat a state court judgment with the same respect that it would receive in the courts of the rendering state.” Matsushita Elec. Indus. Co., Ltd. v. Epstein, 516 U.S. 367, -, 116 S.Ct. 873, 877, 134 L.Ed.2d 6, 16-17 (1996). The lack of any reference to finality in Matsushi-ta is consistent with the Court’s directives in Underwriters Nat’l Assurance Co. and in other cases dealing with the constitutional provision. As Justice Jackson put it in Barber: "Neither the full faith and credit clause of the Constitution nor the Act of Congress implementing it says anything about final judgments or, for that matter, about any judgments. Both require that full faith and credit be given to 'judicial proceedings’ without limitation as to finality.” Barber, 323 U.S. at 87, 65 S.Ct. at 141 (Jackson, J., concurring). If the rendering state does not accord preclusive effect to a decision because of a pending review, full faith and credit requires no more of any other state. . Another factor that apparently influenced the Illinois trial court was the then-recent decision by the LaPorte Superior Court not to exercise jurisdiction over NICTD’s challenge to the arbitration. Although we question whether this should have been part of the inquiry, the Illinois judgment is still entitled to preclusive effect for the reasons explained in this opinion. . "Final” appears to be used in two senses in some discussions of this subject. A judgment may be "final” in the sense that it is not subject to modification and is ripe for appeal. It is also sometimes described as "final” to mean that it is entitled to claim preclusive and/or issue preclu-sive effect. The two may be the same if the judgment is in a jurisdiction, such as the federal courts, where preclusion is effected even if an appeal is pending. 18 Moore’s Federal Practice, § 131.30[2][c][ii] (Matthew Bender 3d ed. 1997). In a jurisdiction such as Illinois may be, where that is not the preclusive effect, a judgment may be ‘‘final” and appealable but not "final” in the sense that it precludes relitigation in another court. We use the term "binding” to mean entitled to preclusive effect to distinguish the two. . In its Illinois appeal, NICTD argued that Illinois courts were required to give full faith and credit to the Indiana Court of Appeals decision adjudicating the jurisdictional issue and, accordingly, should not take jurisdiction over the arbitration. In rejecting this claim, the Appellate Court of Illinois reasoned in part that “the decision of the Illinois court to confirm the arbitration award was not in derogation of any decision then existing by the Indiana court.” Chicago SouthShore and South Bend R.R., 224 Ill.Dec. at 601, 682 N.E.2d at 162. This can be read as implying that, in the view of the Appellate Court, the first state to render an order confirming the award might have some preclusive value for purposes of the "race to judgment” inquiry under the Full Faith and Credit Clause. . On July 15, 1997, the Appellate Court of Illinois denied NICTD’s motion for rehearing. Ordinarily that court's judgment would now be final. PSL Realty Co. v. Granite Inv. Co., 86 Ill.2d 291, 56 Ill.Dec. 368, 374-75, 427 N.E.2d 563, 569-70 (1991); accord Petition of Kirchner, 164 Ill.2d 468, 208 Ill.Dec. 268, 281, 649 N.E.2d 324, 337 (1995) (citing PSL Realty Co.), cert. denied, 515 U.S. 1152, 115 S.Ct. 2599-2600, 132 L.Ed.2d 846. However, when it denied rehearing the Appellate Court granted NICTD's application for a "certificate of importance.” See Ill. S.Ct. Rule 316. Roughly the equivalent of a certified question procedure, a certificate of importance requires the Illinois Supreme Court to review NICTD’s appeal, Ill.Const. art. VI, § 4(c), and a decision from that court is still pending. Although we find no clear precedent on the point, some authority suggests this may prevent use of the intermediate appellate judgment for res judicata purposes. Relph v. Board of Educ., 84 Ill.2d 436, 50 Ill.Dec. 830, 833, 420 N.E.2d 147, 150(1981). . Of these, only Illinois Founders involved the preclusive effect to be accorded an Illinois judgment that was being appealed. Shaw concerned a bankruptcy judgment, Wiseman a New York state judgment, and Golden Rule a California state judgment. However, none of these decisions appeared to condition the availabilily of a stay on whether the judgment whose preclusive effect was at issue was rendered in the Illinois state courts or elsewhere. Rather, all emphasized the possibility of inconsistent judgments if the first judgment was overturned on appeal. . See also Wilson v. City of Chicago, 900 F.Supp. 1015, 1026 (N.D.Ill.1995) (citing Rogers and opining that Illinois law in this area was "all over the board”), aff'd, 120 F.3d 681 (7th Cir. 1997). . Although not styled as a due-process violation, NICTD argued in its Illinois appeal that it should have been allowed to answer the merits of South-Shore's application to confirm. The Appellate Court of Illinois reached the same conclusion we do here — that NICTD had an opportunity to challenge the award in Illinois and failed to do so in a timely manner. Chicago SouthShore and South Bend R.R., 224 Ill.Dec. at 601-02, 682 N.E.2d at 162-63. . Cf. Magnolia Petroleum Co. v. Hunt, 320 U.S. 430, 439, 64 S.Ct. 208, 213-14, 88 L.Ed. 149 (1943) (describing "clear purpose" of Full Faith and Credit Clause as "to establish throughout the federal system the salutary principle of the common law that a litigation once pursued to judgment shall be as conclusive of the rights of the parties in every other court as in that where the judgment was rendered”). .NICTD points out that the arbitration clause in the Agreement provides that the award shall be binding "except that if either party claims that [it] is based upon an error of law it may ... institute an action at law within the State of Indiana to determine such legal issue.” Based on this provision, and noting that the Agreement stipulates Indiana law as governing, NICTD contends that it is not bound by the award pending resolution of its Indiana lawsuit. SouthShore replies that arbitration awards are final even if based on an error of law. In view of the terms of the Agreement, NICTD may well have a point. However, this also is a matter that can be, and was, raised and adjudicated in Illinois, where the trial court declined to delay enforcement of the award notwithstanding NICTD's contentions. . After its jurisdictional challenge in Illinois was rebuffed, NICTD filed a motion to stay the Illinois proceedings pending the outcome of its appeal in Indiana. In a hearing on November 6, 1995, the Illinois trial court denied this motion and indicated that it would confirm the award in favor of SouthShore. . As noted, the trial court treated NICTD's complaint as a motion to set aside the award. NICTD’s efforts to style its claim as a declaratory judgment action are unavailing. Because NICTD seeks relief from the arbitration decision, the trial court was correct to treat the complaint as a motion to set aside the award under the Indiana Uniform Arbitration Act. . SouthShore points to cases where the contract was silent as to the locus for arbitration. In that circumstance, courts in other states have held that the location of the arbitration determines subject-matter jurisdiction under their version of the Uniform Act. See, e.g., State ex rel. Tri-City Constr. Co. v. Marsh, 668 S.W.2d 148 (Mo.Ct.App.1984). However, these cases deal with construction of the Act to fill a necessary void — failure to specify any jurisdiction at all. They present significantly different issues from this case that involves interpretation of the Agreement in light of an abundance of language and actions by the parties. . The Agreement prescribed that "the subject matter hereof shall be embodied in definitive agreements to be prepared and executed by the parties....” NICTD argues, and SouthShore does not appear to dispute, that this provision required amendments to the Agreement to be in writing and signed by the parties. We agree with NICTD that the parol agreement here to hold arbitration proceedings in Chicago did not meet these requirements and therefore did not constitute an amendment to the Agreement.	CASELAW
Barge often refers to a flat-bottomed inland waterway vessel which does not have its own means of mechanical propulsion. The first modern barges were pulled by tugs, but on inland waterways, most are pushed by pusher boats, or other vessels. The term barge has a rich history, and therefore there are many other types of barges. "Barge" is attested from 1300, from Old French barge, from Vulgar Latin barga. The word originally could refer to any small boat; the modern meaning arose around 1480. Bark "small ship" is attested from 1420, from Old French barque, from Vulgar Latin barca (400 AD). The more precise meaning of Barque as "three-masted sailing vessel" arose in the 17th century, and often takes the French spelling for disambiguation. Both are probably derived from the Latin barica, from Greek baris "Egyptian boat", from Coptic bari "small boat", hieroglyphic Egyptian and similar ba-y-r for "basket-shaped boat". By extension, the term "embark" literally means to board the kind of boat called a "barque". In Great Britain a merchant barge was originally a flat bottomed merchant vessel for use on navigable rivers. Most of these barges had sails. For traffic on the River Severn the barge was described as: The lesser sort are called barges and frigates, being from forty to sixty feet in length, having a single mast and square sail, and carrying from twenty to forty tons burthen. The larger vessels were called trows. On the River Irwell there was reference to barges passing below Barton Aqueduct with their mast and sails standing. Barges on the Thames were called west country barges. During the Industrial Revolution, a substantial network of narrow canals was developed in Great Britain from 1750 onward. These new British canals had locks of only 7 feet (2.1 m) wide. This led to the development of the narrowboats, which had a beam of no more than 6 feet 10 inches (2.08 m). It was soon realized that the narrow locks were too limiting. Later locks were therefore doubled in width to 14 feet (4.3 m). This led to the development of the widebeam. The narrowboats were initially also known as barges, but only a very few had sails, unlike earlier vessels. From the start, most of the new canals were constructed with an adjacent towpath along which draft horses walked, towing the barges. These types of canal craft are so specific that on the British canal system the term 'barge' was not used to describe narrowboats and widebeams. Narrowboats and widebeams are still used on canals, now engine-powered. On the British canal system, the Thames sailing barge, and Dutch barge and unspecified other styles of barge, are still known as barges. The term Dutch barge is nowadays often used to refer to an accommodation ship, but originally refers to the slightly larger Dutch version of the Thames sailing barge. The people who moved barges were known as lightermen. Poles are used on barges to fend off other nearby vessels or a wharf. These are often called 'pike poles'. The long pole used to maneuver or propel a barge has given rise to the saying "I wouldn't touch that [subject/thing] with a barge pole." In the United Kingdom the word barge had many meanings by the 1890s, and these varied locally. On the Mersey a barge was called a 'Flat', on the Thames a Lighter or barge, and on the Humber a 'Keel'. A Lighter had neither mast nor rigging. A keel did have a single mast with sails. Barge and lighter were used indiscriminately. A local distinction was that any flat that was not propelled by steam was a barge, although it might be a sailing flat. The term Dumb barge was probably taken into use to end the confusion. The term Dumb barge surfaced in the early nineteenth century. It first denoted the use of a barge as a mooring platform in a fixed place. As it went up and down with the tides, it made a very convenient mooring place for steam vessels. Within a few decades, the term dumb barge evolved, and came to mean: 'a vessel propelled by oars only'. By the 1890s Dumb barge was still used only on the Thames. By 1880 barges on British rivers and canals were often towed by steam tugboats. On the Thames, many dumb barges still relied on their poles, oars and the tide. Others dumb barges made use of about 50 tugboats to tow them to their destinations. While many coal barges were towed, many dumb barges that handled single parcels were not. In the United States a barge was not a sailing vessel by the end of the 19th century. Indeed, barges were often created by cutting down (razeeing) sailing vessels. In New York this was an accepted meaning of the term barge. The somewhat smaller scow was built as such, but the scow also had its sailing counterpart the sailing scow. The innovation that led to the modern barge was the use of iron barges towed by a steam tugboat. These were first used to transport grain and other bulk products. From about 1840 to 1870 the towed iron barge was quickly introduced on the Rhine, Danube, Don, Dniester, and rivers in Egypt, India and Australia. Many of these barges were built in Great Britain. Nowadays 'barge' generally refers to a dumb barge. In Europe, a Dumb barge is: An inland waterway transport freight vessel designed to be towed which does not have its own means of mechanical propulsion. In America, a barge is generally pushed. Barges are used today for transporting low-value bulk items, as the cost of hauling goods that way is very low. Barges are also used for very heavy or bulky items; a typical American barge measures 195 by 35 feet (59.4 m × 10.7 m), and can carry up to about 1,500 short tons (1,400 t) of cargo. The most common European barges measure 251 by 37 feet (76.5 m × 11.4 m) and can carry up to about 2,450 tonnes (2,700 short tons). As an example, on June 26, 2006, in the US a 565-short-ton (513 t) catalytic cracking unit reactor was shipped by barge from the Tulsa Port of Catoosa in Oklahoma to a refinery in Pascagoula, Mississippi. Extremely large objects are normally shipped in sections and assembled after delivery, but shipping an assembled unit reduces costs and avoids reliance on construction labor at the delivery site, which in the case of the reactor was still recovering from Hurricane Katrina. Of the reactor's 700-mile (1,100 km) journey, only about 40 miles (64 km) were traveled overland, from the final port to the refinery. Self-propelled barges may be used for traveling downstream or upstream in placid waters; they are operated as an unpowered barge, with the assistance of a tugboat, when traveling upstream in faster waters. Canal barges are usually made for the particular canal in which they will operate. Unpowered vessels—barges—may be used for other purposes, such as large accommodation vessels, towed to where they are needed and stationed there as long as necessary. An example is the Bibby Stockholm. ...never was land so easily and cheaply in the grasp of the capitalist as it is now, if he chose to put out his hand, and yet there is not a capitalist in his senses who would touch it with a barge pole.	FINEWEB-EDU
Henry M. Phillips Henry Myer Phillips (June 30, 1811 – August 28, 1884) was a Democratic member of the U.S. House of Representatives from Pennsylvania. He was Pennsylvania's second Jewish congressman. Life Phillips was born in Philadelphia. He attended the Philadelphia schools and Franklin Institute. He studied law, was admitted to the bar in 1832 and commenced practice in Philadelphia. He served as clerk of the Philadelphia County Court of Common Pleas. Phillips was elected as a Democrat to the Thirty-fifth Congress. He was an unsuccessful candidate for reelection in 1858. He was a delegate to the 1860 Democratic National Convention. He resumed the practice of law in Philadelphia. He served as a trustee of Jefferson Medical College in 1862. He was appointed a member of the Board of Fairmount Park Commissioners in 1867 and elected its president in 1881. He was a member of the Board of City Trusts in 1869, vice president of the board 1870–1878, and president 1878–1882. He served as a director of the Academy of Music in 1870 and its president in 1872, resigning in 1884. He was elected as a member to the American Philosophical Society in 1871. Phillips was a member of the commission to supervise the erection of the municipal buildings in Philadelphia in 1870, resigning in 1871. He was a director of the Pennsylvania Railroad Company in 1874. Death Phillips died in Philadelphia in 1884 and interment was in Mount Sinai Cemetery in Frankford, Philadelphia, Pennsylvania. Henry M. Phillips Masonic Lodge #337 in Monongahela, PA is named in his honor.	WIKI
Page:Roman public life (IA romanpubliclife00greeiala).pdf/318 a magistrate and not taken from the legis actiones of the civil law—are best explained as survivals of a time when it was a mixed court of international jurisdiction. The two or four jurors probably represented the contracting states in equal proportions, the third or fifth may have been an arbitrator chosen from another community; the magistrate who gave the formula would have been an official of the town in which the mixed court sat. But the formula implied a system of legal principles, and these could not easily be furnished by the civil law (jus civile) of each contracting state. It was not Roman pride that prevented the foreigner from participating in her native law; it was the unwillingness of the foreigner to be made subject to a code characterised by excessive cumbrousness, by danger and by delay, and the counter-objection of the Roman to be the victim of similar disadvantages in the contracting state. No merchant, to whom time meant money, would adopt the cumbrous form of conveyance known as the mancipatio, when ownership could be acquired by the simple transfer (traditio) known of all nations; none would care to repeat a formula (to be learnt only of the Roman pontiff), the least error in the utterance of which was sufficient to extinguish his claim; and the symbolic acts performed before the praetor, though possibly dear to the Roman mind, could not have been attractive to the foreigner. Convenience dictated a compromise, and this was found in the gradual collection of a body of rights (jus) from the customs of "the world" (gentes) as known to the Romans. This jus gentium, or body of rights possessed by man as a citizen of the world, was a code of private international law, and it cannot be regarded as being even purely Italian. A nation that borrowed its alphabet from a Chalcidian city, that imitated the military organisation of the Hellenes, that traded in the sixth century with Sicily, Sardinia, Libya and Carthage, must have been deeply imbued with the customs of the Greek and Phoenician world. Nor was this code a growth of Rome's supremacy, for her commercial preceded her political greatness. Its origin dates back to a time probably anterior to the Republic, certainly far earlier than the institution of the praetorship. We have already	WIKI
1921 in Belgium Events in the year 1921 in Belgium. Incumbents * Monarch – Albert I * Prime Minister – Henry Carton de Wiart (to 16 December); Georges Theunis (from 16 December) Events * 24 April – Municipal elections * April – Third Solvay Conference held in Brussels * June – Crown Prince Hirohito's official visit to Belgium. * 18 September – 10th Gordon Bennett Cup held in Brussels * 20 November – Legislative elections (first with limited female suffrage) * 27 November – Provincial elections Publications * Olympic Games Handbook: Containing official records of the seventh Olympiad (New York, American Sports Publishing co.) * Émile Cammaerts, Belgium from the Roman Invasion to the Present Day (London, T. Fisher Unwin) Art and architecture * Buildings * Antwerp Diamond Exchange completed. Births * 21 March – Arthur Grumiaux, violinist (died 1986) * 13 April – Joseph Moureau, fighter pilot (died 2020) * 7 September – René Derolez, philologist (died 2005) Deaths * 12 November – Fernand Khnopff (born 1858), painter	WIKI
Carcinoid Tumor Gene Set Dataset HuGE Navigator Gene-Phenotype Associations Category disease or phenotype associations Type phenotype Description A tumor formed from the endocrine (argentaffin) cells of the mucosal lining of a variety of organs including the stomach and intestine. These cells are from neuroectodermal origin. (Human Phenotype Ontology, HP_0100570) Similar Terms Downloads & Tools Genes 14 genes associated with the Carcinoid Tumor phenotype by text-mining GWAS publications from the HuGE Navigator Gene-Phenotype Associations dataset. Symbol Name AKT1 v-akt murine thymoma viral oncogene homolog 1 APC adenomatous polyposis coli GNAS GNAS complex locus IDH1 isocitrate dehydrogenase 1 (NADP+), soluble JAK3 Janus kinase 3 KRAS Kirsten rat sarcoma viral oncogene homolog MEN1 multiple endocrine neoplasia I MET MET proto-oncogene, receptor tyrosine kinase NFKB1 nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 PIK3CA phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit alpha RB1 retinoblastoma 1 SMAD4 SMAD family member 4 STK11 serine/threonine kinase 11 TP53 tumor protein p53	ESSENTIALAI-STEM
Page:Popular Science Monthly Volume 49.djvu/781 Rh wise even a long personal acquaintance with the candidate could not afford, and to determine with considerable exactness the working power of individuals in simple mental tasks. The measure is afforded by determining the number of small, similar problems resolved by the subject in a given time—such, for example, as numbering letters, reading, the learning by heart of series of numbers or syllables, and the continuous addition of columns of numbers. In the last-mentioned method the person under trial is set to adding figures ranged one under another in a book printed expressly for that purpose, for a considerable time, without stopping—under some circumstances, for several hours. When the sum reaches a hundred, the hundred is simply carried on and added to the excess in units. A bell sounds every five minutes, when the candidate draws a line after the last-added number. At the end of the trial it is easy to determine how many numbers the person can add every five minutes. The candidates—all of nearly equal degrees of advancement, and of about the same age—varied greatly in the speed of their execution, the more rapid ones adding two and a half times as many numbers in five minutes as the slower ones. This proves that facility in reckoning is largely peculiar to the individual. Accuracy, however, was not considered. If that had been brought in, some of the results might have been materially different. It further appeared that the speed of the additions increased regularly with each effort, but not equally with the different subjects, so that it was possible sometimes for a slower calculator eventually to pass ahead of the next quicker one. This improvement in facility was, however, subject to limitation, and is less in each repetition—as, for example, twenty-five per cent from the first trial to the second; fifteen per cent from the second to the third; and about six per cent from the third to the fourth—till a point is finally reached when there is no further increase. This capacity for improvement through practice appears also to be an individual quality. The permanence of the acquisitions obtained through it has not been sufficiently investigated; but they seem in the end gradually to wear out, and the rapidity of the wearing-out process to vary with the persons. Of an opposite character to this is the far more rapidly increasing effect of fatigue, which always causes a diminution of efficiency, however much it may at first be temporarily balanced by the improvement through exercise. When it has once gained the upper hand, a speedy and unintermitted decline of efficiency ensues. The time when this shall take place depends on the degree of capacity already reached, the personal peculiarity, and casual influences.	WIKI
Talk:List of Malibu Country episodes This article I still don't see why we need a separate episode list. The entire combined pagesize with the main page is just over 30K bytes. Far below WP:SIZERULE recommendations and causes readers to navigate elsewhere. If people would quit detailing every little thing in the episode summaries, the list would be much smaller. — WylieCoyote 09:46, 8 January 2013 (UTC) * Hi CAWylie, thank you for trimming the summaries I added, I know your quite irritated about my detailed edit summaries based on your edit summaries ending with exclamation point. I'm going to try to make my short summaries better by making it less detailed and I hope you will believe me on that part. I absolutely understand your point, but I felt the episode list on the main page was getting somewhat large and should be added to it's own episode list article and after analyzing some article lists, I saw that most episode article lists like this one for instance are created anyway. Also, Malibu Country has new episodes almost every Friday and the number of episodes will fill up very fast, a separate article episode list is ideal for a huge episode list. * — Webclient101 talk 05:16, 10 January 2013 (UTC) * Thanks for keeping the summary length down. As for your reasoning to have this page, please see WP:OTHERSTUFF. Nashville is just over the acceptable limit for page splitting. Malibus split should've waited till the second season. — WylieCoyote' 22:31, 14 January 2013 (UTC) * My reasoning was to show you why I created this article. But I agree with what your saying. I will add the episode list back to the Malibu Country, and I will redirect this article to Malibu Country. After the episode list on the main page gets quite large, perhaps till the second season, I will add the content back to this page. Cheers, Webclient101 talk 03:13, 16 January 2013 (UTC)	WIKI
Bipartisan group of senators calls for probe of Russian role in 2016 US elections (CNN)A bipartisan quartet of high-profile senators said Sunday that "recent reports of Russian interference in our election should alarm every American," as President-elect Donald Trump sharpened his unprecedented attacks on US intelligence agencies. The group -- two Republicans and two Democrats -- called for an investigation into American intelligence agencies' conclusion that Russian hacking was intended to help Trump defeat Hillary Clinton. "Congress's national security committees have worked diligently to address the complex challenge of cybersecurity, but recent events show that more must be done," said Sens. Chuck Schumer, the incoming Senate Democratic leader, Sen. John McCain, the Armed Services Committee chairman, fellow Republican Sen. Lindsey Graham, and Sen. Jack Reed, the top Armed Services Committee Democrat, in a Sunday morning statement. "While protecting classified material, we have an obligation to inform the public about recent cyberattacks that have cut to the heart of our free society. Democrats and Republicans must work together, and across the jurisdictional lines of the Congress, to examine these recent incidents thoroughly and devise comprehensive solutions to deter and defend against further cyber-attacks." The letter is an implicit rebuke of Trump, who has questioned whether Russia actually interfered with the election, including with hacks of Democratic operatives. The President-elect on Sunday morning blasted the intelligence community anew, calling its assessment that Russia interfered in the election "ridiculous." "I think it's just another excuse. I don't believe it," Trump said in an interview on "Fox News Sunday." Two days earlier Trump sided with Russia over the CIA and attacked the US intelligence assessment of Russia's role. "These are the same people that said Saddam Hussein had weapons of mass destruction," Trump's transition team said in a terse, unsigned statement targeting the CIA on Friday. "The election ended a long time ago in one of the biggest Electoral College victories in history. It's now time to move on and 'Make America Great Again.'" Trump won 306 electoral votes, a comfortable margin above the 270 necessary but in the lower percentage of presidential victories over two centuries. Concerns The transition team's reference to the agency's most humiliating recent intelligence misfire -- over its conclusion that Iraq under Saddam Hussein had weapons of mass destruction -- threatens to cast an early cloud over relations between the Trump White House and the CIA, whose assessments he'll need to make monumental decisions. The top leadership of the agency that presided over the Iraq failure during the Bush administration has long since been replaced. But the comments from Trump's camp will cause concern in the Intelligence community about the incoming President's attitude to America's spy agencies. CNN reported last week that Trump is getting intelligence briefings only once a week. Several previous presidents preparing for the inauguration had a more intense briefing schedule. The sharp pushback to revelations in The Washington Post, which followed an earlier CNN report on alleged Russian interference in the election, represented a startling rebuke from an incoming White House to the CIA. Trump has also been highly sensitive to any suggestion that he did not win the election fair and square, including claiming that he is only trailing Clinton in the popular vote because of a huge trove of illegal votes -- a claim for which he has provided no evidence. On Sunday Schumer said his requested probe should reach beyond Russia. "The goal is to find out how extensive it is, how deep this is, what countries are doing this -- it won't be limited to just Russia and then to come up with conclusions on how to stop it," Schumer told reporters in New York City. "Our intel property in the government and some of our most important companies that employ tens of thousands of people in good paying jobs are hacked regularly. We have to look at all of this." CNN's Stephen Collinson, Elise Labott and Vivian Kuo contributed to this report.	NEWS-MULTISOURCE
Page:Prosecution of Offences Act 1985.pdf/3 c. 231 1985 CHAPTER 23 An Act to provide for the establishment of a Crown Prosecution Service for England and Wales; to make provision as to costs in criminal cases; to provide for the imposition of time limits in relation to preliminary stages of criminal proceedings; to amend section 42 of the Supreme Court Act 1981 and section 3 of the Children and Young Persons Act 1969; to make provision with respect to consents to prosecutions; to repeal section 9 of the Perjury Act 1911; and for connected purposes. by the Queen's most Excellent Majesty, by and with the advice and consent of the Lords Spiritual and Temporal, and Commons, in this present Parliament assembled, and by the authority of the same, as follows:— Constitution and functions of Service 1.—(1) There shall be a prosecuting service for England and Wales (to be known as the “Crown Prosecution Service”) consisting of— * (a) the Director of Public Prosecutions, who shall be head of the Service;	WIKI
Handle Android Services (Part-1) Abhishek Srivastava 6 min readJul 8, 2020 -- With recent Android releases dealing with background Services, it has become more complicated than ever. For android developers there are Five groundbreaking changes: >Memory Basics >Background execution limits >Location updates limit >Removing of implicit broadcasts >Notification channels Memory Basics: Why Android devices have out of memory issue on Mobile Apps due to the heavy load of running Activity/Services Android kernel was first developed it and it was based on Linux-Kernel. The main difference between Android and all other Linux-Kernel based systems is that Android does not have a thing called “Swap space.” Swap space in Linux is used when the amount of physical memory (RAM) is full. If the system needs more memory resources and the RAM is full, inactive pages in memory are moved to the swap space. While swap space can help machines with a small amount of RAM, it should not be considered a replacement for more RAM. Swap space is located on hard drives, which have a slower access time than physical memory. In Android, there is no such thing as a “Swap space.” When the system is running out of memory. The guy’s goal is to free up memory by killing the processes based on their “visibility state” and the amount of memory consumed. Every process gave its oom_adj score by Activity Manager. It’s a combination of application state (e.g., foreground, background, background with service, etc.). Here is a short example of all oom_adj values: # Define the oom_adj values for the classes of processes that can be # killed by the kernel. These are used in ActivityManagerService. setprop ro.FOREGROUND_APP_ADJ 0 setprop ro.VISIBLE_APP_ADJ 1 setprop ro.SECONDARY_SERVER_ADJ 2 setprop ro.BACKUP_APP_ADJ 2 setprop ro.HOME_APP_ADJ 4 setprop ro.HIDDEN_APP_MIN_ADJ 7 setprop ro.CONTENT_PROVIDER_ADJ 14 setprop ro.EMPTY_APP_ADJ 15 Background execution limits Let’s talk about the background execution limitations. Background execution limitations mainly apply to two major components: >Service >Wake locks Service: A Service is an application component that can perform long-running operations in the background, and it does not provide a user interface. So, fundamentally Service is the same thing as the activity but it doesn’t have the UI component in it. So, it doesn’t have to perform smooth animation at 60 fps. That’s why it can run perform any task for a longer period of time than the activity. There are three types of service: Started Service — A service is started when an application component (such as an activity) calls startService(). Bound Service — A service is bound when an application component binds to it by calling bindService(). Scheduled Service — A service is scheduled when an API such as the JobScheduler. Background vs Foreground applications: To learn background execution changes, we need to know the difference between background and foreground application first. Rule of thumb, your application will be considered as a foreground service if any of the below three cases are true: 1. Your application has currently visible activity. 2. Your application has foreground service running. 3. Your application is connected to another foreground app by binding the service or by consuming their content providers. If any of the above scenarios are not true in the current instance, your application is considered to be in the background. Why do we need to restrict the use of background services? Whenever your applications run in the background using services, your application consumes two precious resources: 1) Memory and 2) Battery. These two are limited resources on mobile devices and most of the low to mid-range devices don’t have plenty of memory or battery inside it. Suppose, if your application is doing some very intensive tasks in the background and using the larger amount of RAM to perform that task, then this will create the very junky user experience, especially if the user is using another resource-intensive app, such as playing a game or watching a video in foreground. As per the documentation for the started service the best practice is, When the operation is complete, the service should stop itself. But, many applications have long-running background services, which basically runs for the infinite time to either maintain the socket connection with the server or monitor some tasks or user activity. These services create battery drain and also they constantly consume memory. What are the limitations of services starting from Android O? Starting from Android O, if your application is in the background (check above three conditions), your application is allowed to create and run background services for some minutes. After some minutes passed, your application will enter the idle stage. When your application entered in the idle stage, the system will stop all the background services just like your service calls Service.stopSelf(). And here comes the fun part… As I discussed above, the problem of battery drain and memory consumption is mainly caused by started services. To eliminate this, Android O completely prevents the use of the startService() method to start the service. If you call startService() on Android O, you will end up getting IllegalArgumentException. To handle Background process execution and memory issue Google launches WorkManager. WorkManager WorkManager aims to simplify the developer experience by providing a first-class API for system-driven background processing. It is intended for background jobs that should run even if the app is no longer in the foreground. Where possible, it uses JobScheduler or Firebase JobDispatcher to do the work; if your app is in the foreground, it will even try to do the work directly in your process.WorkManager incorporates the features of its predecessors in a modern, consistent API that works back to API level 14 while also being conscious of battery life. WorkManager uses an underlying job dispatching service based on the following criteria: Note: If your app targets Android 10 (API level 29) or above, your FirebaseJobDispatcher and GcmNetworkManager API calls will no longer work on devices running Android Marshmallow (6.0) and above. Follow the migration guides for FirebaseJobDispatcher and GcmNetworkManager for guidance on migrating. Also, see the Unifying Background Task Scheduling on the Android announcement for more information regarding their deprecation. The WorkManager library has several components: WorkManager — receives work with arguments & constraints and enqueues it. Worker — have only one method to implement doWork() which is executed on a background thread. It’s the place where all your background tasks should be done. Try to keep it as simple as possible. WorkRequest — work request specify which Worker enqueued with what Arguments and what are the Constraints for it (e.g., internet, charging ). WorkResult — Success, Failure, Retry. Data — Persistable set of key/value pairs which are passed to/from Worker. Underneath, the architecture of WorkManager lib will look like this: Now for the rest points, we will discuss in the second part for Location update Issue, Removing of implicit broadcasts, and Notification channels. https://developer.android.com/topic/libraries/architecture/workmanager -- -- Abhishek Srivastava Senior Software Engineer \| Android \| Java \| Kotlin \|Xamarin Native Android \|Flutter \|Go Recommended from Medium Lists See more recommendations	ESSENTIALAI-STEM
Page:Eliot - Middlemarch, vol. I, 1871.djvu/62 48 It was not many days before Mr Casaubon paid a morning visit, on which he was invited again for the following week to dine and stay the night. Thus Dorothea had three more conversations with him, and was convinced that her first impressions had been just. He was all she had at first imagined him to be: almost everything he had said seemed like a specimen from a mine, or the inscription on the door of a museum which might open on the treasures of past ages; and this trust in his mental wealth was all the deeper and more effective on her inclination because it was now obvious that his visits were made for her sake. This accomplished man condescended to think of a young girl, and take the pains to talk to her, not with absurd compliment, but with an appeal to her understanding, and sometimes with instructive correction. What delightful companionship! Mr Casaubon seemed even unconscious that trivialities existed, and never handed round that small-talk of heavy men which is as acceptable as stale bride-cake brought forth with an odour of cupboard. He talked of what he was interested in, or else he was silent and bowed with sad civility. To Dorothea this was adorable genuineness, and religious abstinence from that artificiality which uses up the soul in the efforts of pretence. For	WIKI
Wikipedia:Articles for deletion/The Global Architect Institute The result was delete. Sandstein 21:27, 22 February 2022 (UTC) The Global Architect Institute * – ( View AfD View log \| edits since nomination) Fails WP:GNG and WP:ORG Assyrtiko (talk) 11:23, 15 February 2022 (UTC) * Note: This discussion has been included in the list of Education-related deletion discussions. Assyrtiko (talk) 11:23, 15 February 2022 (UTC) * Note: This discussion has been included in the list of United States of America-related deletion discussions. Assyrtiko (talk) 11:23, 15 February 2022 (UTC) * Note: This discussion has been included in the list of Organizations-related deletion discussions. CAPTAIN RAJU (T) 11:33, 15 February 2022 (UTC) * Note: This discussion has been included in the list of Delaware-related deletion discussions. CAPTAIN RAJU (T) 11:33, 15 February 2022 (UTC) * Automated comment: This AfD was not correctly transcluded to the log (step 3). I have transcluded it to Articles for deletion/Log/2022 February 15. —cyberbot I Talk to my owner :Online 16:20, 15 February 2022 (UTC) * Delete. My searches found nothing but press releases. Without some sort of significant coverage in independent reliable sources, this organization does not meet the notability criteria. Extraordinary Writ (talk) 01:11, 16 February 2022 (UTC) * Delete Fails WP:ORG. 1 gnews hit. LibStar (talk) 05:33, 16 February 2022 (UTC) * Delete' Press releases do not equal notability and no better sources can be found. GeekBurst (talk) 17:22, 22 February 2022 (UTC)	WIKI
DYMX DYMX (95.5 FM), broadcasting as 95.5 Star FM, is a radio station owned and operated by Bombo Radyo Philippines through its licensee People's Broadcasting Service, Inc. Its studio, offices and transmitter are located at the CBS Bldg., 140 M. Velez St., Guadalupe, Cebu City. It operates daily from 5:00 AM to 9:30 AM. History Star FM started operations on May 25, 1994, a month after Bombo Radyo was rebranded all 17 FM stations under the such branding. Its initially carried a power of 25,000 watts, covering the Central Visayas region and portions of the Western and Eastern Visayas. In less than a year, Star FM was ranked by the Radio Research Council as the #1 FM radio station in the city. It remained on top until 1999, when its rival station 91.5 Hot FM (now Yes The Best) took over the top spot, which lasted until 2002. Star FM became the first FM radio station in Metro Cebu to use audio cassette tapes and compact discs for playing their favorite songs and playback. Among its notable programs were It's All For You every Morning, Afternoon & Evening, Twilight Zone, Star Sweep every weekday, Never on Sunday, Superstar Sunday and Sunday Disco Recall every Sunday. In April 2006, on its 12th anniversary, Star FM was relaunched with a new logo and the slogan, "Iba Ang Dating". A Few years later, the station reduced its power to 10,000 watts. In 2013, Star FM adapted the new slogan "Like Mo, Share Mo". On February 3, 2014, Bombo Network News began simulcasting in several Star FM stations alongside Bombo Radyo stations; thus allowing the station to added news and talk to its format. The network's flagship national newscast was made to compete with longer-established rival Brigada News FM, a news and music FM station owned by Brigada Mass Media Corporation. On the 1st quarter of 2016, Star FM's provincial stations started carrying the slogan "It's All For You", this time emphasizing more on the music. In a few months, it began broadcast 24/7 operations until 2018. From September 2016 to January 2018, Star FM operated with a transmitting power of 5,000 watts stereo, but with limited coverage area. On January 18, 2018, after setting up its new transmitting equipment at the rooftop of the CBS Building, Star FM upgraded its power to a newly improved 25,000 watts stereo, resulting in an even clearer signal in Central Visayas and Southern Leyte. It was only in the same year when several Star FM stations licensed to Consolidated Broadcasting System transferred its licensee to People's Broadcasting Service, following the former's non-renewal of licensee. In 2019, due to financial problems, Star FM reduced its daily broadcast schedule from 24 hours to 19 hours, signing off at 11:00 PM. In March 2020, The Holy Rosary started simulcasting on all Bombo Radyo and Star FM stations nationwide, following the extension of the community quarantine regulations amidst the COVID-19 in the Philippines. The station also reduced its broadcasting hours, signing off between 9:00-9:30pm. Following the aftermath of Typhoon Rai (Odette) at the evening of December 16, 2021, Star FM was simulcast over its sister station Bombo Radyo in providing updates regarding the impact of the said typhoon in Cebu, Bohol and Leyte. A day later, DYMF went off the air after its transmitter was destroyed by the said typhoon. Since then, several of its programs began airing on Star FM, this time under the interim name Bombo Radyo Star FM. On February 15, 2022, Star FM reverted to its original programming after DYMF, whose new transmitter equipment was installed the day before, resumed operations.	WIKI
White Mountain Wilderness The White Mountain Wilderness is a 46,963 acre designated wilderness area managed by the United States Forest Service. Located in the Smokey Bear Ranger District of the Lincoln National Forest, the White Mountain Wilderness lies in the Sierra Blanca mountains of south central New Mexico, approximately 15 mi north northwest of the town of Ruidoso. History and Administration The White Mountain Wilderness was first established as a primitive area by the United States Congress in 1933. After the passage of Public Law 88-577, also known as The Wilderness Act, in September 1964, the primitive area was re-designated as the White Mountains Wilderness Area and entered into the newly created National Wilderness Preservation System. Originally established at 28,118 acres, Public Law 96-550, the New Mexico Wilderness Act, added an additional 16,860 acres to the area in December 1980, increasing the total size to 46,963 acres. The Wilderness Area is administered by the United States Forest Service as part of the Lincoln National Forest, headquartered in Alamogordo, New Mexico. Located in the Smokey Bear Ranger District of the Lincoln, the Wilderness is managed from the District Ranger Office in Ruidoso, New Mexico. Geography and Climate This wilderness area contains approximately 46963 acre of land and is approximately 12.5 mi long and 12 mi wide. It consists of mainly a long, northerly running ridge and its branches. The west side of this ridge is extremely steep and rugged, while the eastern side is more gentle with broader, forested canyons and some small streams. Elevations range from 6400 ft at Three Rivers Campground on the western side to 11580 ft near Lookout Mountain in the south. There are four different life zones within this wilderness area: pinyon-juniper, ponderosa pine, mixed conifer, and sub-alpine forest, plus alpine tundra found at the summit of Sierra Blanca just outside the wilderness boundary. Abrupt changes in elevation, escarpments, rock outcroppings, and avalanche chutes make for striking contrast and scenery. The area is also interspersed with meadows and grass-oak savannahs, which are the result of forest fires. The weather is dry and windy in springtime, with temperatures ranging from 32 °F/0 °C to 80 °F/26 °C. July and August are the rainy months with frequent afternoon showers and high temperatures averaging 85 °F/29 °C. Snows in winter do not typically begin until mid-November, and snowfall averages 6 ft or more. Low temperatures during winter average around 22 F, but have reached as low as -15 F. Water sources are not abundant, but do exist in the form of small streams or springs scattered throughout the area. Trails with good water access include Big Bonito Trail and South Fork Trail. Although fishing is permitted within the wilderness area, few fish are found due to the small size of most streams. Although the streams run well most of the year, in times of severe drought, they may be non-existent. Wildlife Wildlife commonly found in the Wilderness Area include mule deer, elk, black bear, turkey, porcupine, badger, bobcat, gray fox, coyote, skunk, spruce and rock squirrels, and numerous species of mice, moles, and birds. The White Mountain area is also home to many types of birds and is a critical habitat for several species, including the northern three-toed woodpecker, Clark's nutcracker, red-breasted nuthatche, Townsend's solitaires, and golden-crowned kinglets. Location and Access Located approximately 15 miles NNW of Ruidoso, the northern and eastern sections of the Wilderness can be accessed by passenger car from Ruidoso via NM state highways 48 and 37, while the southern half can be reached from either Ruidoso, via state highway 532 or from Carrizozo, New Mexico or Tularosa, New Mexico via US 54. As with all designated Wilderness Areas the White Mountains Wilderness is closed to all forms of mechanized transport, so the most common means of access is via trailheads, small developed parking areas located just outside the Wilderness’ boundaries. New Mexico 37 offers access to the Nogal Canyon Trailhead, via Forest Road 400, the Mills Canyon and Argentina & Bonito Trailheads via Forest Road 107, and the Crest Trailhead via Forest Roads 107 and 108. State Highway 532 offers access to the Wilderness via Ski Apache, a winter sports area west of Ruidoso operated by the Mescalero Apache Reservation. US 54 offers access to the Three Rivers Trailhead at the Three Rivers Campground, a small Forest Service camping area at the end of Forest Road 579, a 13-mile road that begins on US 54 approximately 18 miles north of Tularosa and 24 miles south of Carrizozo. Recreation While there are no developed facilities within the Wilderness, the area is open to hiking, backpacking, horse-back riding, and primitive “Leave No Trace” camping. For hikers and riders the Wilderness contains a developed trail system of nearly two dozen maintained trails ranging in length from 0.8 miles to 20 miles and rated from easy to difficult. The area’s longest trail, the 20-mile long Crest Trail (T25), runs across much of the eastern end of the Wilderness and crosses a number of smaller trails, including the Big Bonito Trail (T36), the Scenic Trail (T15), and the Three Rivers Trail (T44). Nearby Attractions The area’s namesake peak, Sierra Blanca (White Mountain) is located on the adjacent Mescalero Indian Reservation and can reached by a 1.25 mile (2 km) trail from Lookout Mountain. Reaching 11,973 ft, Sierra Blanca is the southernmost mountain in the continental United States to rise above timberline. Other areas of interest near the Wilderness include the previously mentioned Ski Apache winter sports area, and the Monjeau Lookout, a stone fire lookout tower built in the 1930s. The Lincoln National Forest’s other Wilderness Area, the Capitan Mountains Wilderness, is located NE of the White Mountains Wilderness, near Capitan, New Mexico. Also located in the Smokey Bear Ranger District, the Capitan Wilderness is considerably more rugged and remote than the White Mountain Wilderness, and can only be accessed by high-clearance vehicles. Also near Capitan is the Fort Stanton-Snowy River Cave National Conservation Area. A former frontier military reservation, the Bureau of Land Management-administered area protects the 31-mile Fort Stanton Cave complex, the 14th longest cave in the United States.	WIKI
Table Editor Table Generator How to JSONLines Online ? 1. Create JSONLines using Table Editor You can edit your data online like Excel through Table Editor, and the changes will be converted into JSONLines in real-time. 2. Copy the Generated JSONLines The JSONLines data has been generated in the box of Table Generator. This handy converter defaults to outputting data where each line is an object, in addition to this it can optionally generate lines in an array format. Note: Your data is secure, the converts is done completely in your web browser and we will not store any of your data. What is JSONLines? .jsonl .json .jsonline JSON Lines is a convenient format for storing structured data that may be processed one record at a time. It works well with unix-style text processing tools and shell pipelines. It's a great format for log files. It's also a flexible format for passing messages between cooperating processes. Would you recommend this online tool to your friends?	ESSENTIALAI-STEM
United States Steel sees fourth-quarter profit above estimates Adds details and background throughout Dec 14 (Reuters) - United States Steel X.N on Thursday said it expects its fourth quarter profit above analysts' expectations. Steel companies are set for a strong start to 2024 as prices spike following a resolution of the United Auto Workers (UAW) union strike against the Detroit Three automakers. The company said it expects net earnings per share in the range of 20 cents to 25 cents, above analysts average expectation of 19 cents per share, according to LSEG data. It also forecast quarterly EBITDA at about $250 million, above estimates of $236.70 million. (Reporting by Jaiveer Singh Shekhawat and Arunima Kumar in Bengaluru) ((JaiveerSingh.Shekhawat@thomsonreuters.com;)) The views and opinions expressed herein are the views and opinions of the author and do not necessarily reflect those of Nasdaq, Inc.	NEWS-MULTISOURCE
Solidity Development Tools: Boosting Productivity and Efficiency Photo of author Written By Liam Bennett Liam Bennett is a pioneering figure in the blockchain realm with over a decade of hands-on experience in Solidity. Committed to pushing the boundaries of decentralized technologies, Liam has been at the forefront of numerous innovative projects. Solidity Development Tools Solidity development tools play a crucial role in boosting productivity and enhancing efficiency for developers working on Ethereum smart contracts. These tools provide valuable features that streamline the development process, improve code quality, and ensure the security of the contracts. In this section, we will explore the importance of Solidity development tools and provide an overview of some commonly used tools in the field. The Importance of Solidity Development Tools Solidity development tools are essential for several reasons. Firstly, they provide a convenient environment for writing, testing, and deploying smart contracts. These tools offer features such as code autocompletion, syntax highlighting, and error checking, which help to catch potential bugs and improve code efficiency. Secondly, Solidity development tools offer debugging capabilities that aid in identifying and resolving issues within smart contracts. Debugging tools allow developers to step through their code, inspect variables, and trace the execution flow. By leveraging these tools, developers can save time and effort in diagnosing and fixing errors. For more information on debugging Solidity contracts, refer to our article on debugging Solidity contracts: best tools and practices. Lastly, Solidity development tools provide a range of security auditing features to ensure the robustness and integrity of smart contracts. These tools help detect common vulnerabilities and recommend best practices to mitigate potential risks. Solidity developers should prioritize security audits to safeguard their contracts. To learn more about the importance of security audits in Solidity development, refer to our article on the importance of security audits in Solidity development. Overview of Solidity Development Tools There are various Solidity development tools available in the market, each serving a specific purpose. Let’s take a high-level look at some commonly used tools: Tool Description Truffle Suite A comprehensive development framework that provides a suite of tools for compiling, testing, and deploying smart contracts. It also offers a development environment and a built-in testing framework. For more details, refer to our article on Truffle Suite. Remix IDE A web-based integrated development environment (IDE) that allows developers to write, test, and deploy Solidity contracts. Remix IDE offers a user-friendly interface and supports various debugging features. To get started with Remix IDE, check out our tutorial on using Remix IDE for Solidity debugging. Ganache A local blockchain emulator that provides a simulated environment for testing smart contracts. Ganache allows developers to deploy contracts, execute transactions, and inspect state changes without interacting with the live Ethereum network. MythX A security analysis platform that performs automated security audits on Solidity smart contracts. MythX helps identify vulnerabilities, such as reentrancy attacks and uninitialized variables, and provides detailed reports for remediation. For more information on tools and platforms for security audits, refer to our article on tools and platforms for Solidity security audits. These are just a few examples of Solidity development tools that can significantly enhance productivity and efficiency. It’s important for developers to regularly update and maintain their tools to leverage the latest features and security patches. Additionally, staying informed about new tools and updates in the Solidity ecosystem is crucial for keeping up with best practices and emerging technologies. Finally, developers should actively participate in the Solidity community to leverage community support and resources. By utilizing the right tools and following best practices, developers can streamline their workflow and build secure and efficient smart contracts. Boosting Productivity To enhance productivity and efficiency in Solidity development, several tools can be utilized. These tools aid developers in writing clean and error-free code, debugging their contracts effectively, and automating testing processes. Here are some essential tools that can significantly boost productivity: Code Editors and IDEs Code editors and Integrated Development Environments (IDEs) play a vital role in Solidity development, providing a user-friendly interface for writing and managing code. These tools offer features such as syntax highlighting, code completion, and automatic formatting, which enhance code readability and reduce errors. Some popular code editors and IDEs for Solidity development include Remix IDE, Visual Studio Code, and Atom. Choosing the right code editor or IDE that aligns with your preferences and workflow can greatly improve development efficiency. Integrated Debugging Tools Debugging is a crucial aspect of Solidity development, as it helps identify and fix errors in smart contracts. Integrated debugging tools enable developers to step through their code, inspect variables, and identify the root cause of issues. These tools provide valuable insights into contract execution, making the debugging process more efficient. Tools like Remix IDE offer built-in debugging capabilities that allow developers to set breakpoints, examine variables, and trace contract execution. Additionally, there are command-line tools like Hardhat and Truffle that provide debugging functionalities for Solidity contracts. Automated Testing Frameworks Automated testing frameworks simplify the process of testing Solidity contracts, ensuring that they function as intended and minimizing the risk of bugs and vulnerabilities. These frameworks allow developers to write test cases and execute them automatically, providing confidence in the reliability of their contracts. Frameworks like Truffle and Hardhat offer robust testing capabilities, including the ability to write unit tests, integration tests, and even simulate complex scenarios. These frameworks can also integrate with popular testing libraries such as Mocha and Chai, making it easier to write comprehensive tests for Solidity contracts. By leveraging code editors and IDEs, integrated debugging tools, and automated testing frameworks, Solidity developers can significantly enhance their productivity and efficiency. These tools streamline the development process, improve code quality, and ensure the reliability of smart contracts. It is crucial to stay updated with the latest features and improvements of these tools and leverage the support and resources provided by the Solidity community. Enhancing Efficiency When it comes to solidity development, enhancing efficiency is key to streamlining the process and ensuring the delivery of high-quality smart contracts. This section highlights three important tools that can help achieve this goal: gas optimization tools, security auditing tools, and documentation generators. Gas Optimization Tools Gas optimization is a critical aspect of solidity development as it directly impacts the cost and efficiency of smart contracts on the Ethereum network. Gas optimization tools assist developers in identifying and reducing gas consumption, resulting in more cost-effective and optimized contracts. These tools analyze the solidity code and provide suggestions and optimizations to minimize gas consumption. By reducing unnecessary computations, optimizing storage usage, and employing smart coding techniques, developers can significantly improve the efficiency of their smart contracts. This leads to reduced transaction costs and improved overall performance. Security Auditing Tools Security auditing is of utmost importance when developing smart contracts. Solidity, being a powerful and expressive language, requires thorough inspection to identify and mitigate potential vulnerabilities. Security auditing tools help developers assess the security of their contracts by scanning for common vulnerabilities, such as reentrancy attacks, integer overflows, and unauthorized access. These tools can perform static analysis on the solidity code, identify potential security flaws, and suggest remediation strategies. By conducting comprehensive security audits using these tools, developers can ensure the integrity and robustness of their smart contracts, protecting them from potential exploits and vulnerabilities. Documentation Generators Clear and comprehensive documentation is essential for effective collaboration and maintenance of solidity projects. Documentation generators simplify the process of creating well-structured and easily accessible documentation for smart contracts. These tools automatically extract information from the solidity code, such as function signatures, descriptions, and event definitions, and generate documentation in various formats, including HTML and Markdown. By utilizing documentation generators, developers can ensure that their smart contracts are well-documented, making it easier for other developers to understand and interact with the codebase. This improves collaboration, reduces the learning curve, and facilitates the overall maintenance and evolution of solidity projects. Enhancing efficiency in solidity development requires leveraging the power of these tools. Gas optimization tools optimize the cost and performance of smart contracts, security auditing tools ensure the robustness and security of the codebase, and documentation generators facilitate collaboration and maintenance. By incorporating these tools into the development workflow, developers can boost productivity and efficiency while delivering high-quality smart contracts. Exploring Solidity Development Tools To enhance productivity and efficiency in Solidity development, it’s crucial to leverage the right tools. Let’s explore some popular Solidity development tools that can streamline the development process and facilitate smart contract creation. Truffle Suite Truffle Suite is a comprehensive development framework that provides a suite of tools to aid in Solidity development. It includes Truffle, a development environment, Ganache, a personal blockchain for local development and testing, and Drizzle, a collection of front-end libraries for building dApps. Truffle simplifies many aspects of smart contract development, including project creation, compilation, testing, and deployment. It also offers built-in support for various testing frameworks, such as Mocha and Chai. Truffle’s versatility and ease of use make it a popular choice among Solidity developers. Remix IDE Remix IDE is a web-based integrated development environment specifically designed for Solidity development. It provides a user-friendly interface and comprehensive features for writing, testing, and deploying smart contracts. Remix IDE supports various compilers, including the Solidity compiler, enabling developers to write and compile their code directly in the browser. With Remix IDE, developers can efficiently debug their Solidity contracts, inspect variables, and execute transactions in a simulated environment. It also offers plugins and extensions to enhance functionality and integration with other tools. Check out our tutorial on using Remix IDE for Solidity debugging for more information. Ganache Ganache, part of the Truffle Suite, is a personal blockchain for local development and testing purposes. It provides a simulated Ethereum network environment that allows developers to deploy and test their smart contracts without incurring any gas costs. Ganache offers a user-friendly interface and supports features such as contract deployment, transaction simulation, and account management. By using Ganache, developers can quickly iterate and test their contracts in a controlled environment. It provides flexibility and customization options, allowing developers to simulate various scenarios, such as network congestion and different gas price configurations. Ganache is a valuable tool for Solidity developers aiming to ensure the stability and reliability of their smart contracts. MythX MythX is a security analysis platform for Ethereum smart contracts. It performs comprehensive security audits by using a combination of static analysis and symbolic execution techniques. MythX helps identify common vulnerabilities and potential security risks in Solidity code, allowing developers to address them before deploying their contracts. By integrating MythX into the development workflow, developers can proactively reduce the chances of security breaches and vulnerabilities. It provides detailed analysis reports and offers guidance on how to fix identified issues. To learn more about security audits in Solidity development, check out our article on the importance of security audits in Solidity development. These Solidity development tools are just a few examples of the wide range of options available to developers. It’s essential to choose the tools that best fit your specific requirements and project needs. By leveraging the right tools, developers can streamline the development process, improve productivity, and ensure the reliability and security of their smart contracts. Best Practices for Using Solidity Development Tools To make the most out of Solidity development tools and ensure a seamless development process, it is important to follow some best practices. By incorporating these practices into your workflow, you can enhance productivity and efficiency. Here are some key practices to consider: Regularly Update and Maintain Tools Solidity development tools are constantly evolving, with new features and improvements being introduced regularly. It is important to regularly update and maintain these tools to take advantage of the latest enhancements and bug fixes. Keeping your tools up to date ensures that you have access to the most efficient and secure functionalities. Stay informed about updates by visiting the official websites or subscribing to the relevant developer communities. Stay Informed About New Tools and Updates The world of Solidity development is dynamic, with new tools and updates being introduced frequently. To stay ahead of the curve, it is crucial to actively seek information about emerging tools and updates. Stay informed through online forums, developer communities, and blogs that focus on Solidity development. By staying up to date, you can explore new tools that may enhance your productivity and efficiency. Leverage Community Support and Resources The Solidity development community is vibrant and knowledgeable, offering a wealth of support and resources. Leverage community support and resources by participating in online forums, attending developer conferences, and engaging with fellow developers. These communities are a valuable source of information, offering insights, best practices, and troubleshooting assistance. By tapping into the collective knowledge and experience of the community, you can accelerate your learning and problem-solving process. By following these best practices, you can optimize your experience with Solidity development tools. Remember to update and maintain your tools regularly to benefit from the latest features and improvements. Stay informed about new tools and updates to explore opportunities for enhanced productivity and efficiency. Lastly, leverage the support and resources available within the Solidity development community to further expand your knowledge and skills. For more in-depth information on debugging Solidity contracts and security audits, check out our related articles on debugging Solidity contracts: best tools and practices and the importance of security audits in Solidity development.	ESSENTIALAI-STEM
Cognitive decline in older adults in the UK during and after the COVID-19 pandemic: a longitudinal analysis of PROTECT study data The study, “Cognitive decline in older adults in the UK during and after the COVID-19 pandemic: a longitudinal analysis of PROTECT study data” provides critical insights into the cognitive impacts of the COVID-19 pandemic on older adults. Here’s a detailed summary: Background and Methodology: • The study, using data from the PROTECT study, investigated the long-term health effects of COVID-19, focusing on cognitive and mental health impacts due to pandemic-related societal restrictions. • It involved 3,142 participants aged 50 and older in the UK. Data were collected before the pandemic (March 2019-Feb 2020), during its first year (March 2020-Feb 2021), and second year (March 2021-Feb 2022). • Cognitive function was assessed in different time periods using a linear mixed-effects model, with a focus on executive function and working memory. Key Findings: • A significant decline in executive function and working memory was observed during the first year of the pandemic across the whole cohort, with sustained worsening of working memory in the second year. • For participants with mild cognitive impairment and those who had a history of COVID-19, the decline was significant in both executive function and working memory, persisting into the second year of the pandemic. • The study identified decreased exercise and increased alcohol use as significant factors associated with cognitive decline. These associations persisted in the second year of the pandemic, along with the impact of loneliness and depression, especially in those with mild cognitive impairment and a history of COVID-19. Interpretation and Implications: • The study highlights the need for public health interventions to mitigate dementia risk, particularly in people with mild cognitive impairment, who are at a substantial risk of conversion to dementia within five years. • For individuals with a history of COVID-19, long-term interventions should be considered to support cognitive health. • The findings suggest that lifestyle changes during the pandemic, such as reduced exercise, increased alcohol consumption, and the psychological impacts of loneliness and depression, contributed to the observed cognitive decline. • The implications are significant for public health, emphasizing the need to incorporate measures to support cognitive health in planning for future pandemics and in the long-term care of people affected by COVID-19. In conclusion, this study provides compelling evidence of the COVID-19 pandemic’s adverse effects on cognitive health in older adults. It underscores the importance of addressing lifestyle and mental health factors to support cognitive well-being during and after such global health crises. Read More: https://www.thelancet.com/journals/lanhl/article/PIIS2666-7568(23)00187-3/fulltext Leave a comment	ESSENTIALAI-STEM
Page:Visions and Prophecies of Zechariah (Baron, David).djvu/145 himself unfit to be again Jehovah's sanctuary and appointed minister of blessing to the nations? As if in answer to this question, the vision in the 3rd chapter is shown to the prophet, from which he is to learn (i) that the fulfilment of "the good words and comfortable words " of promise, rests, not on Israel's merits or worthi ness, but on the immutable purpose of Jehovah, Who, in His free sovereign grace, hath " chosen Jerusalem," and Whose gifts and calling are without repentance. (2) The solution of the moral problem, how the Holy One can dwell in the midst, and accept and use the ministry of those who are defiled by sin, is realistically presented to the prophet in the transformation which he witnesses as taking place in the case of Joshua, who stands before the Angel of Jehovah, not in his private capacity, but as the high priest and representative of the people. Like the filthy garments in which their representative had been clothed, so shall the Lord remove the moral filth of the daughter of Zion, and cause her iniquity to pass away in that " one day " when her eyes shall be opened to behold the glorious Person and atoning work of her Messiah, who, in allusion to the prophecies in the second half of Isaiah (especially chap, liii.), is called " My Servant," and also by the well-known Messianic title, " The Branch" (Hi. 8). Thus, clothed in the righteousness of Him, Who " by His knowledge makes the many righteous," and arrayed in the " rich apparel," or festal attire of priestly garments, with the high-priestly mitre, to which was fastened the plate of gold with Qodesh la- Yehovah on his head, Israel shall be fitted, not only for fellowship with Jehovah, but to go forth on the mission for which he was originally chosen and destined, namely, to disseminate the truth and the blessings of Jehovah among the nations. Now, in beautiful order of sequence we have the vision in chap, iv., which presents to us Israel as the Light of the world.	WIKI
The Annals of Statistics Conditions for the Equivalence of Optimality Criteria in Dynamic Programming James Flynn Full-text: Open access Abstract This paper examines the relationships between optimality criteria which are commonly used for undiscounted, discrete-time, countable state Markovian decision models. One approach, due to Blackwell, is to maximize the expected discounted total return as the discount factor approaches 1. Another, due to Veinott, is to maximize the Cesaro means of the finite horizon expected returns as the horizon tends to infinity. Derman's is to maximize the long-run average gain. Denardo, Miller and Lippman showed that Blackwell's and Veinott's approaches are equivalent for finite state and action spaces. As shown here, that equivalence breaks down when the state space is countable. Also, policies optimal according to Blackwell's or Veinott's approach need not be optimal according to Derman's. On the positive side, fairly weak conditions are given under which Blackwell's and Veinott's criteria imply Derman's, and somewhat stronger conditions under which Blackwell's and Veinott's criteria are equivalent. Article information Source Ann. Statist., Volume 4, Number 5 (1976), 936-953. Dates First available in Project Euclid: 12 April 2007 Permanent link to this document https://projecteuclid.org/euclid.aos/1176343590 Digital Object Identifier doi:10.1214/aos/1176343590 Mathematical Reviews number (MathSciNet) MR429138 Zentralblatt MATH identifier 0351.93038 JSTOR links.jstor.org Subjects Primary: 49C15 Secondary: 62L99: None of the above, but in this section 90C40: Markov and semi-Markov decision processes 93C55: Discrete-time systems 60J10: Markov chains (discrete-time Markov processes on discrete state spaces) 60J20: Applications of Markov chains and discrete-time Markov processes on general state spaces (social mobility, learning theory, industrial processes, etc.) [See also 90B30, 91D10, 91D35, 91E40] Keywords Dynamic programming Markovian decision process optimality criteria average overtaking criteria average gain discounting small interest rates Citation Flynn, James. Conditions for the Equivalence of Optimality Criteria in Dynamic Programming. Ann. Statist. 4 (1976), no. 5, 936--953. doi:10.1214/aos/1176343590. https://projecteuclid.org/euclid.aos/1176343590 Export citation	ESSENTIALAI-STEM
1994 British Open The 1994 British Open was a professional ranking snooker tournament, that was held from 30 March to 7 April 1994 at the Plymouth Pavilions, Plymouth, England. Ronnie O'Sullivan won the tournament by defeating James Wattana 9–4 in the final. The defending champion Steve Davis was defeated in the semi-final by Wattana. There were three notable factors in this year's tournament: There was no title sponsor, there was a new venue, and there was no TV coverage after 14 years of being shown on ITV.	WIKI
Ernesto Hintze Ribeiro Ernesto Rodolfo Hintze Ribeiro (Ponta Delgada, Azores, 7 November 1849 – Lisbon, 1 August 1907) was a Portuguese politician, statesman, and nobleman from the Azores, who served as Prime Minister of Portugal three times, during King Carlos I's reign. A member of the Regenerator Party, Hintze Ribeiro's reforms in forestry, pharmacy, and autonomy for insular Portugal are the basis of these fields' policies today. Career He was a prominent parliamentarian and Peer of the Realm, Attorney-General of the Crown, Minister of Public Works, of Finance and Foreign Affairs as well as uncontested leader of the Regenerator Party, holding the position of President of the Council of Ministers (Prime Minister) thrice (22 February 1893 – 5 February 1897, 26 July 1900 – 20 October 1904 and 19 March 1906 – 19 May 1906). He was one of the dominant politicians of the final part of the Portuguese Constitutional Monarchy, occupying the post of Prime Minister longer than any other in his time. He was responsible for important reforms - some of which are still valid - such as the insular autonomy for the Azores and Madeira islands (1895), the pharmacies' law, and forest's law (1901). He was made effective Councillor of State in 1891, received many decorations, among them the Great-Cross of the Order of the Tower and Sword. He was associate of the Royal Academy of Sciences. A street in Ponta Delgada has been named in his honor.	WIKI
Research & Teaching Faculty How do chemical denaturants affect the mechanical folding and unfolding of proteins? TitleHow do chemical denaturants affect the mechanical folding and unfolding of proteins? Publication TypeJournal Article Year of Publication2008 AuthorsCao, Y, Li, H JournalJournal of Molecular Biology Volume375 Pagination316-324 Date PublishedJan ISBN Number0022-2836 Abstract We present the first single-molecule atomic force microscopy study on the effect of chemical denaturants on the mechanical folding/Unfolding kinetics of a small protein GB1 (the B1 immunoglobulin-binding domain of protein G from Streptococcus). Upon increasing the concentration of the chemical denaturant guanidinium chloride (GdmCl), we observed a systematic decrease in the mechanical stability of GB1, indicating the softening effect of the chemical denaturant on the mechanical stability of proteins. This mechanical softening effect originates from the reduced free-energy barrier between the folded state and the unfolding transition state, which decreases linearly as a function of the denaturant concentration. Chemical denaturants, however, do not alter the mechanical unfolding pathway or shift the position of the transition state for mechanical unfolding. We also found that the folding rate constant of GB1 is slowed down by GdmCl in mechanical folding experiments. By combining the mechanical folding/unfolding kinetics of GB1 in GdmCl solution, we developed the "mechanical chevron plot" as a general tool to understand how chemical denaturants influence the mechanical folding/unfolding kinetics and free-energy diagram in a quantitative fashion. This study demonstrates great potential in combining chemical denaturation with single-molecule atomic force microscopy techniques to reveal invaluable information on the energy landscape underlying protein folding/unfolding reactions. (c) 2007 Elsevier Ltd. All rights reserved. URL<Go to ISI>://000252002100025	ESSENTIALAI-STEM
Newt Gingrich, as speaker, did preside over a period in which the number and total cost of earmarks spiraled upward. Debate Fact Check: Gingrich and Earmarks Earlier in Arizona the debate, three of the Republicans – Newt Gingrich, Rick Santorum and Mitt Romney — jousted as they often do on the subject of earmarks, which are spending items that members of Congress insert in the annual appropriations bills to benefit a particular project or program benefitting constituents or supporters. Mr. Romney has criticized both of his rivals for their use of earmarks when each was in Congress. As the moderator, CNN’s John King, indicated, earmarked spending has always been a miniscule piece of federal spending – typically less than 1 percent.	NEWS-MULTISOURCE
ex aequo et bono Phrase * 1) according to what is right and good - rather than according to the law	WIKI
ElenaDBA ElenaDBA - 2 months ago 14 AngularJS Question AngularJS posting data to DB - data gets entered but error is shown I am inserting data into the database from AngularJS application. I create a data object and fill it with data then call post request. I get an error Failed to load resource: the server responded with a status of 500 (Internal Server Error) but meanwhile the data does get entered into the database. Not sure why this is happening and what is going on var inputData = { "EntryDate": $filter('date')(curdate, 'yyyy/MM/dd hh:mm:ss'), "Field1": $scope.$parent.field1, "Field2": $scope.$parent.field2, "SortOrder":1 }; var config = { method: "POST", url: window.baseApiUrl + '/PostEntry', data: inputData }; $http(config). then(function (data, status, header) { $scope.result = "Success" console.log($scope.result); }, function errorCallback(xhr) { //print error to console. console.log(header.responseText); $scope.result = header.responseText; }); Answer Do you have access to the server code? Any chance it is erroring while executing an operatoon after the "write to DB" action is done? Maybe while formatting the response?	ESSENTIALAI-STEM
Talk:The Midnight Bell No source No public domain original text yet known (internet archive only has a 1989 edition), the presentation is inspired by the current outlay for The Mysteries of Udolpho Ostrea (talk) 16:33, 24 March 2024 (UTC)	WIKI
(416) 800-5050 When plumbing issues are ignored or simply fixed with a temporary, do-it-yourself solution, the issues are only temporarily subdued. More expensive and dangerous problem may arise in the future (often sooner rather than later). What is that SMELL? If you are in your living room or basement, and you sometimes smell a rotting stench or something that resembles a sewage drain, then you have problem that needs attention. The gas you are smelling is most likely hydrogen sulfide, which is a type of sewer gas that is typically vented out of the building with a properly operating plumbing system. How Sewage Smell Can Harm You Even if the smell comes and goes, it can still be dangerous to your health. Call a licensed plumber to inspect and fix the problem. Prolonged exposure to this type of gas, even in small amounts, can cause serious health problems including: • Functioning Problems like Head Aches, Fatigue, Irritability, Dizziness, & Memory Loss • Sicknesses such as Sinus Infections, Bronchitis, and Pneumonia What Could Cause Sewage Smell In My Home? Problems can range from a small issue such as dried out water seal in the floor drain or a lack of vents or traps in your system; to a bigger problem like a clogged or broken pipe that is affecting your plumbing system to a point where it is allowing this sewer gas to leak into your home. Regardless the severity of the problem at the moment you notice it, over time the issue will continue to grow until your home has extremely expensive damage, or your loved ones are afflicted with a severe medical issue caused by the toxic sewer gas. As Soon As You Smell Sewage, Wrench It Up! Even if you think you only smell the sewer gas once in your home, your body can quickly become desensitized to the smell. The sewer gas will still be present, even though you can no longer sense it. Over a long period of time, your plumbing problem will become worse, and you will reach a point in time when you wished you had called a plumber when you first noticed the problem. Contact Wrench It Up so we can inspect any plumbing issue that you may have. We’ll give you an informative assessment of your situation, and our fully licensed and experienced plumbers will provide immaculate service at an affordable price. Our goal is to ensure your plumbing is working properly so that you are comfortable, healthy, and safe within your home.	ESSENTIALAI-STEM
Ivan Sidorovich Lazarenko Ivan Sidorovich Lazarenko (Иван Сидорович Лазаренко; 8 October 1895 – 26 June 1944) was a Red Army major general and a posthumous Hero of the Soviet Union. From 1940 to 1941 he was the commander of the 42nd Rifle Division. After his division was destroyed near Brest, Belarus, during the German invasion of the Soviet Union (see also Defense of Brest Fortress), in 1941 he was court-martialed and condemned to death, but the sentence was canceled. In 1943 he became the commander of the 369th Rifle Division; he was killed in action in 1944. Lazarenko was posthumously awarded the title Hero of the Soviet Union for his leadership of the division in the Mogilev Offensive. Early life and World War I Lazarenko was born on 8 October 1895 in the stanitsa of Staromikhailovka in the Labinsky Otdel of Kuban Oblast (now Mikhailovka, Kurganinsky District, Krasnodar Krai) to a peasant family. After graduating from seven grades at a gymnasium, he worked as a miner. During World War I, Lazarenko was mobilized into the Imperial Russian Army's 5th Amur Border Regiment on 15 May 1915. In September, he was sent to the 107th Severotroitsk Cavalry Regiment, fighting on the Western Front. There, Lazarenko graduated from the regiment's training unit. He was awarded four Crosses of St. George for his actions on the Southwestern Front, making him a Full Cavalier of St. George. During the Povolzhye famine of 1921, Lazarenko donated his crosses for famine relief. For his actions, he was promoted to senior unteroffizier and later wachtmeister, and given command of a platoon for 1.5 years, in addition to carrying the regimental flag for five months. Russian Civil War On 27 September 1917, due to illness, Lazarenko was evacuated from the front to Moscow, and from there was sent to the 3rd Machine Gun Regiment in Saratov, where he joined a Red Guard detachment on 12 October. For participating in a demonstration, he was arrested on 20 October, but after the Bolsheviks seized power in Saratov on 27 October Lazarenko was released and appointed a platoon commander in the detachment. With the detachment, he fought in battles with the Ural Cossacks, who attempted to recapture the city. In December, Lazarenko was transferred to the 2nd Atamanovsky Regiment, which was disarmed by White Cossack commander Krasnov's troops in Rostov-on-Don at the end of the month. He then joined the Rostov Red Guard detachment and was made a battery commander, fighting in battles against Krasnov's troops. Lazarenko transferred to become a squadron commander in a detachment led by Rudolf Sivers during battles with White troops at Novorossiysk and Tsaritsyn. At the end of June 1918, the detachment was converted into the Stenka Razin Cavalry Detachment, which his squadron also joined. During the summer, he fought in battles near Penza, and became detachment commander after the death of its commander at the end of July, joining the Red Army in September. Lazarenko fought in battles near Syzran and Ufa, and was concussed while fighting on the Belaya River. He was treated in military hospitals and went back into combat in January 1919 as a platoon commander in the 63rd Cavalry Regiment, fighting against Anton Denikin's troops on the Southern Front. In May, he became a machine gun squadron commander in the 1st Kuban Zlobin Regiment of Dmitry Zhloba's 1st Partisan Cavalry Brigade. Lazarenko was treated in the hospital from November to December, then was sent to the 1st Exemplary Regiment in the 1st Special Purpose Brigade, where he became a machine gun squadron commander and assistant regimental commander for line units. During his time on the Southern Front in 1919 and 1920, Lazarenko fought in battles at Lugansk, Debaltseve, Novocherkassk, Rostov-on-Don, Manych, Krasnodar, and Novorossiysk. He was wounded on 26 March 1920, and upon his recovery became a platoon commander in the 15th Don Rifle Regiment. With the unit, Lazarenko fought against Pyotr Wrangel's White army, and participated in the destruction of Colonel Fyodor Nazarov's diversionary landing force in the area of the Konstantinovskoye and Razdorskaya stanitsas. In July and August, he fought in the repulse of Sergei Ulagay's landing operation, particularly distinguishing himself in battle at the stanitsa of Stepnoy, where he captured troops of General Babiev. For his actions, Lazarenko was personally awarded the Order of the Red Banner by Lenin. In September, the regiment was merged into the 10th Rifle Regiment of the 2nd Cavalry Division's 1st Brigade, and he became a machine gun section commander, fighting in battles with Wrangel's troops in the areas of Mariupol, Bolshoy Tokmak, Melitopol, Aleksandrovskoye, and in Crimea. After the defeat of the White forces Lazarenko fought against Nestor Makhno's Revolutionary Insurrectionary Army of Ukraine in Taurida Governorate during late 1920. He joined the Communist Party of the Soviet Union in 1921, and took part in the suppression of partisan forces led by Popov, Fyodorov, and Sychyov in the Donbas and Don Oblast. Interwar period After the end of the war, the 1st Brigade became the 4th Red Banner Rifle Regiment, which later became the 9th Rifle Division's 25th Cherkassy Red Banner Rifle Regiment, with Lazarenko continuing as machine gun section commander and then commander of a machine gun company. In September 1924, he entered the Vystrel courses, graduating a year later. In October 1926, he was seconded to the Novocherkassk OGPU replacement battalion as a clerk. In March 1927, he returned to the 25th Rifle Regiment, successively serving as commander of a machine gun company, battalion, and acting regimental commander. In 1929, he graduated from the Novocherkassk Communist University. Lazarenko transferred to command the Moscow Military District's 27th Separate Territorial Rifle Battalion at Borisoglebsk in November 1931. He completed two Frunze Military Academy correspondence courses in 1934 and in 1935 graduated from reconnaissance courses in Moscow. In March 1935, he took command of the 49th Rifle Division's reconnaissance battalion. Lazarenko was sent to Spain in 1936 as a Soviet adviser to the Spanish Republican Army during the Spanish Civil War, becoming senior adviser to the commander of the 5th Corps, Colonel Juan Modesto. After returning to the Soviet Union, he became the 38th Rifle Division's assistant commander in March 1938, but transferred to command of the Karelian Fortified Region in October 1939, shortly before the Soviet Union invaded Finland, beginning the Winter War. On 31 January 1940, the 42nd Rifle Division was formed from troops stationed in the fortified region, under Lazarenko's command. He led the division during the Soviet offensive on the Karelian Isthmus in the last months of the war. Promoted to major general on 4 June, Lazarenko continued to command the 42nd after it was transferred to Brest in the Western Special Military District in early 1941, becoming part of the 4th Army. From November 1940 to May 1941, he studied at the Frunze Military Academy's Higher Academic Courses. World War II On 22 June 1941, Operation Barbarossa, the German invasion of the Soviet Union began. Under heavy artillery and air bombardment, Lazarenko managed to extricate the remnants of his division from the German assault, which encircled the remainder of the division that defended the Brest Fortress. The 42nd retreated to positions east of Brest, and after a fighting retreat exited the pocket at Bobruisk. On 4 July he was arrested, along with other Western Front commanders scapegoated for the defeats of the early days of the fighting, and was sentenced to death on 17 September. The sentence read: "despite having knowledge of the active preparations of the enemy for military operations, showing carelessness, he did not keep the troops on alert. In the first moments of the attack Lazarenko showed confusion and inaction, and, instead of taking action and repulsing the enemy, he went to the corps headquarters, leaving his units without proper guidance." On 29 September his sentence was suspended and instead changed to ten years in labor camps. Lazarenko was imprisoned in a camp in the Komi Autonomous Soviet Socialist Republic for slightly more than a year. On 21 October 1942, Lazarenko was released from prison and sent to the front as deputy commander of the 146th Rifle Division with the rank of colonel. In January 1943 he was transferred to serve in the same position with the 50th Army's 413th Rifle Division, fighting on the Western Front. The 413th fought in the Third Rzhev–Sychevka Offensive in March, Operation Kutuzov, the Smolensk–Roslavl Offensive, and the Bryansk Offensive. On 24 October, as a result of proposals from front commander Konstantin Rokossovsky, the 50th Army's military tribunal removed the criminal conviction from Lazarenko's military record. He took command of the 369th Rifle Division on 16 November, and was restored to the rank of major general in 1944. From late June 1944, Lazarenko led the division in the Mogilev Offensive, part of Operation Bagration, the Soviet strategic offensive that recaptured Belarus and eastern Poland. Between 23 and 25 June, the 369th broke through heavily fortified German defenses, and crossed the Pronya and Basya Rivers, advancing 25 kilometers and inflicting heavy casualties. On 26 June, while directing his troops in the crossing of the Resta River four kilometers west of the village of Kholmy in Chavusy Raion, Lazarenko was killed when a German artillery shell scored a direct hit on his command vehicle. Initially buried in Krichev, he was reinterred in Mogilev after its recapture on 28 June. On 21 July Lazarenko was posthumously awarded the title Hero of the Soviet Union and the Order of Lenin for his leadership of the division. Legacy A square and a street in Mogilev were named for Lazarenko. In April 2010, on the proposal of the Chief Military Prosecutor of the Russian Federation, the Military Collegium of the Supreme Court of the Russian Federation quashed the indictment of 17 September 1941, stating that it "did not correspond to the facts of the case". The court deemed Lazarenko's actions on 22 June to have been consistent with the situation and orders from the corps headquarters. Personal life Lazarenko married Polina Ivanovna and had a son, Grigory, who also fought in World War II.	WIKI
Active IQ Unified Manager Discussions Password Parameters brycedeutsche I'm trying to avoid clear text passwords in my Powershell scripts by passing them as variables from WFA where only Operators would be able to see these in the Workflow Commands, which is an improvement over having them in the scripts - however the parameters will be visible in the Execution output to Operators etc which will not do. Is there any facility in WFA to manage password variables or any variable types which when chosen are not displayed in the Execution output? 4 REPLIES 4 ag NetApp Hi, Is this the controller password you are talking about? For what purpose are you passing the passwords? Is it only for authentication? If so, You can always configure the controller passwords at execution>credentials. You can include a statement at the beginning of your command: Connect-WfaCluster -Node $Cluster // For C-mode and Connect-WfaController -Array $Array // For 7-mode That will take care of authentication abhit Hi: There is a new feature named 'password as user input' coming up in the next release, scheduled towards end of this year. With that feature, there will be another user input type known as password. Password won't be visible in clear text in the user input screen. Also it won't be logged in the log files. Is this what you are looking for? Regards Abhi brycedeutsche Hi Abhi That's exactly what I want - therefore WFA will hold the passwords and we can use the security of WFA to restrict access to the passwords. So, there's no alternative currently than encrypting the password and de-encrypting in the PS script? Bryce adaikkap Hi Bryce, For now you may add the systems as a host in under credentials and access them as a hack. Regards adai Public	ESSENTIALAI-STEM
编辑本页 A Basic Kotlin/Native Application 最近更新 2019-04-15 A look at how to compile our first Kotlin/Native application and open it in an IDE In this tutorial, we'll look at how to 获取编译器 The Kotlin/Native compiler is available for macOS, Linux, and Windows. It supports different targets including iOS (arm32, arm64, simulator x86_64), Windows (mingw32 and x86_64), Linux (x86_64, arm64, MIPS), macOS (x86_64), Raspberry PI, SMT32, WASM. For the full list of targets we can refer to the Kotlin/Native overview. While cross-platform compilation is possible (i.e., using one platform to compile for another), in this first tutorial we are only compiling for the operating system we're running on. The best way to use the Kotlin/Native compiler is with a build system. It helps by downloading and caching the Kotlin/Native compiler binaries and libraries with transitive dependencies, and running the compiler and tests. It caches the compilation results too. A build system can also be used by an IDE to understand the project layout. Kotlin/Native uses the Gradle build system through the kotlin-multiplatform plugin. We'll look at how to configure a Gradle build below. For some corner cases, a Kotlin/Native compiler can still be obtained manually (not recommended) from the Kotlin releases page on GitHub. In the tutorial, we are focusing on using the Gradle builds. While the output of the compiler does not have any dependencies or virtual machine requirements, the compiler itself and the Gradle build system require a Java 1.8 or 11 runtime. Check out the https://jdk.java.net/11 or another resource for the best JRE, OpenJDK, or JDK distribution. 创建 Hello Kotlin Our first application is simply going to print some text on the standard output. In our case, this text is "Hello Kotlin/Native". We can open up our favorite IDE or editor and write the following code in a file named hello.kt: fun main() { println("Hello Kotlin/Native!") } Compiling the code from the console To manually compile the application call the downloaded compiler and generate a hello.kexe (Linux and macOS) or hello.exe (Windows) binary file: kotlinc-native hello.kt -o hello While compilation from the console seems to be easy and clear, we should notice, that it does not scale well for bigger projects with hundreds of files and libraries. In addition to this, the command line approach does not explain to an IDE how to open such a project, where the sources are located, what dependencies are used, or how the dependencies are downloaded and so on. Creating a Kotlin/Native Gradle project The New Project wizard in IntelliJ IDEA can be used to start a new Kotlin/Native project with just one click. Check out the Kotlin section and select the Native \| Gradle option to generate the project. For a better understanding and to explain what's happening, in this tutorial we'll create the project manually. Let's first create a project folder. All the paths in this tutorial will be relative to this folder. Sometimes the missing directories will have to be created before new files are added. Gradle supports two languages for the build scripts. We have the following options: • Groovy scripts in build.gradle files • Kotlin scripts in build.gradle.kts files Groovy language is the oldest supported scripting language for Gradle, it leverages the power of the dynamic typing and runtime features of the language. Sometimes it can be harder to maintain Groovy build scripts. IDEs are struggling to get through the dynamism of Groovy to provide helpful insights or code completion. Kotlin as a statically typed programming language plays well for writing Gradle build scripts. Thanks to the static type inference, the Kotlin compiler detects errors earlier and shows important compilation error messages and warnings. Both an IDE and the compiler can use the information about types to infer the available functions and properties in a given scope. We create build.gradle build.gradle.kts Gradle build file with the following contents: plugins { id 'org.jetbrains.kotlin.multiplatform' version '1.3.21' } repositories { mavenCentral() } kotlin { macosX64("native") { binaries { executable() } } } wrapper { gradleVersion = "5.3.1" distributionType = "ALL" } plugins { id 'org.jetbrains.kotlin.multiplatform' version '1.3.21' } repositories { mavenCentral() } kotlin { linuxX64("native") { binaries { executable() } } } wrapper { gradleVersion = "5.3.1" distributionType = "ALL" } plugins { id 'org.jetbrains.kotlin.multiplatform' version '1.3.21' } repositories { mavenCentral() } kotlin { mingwX64("native") { binaries { executable() } } } wrapper { gradleVersion = "5.3.1" distributionType = "ALL" } plugins { kotlin("multiplatform") version "1.3.21" } repositories { mavenCentral() } kotlin { macosX64("native") { binaries { executable() } } } tasks.withType<Wrapper> { gradleVersion = "5.3.1" distributionType = Wrapper.DistributionType.ALL } plugins { kotlin("multiplatform") version "1.3.21" } repositories { mavenCentral() } kotlin { linuxX64("native") { binaries { executable() } } } tasks.withType<Wrapper> { gradleVersion = "5.3.1" distributionType = Wrapper.DistributionType.ALL } plugins { kotlin("multiplatform") version "1.3.21" } repositories { mavenCentral() } kotlin { mingwX64("native") { binaries { executable() } } } tasks.withType<Wrapper> { gradleVersion = "5.3.1" distributionType = Wrapper.DistributionType.ALL } The prepared project sources can be directly downloaded from GitHub. GitHub. GitHub. GitHub. GitHub. GitHub. Now need to create an empty settings.gradle.kts settings.gradle file in the project root directory. Depending on the target platform, we use different functions, e.g. macosX64, mingwX64, linuxX64, iosX64, to create the Kotlin target. The function name is the platform which we are compiling our code for. These functions optionally take the target name as a parameter, which is "native" in our case. The specified target name is used to generate the source paths and task names in the project. By the convention, all sources are located in the src/<target name>[Main\|Test]/kotlin folders. It creates main and test source sets for every target. Let's place the hello.kt we previously created into the main source set folder, which is src/nativeMain/kotlin. The nativeMain folder comes from the "native" target name, which we specified in the build script above. The project is ready. The next step is to open it in IntelliJ IDEA. For advanced build scenarios, it is recommended to refer to the more detailed documentation. Anyone wanting to continue on without an IDE, will need to download and install the Gradle build tool. Make sure to use the right version of Gradle (e.g. 5.4.1 or newer). Running the gradle wrapper command will complete the project creation. Getting Started with Gradle explains in detail how to start using Gradle projects. Opening the Project in IDE We are using IntelliJ IDEA for this tutorial. Both the free and open source IntelliJ IDEA Community Edition and IntelliJ IDEA Ultimate Edition work for this tutorial. We can download and install both of them from https://jetbrains.com/idea/download if necessary. The Kotlin plugin is included with IntelliJ IDEA by default, but still, we need to make sure the Kotlin plugin version is 1.3.31 (or newer) in the Settings or Preferences dialog, under the Language & Frameworks \| Kotlin section. At this point, we should have a Gradle project that is ready to be opened in an IDE. IntelliJ IDEA (CLion, AppCode, or AndroidStudio) helps us to generate the Gradle Wrapper scripts for our project. Now let's open the project in IntelliJ IDEA. For that we click on the File \| Open… and select our build.gradle.kts build.gradle project file. Open Project Dialog Confirm to open the file as Project. Gradle Import Dialog Select Use gradle 'wrapper' task configuration option in the Gradle import dialog to complete the import. For existing projects, which already have Gradle wrapper scripts, the Use default Gradle wrapper option should be selected instead. Use the path to the Java runtime version 1.8 or 11 for the Gradle JVM field. Check out the https://jdk.java.net/11 or https://adoptopenjdk.net/ for the best JRE, OpenJDK, or JDK distribution. Running the application Usually, a native binary can be compiled as debug with more debug information and fewer optimizations, and release where optimizations are enabled and there is no (or at least less) debug information available. The binary files are created in the build/bin/native/debugExecutable or build/bin/native/releaseExecutable folders respectively. The file has a .kexe extension on Linux and macOS and an .exe extension on Windows. Use the following command to instruct the build to produce binaries: ./gradlew build ./gradlew build gradlew.bat build It's important to understand that this is now a native application, and no runtime or virtual machine is required. We can now run the compiled binary from the console: Hello Kotlin/Native! In addition to the build tasks, the Gradle build includes helpful tasks to run the application directly via runDebugExecutableNative and runReleaseExecutableNative. The names of these tasks were created from the formula: run[Debug\|Release]Executable<target name>, where target name is the capitalized target name that we specified in the build.gradle.kts build.gradle file out of our build, "native" in our case. Let's run the task in the IDE. For that, let's open the Gradle Tool Window and find the task in the list: Gradle Import Dialog Alternatively, we may call the following command from the console: ./gradlew runDebugExecutableNative ./gradlew runDebugExecutableNative gradlew.bat runDebugExecutableNative The output should be: > Task :runDebugExecutableNative Hello Kotlin/Native! BUILD SUCCESSFUL Next Steps Kotlin/Native can be used for many targets and applications, including, but not limited to macOS, Windows, Linux, and iOS. Calling C, Objective-C, or Swift from Kotlin/Native is easy. Take a look at the C Interop documentation or Objective-C and Swift interop documentation or check out one of our tutorials. With Kotlin multiplatform projects, it is possible to share the same Kotlin code between all the supported platforms. Check out the tutorial on sharing Kotlin code between iOS and Android or have a look at how to build your own multiplatform library.	ESSENTIALAI-STEM
Skip to main content SCIENTIFIC HIGHLIGHTS 29 March 2016 defectsinceramics Jaume Gazquez,* Roger. Guzman, Rohan Mishra, Elena Bartolomé, Juan Salafranca, Cesar Magén, Maria Varela, Mariona Coll, Anna Palau, S. Manuel Valvidares, Pierluigi Gargiani, Eric Pellegrin, Javier. Herrero-Martin, Stephen J. Pennycook, Sokrates T. Pantelides, Teresa Puig, and Xavier Obradors. Adv. Sci. 2016, 1500295. DOI: 10.1002/advs.201500295 Defects in ceramic materials are generally seen as detrimental to their functionality and applicability. Yet, in some complex oxides, defects present an opportunity to enhance some of their properties or even lead to the discovery of exciting physics, particularly in the presence of strong correlations. A paradigmatic case is the high-temperature superconductor YBa2Cu3O7-δ (Y123), in which nanoscale defects play an important role as they can immobilize quantized magnetic flux vortices. Here previously unforeseen point defects buried in Y123 thin films that lead to the formation of ferromagnetic clusters embedded within the superconductor are unveiled. Aberration-corrected scanning transmission microscopy has been used for exploring, on a single unit-cell level, the structure and chemistry resulting from these complex point defects, along with density functional theory calculations, for providing new insights about their nature including an unexpected defect-driven ferromagnetism, and X-ray magnetic circular dichroism for bearing evidence of Cu magnetic moments that align ferromagnetically even below the superconducting critical temperature to form a dilute system of magnetic clusters associated with the point defects. Hits: 8977 Sustainable energy conversion & storage systems Emerging Diluted Ferromagnetism in High-Tc Superconductors Driven by Point Defect Clusters	ESSENTIALAI-STEM
Emmanuel Forbes Emmanuel Forbes Jr. (born January 13, 2001) is an American football cornerback for the Washington Commanders of the National Football League (NFL). He played college football for the Mississippi State Bulldogs and holds the FBS record for most career interceptions returned for a touchdown with six. Forbes was selected by the Commanders in the first round of the 2023 NFL draft. Early life Forbes was born on January 13, 2001, in Grenada, Mississippi. He grew up playing football in youth leagues, often as a quarterback, before attending Grenada High School, where he played football, basketball, and baseball. In football he recorded 49 tackles with eight interceptions as a cornerback, two of which were returned for touchdowns. Forbes also caught 31 passes for 499 yards and seven touchdowns as a wide receiver, and returned a punt and blocked field goal for touchdowns on special teams. Forbes was considered the second-best prospect in Mississippi's 2020 recruiting class. In December 2019, he signed a National Letter of Intent to play college football for the Bulldogs at Mississippi State University. He had also received several JUCO offers to play college baseball. College career Forbes was included on the Southeastern Conference All-Freshman team after recording 45 tackles and five interceptions, three of which were returned for a touchdown. He started every game as a sophomore in 2021, recording 59 tackles and three interceptions. He was a consensus All-American as a junior after recording six interceptions with three returned for touchdowns. Considered a ballhawk, Forbes holds the NCAA Division I Football Bowl Subdivision (FBS) record for most career interceptions returned for a touchdown with six and is fourth in Mississippi State history with 14 interceptions. He also holds school records for the longest interception return at 90 yards, doing so at the 2020 Armed Forces Bowl, and the most interception yards in a season with 183, doing so as a freshman. Professional career Forbes was selected by the Washington Commanders in the first round (16th overall) of the 2023 NFL draft. His slim weight is a common point of discussion, with him being the only cornerback drafted since 2000 to weigh under 170 pounds at the NFL Combine. He signed a fully guaranteed four-year $15.4 million contract on July 22, 2023. Forbes recorded his first career interception in his second game, a 35–33 win over the Denver Broncos. In the Week 4 loss against the Philadelphia Eagles, he was widely criticized for his poor performance covering wide receiver A. J. Brown. The following week, Forbes was benched on Thursday Night Football after multiple blown coverages against Chicago Bears wide receiver D. J. Moore. Following the benching, Forbes was downgraded on the team's depth chart and removed from the defense's starting lineup. In the first quarter of the Week 10 game, Forbes was ejected after an illegal helmet-to-helmet hit against Seattle Seahawks wide receiver Tyler Lockett. The NFL would fine Forbes for $15,563 for his Week 10 ejection. Personal life Forbes is the second-youngest of three siblings. He wears several necklaces for good luck, most featuring the Christian cross, while playing sports and performing daily activities such as showering. His father gave him his first necklace after closing a win as a pitcher in a championship baseball game. Forbes participated in a celebrity softball game at Classic Park in June 2023.	WIKI
Author: Gerhard Haering (gerhard@bigfoot.de) 0. Scope of this HOWTO ---------------------- This howto describes how to debug native win32 Python extensions with open source tools. See Appendix A for how to do this with Cygwin's Python (which is much simpler). 1. Prepare Python for development with gcc ------------------------------------------ - Install native Python: http://www.python.org/ - Install Cygwin (you'll need gcc, gdb, ...) http://www.cygwin.com/ - Get the dll2def package from http://home.trouwweb.nl/Jerry/packages.html#LIB2DEF unzip and put the executable somewhere in your path (it put such stuff in c:\opt\tools) - Open the Cygwin shell and chdir to the libs directory of your Python installation - Create a python21.def file $ dll2def c:/winnt/system32/python21.dll >python21.def (Adjust the path to the python dll if you use Windows 9x or don't have your OS installed in c:/winnt) - Create a libpython21.a file $ dlltool --dllname python21.dll --def python21.def --output-lib \ libpython21.a - Create a fake debugging environment for distutils (the debugging files download from python.org is of no use, because Cygwin gdb cannot understand the debugger symbol format used by Visual C++, which is used by the Python crew to build the native win32 Python). $ cp libpython21.a libpython21_d.a - Steps to make your life easier: -- Put the directory of the native Python in your PATH. -- Copy the native python.exe to something like ntpython.exe to avoid confusion with Cygwin's Python 2. Write the extension module ----------------------------- Here's a buggy extension module: /* BEGIN FILE crash.c **********************************************/ #include "Python.h" PyObject crash() { char* s = "test!"; s[0] = 'T'; /* This is asking for trouble :-) / Py_INCREF(Py_None); return Py_None; } static PyMethodDef crashMethods[] = { {"crash", (PyCFunction)crash, NULL, NULL}, {NULL, NULL} }; DL_EXPORT(void) initcrash(void) { PyObject m; m = Py_InitModule("crash", crashMethods); } /* END FILE crash.c ************************************************/ And the setup.py file to build it: ###### BEGIN setup.py ############################################### import sys from distutils.core import setup from distutils.extension import Extension setup ( name = "crash", ext_modules = [Extension( name="crash", sources = [ "crash.c" ] )], ) ###### END setup.py --############################################### 3. Build and debug the extension module --------------------------------------- $ ntpython setup.py build --compiler=mingw32 --debug $ cd build/lib.win32-2.1/ $ mv crash_d.pyd crash.pyd # workaround for distutils $ gdb ntpython - Run the application in gdb - Then: Python 2.1.1 (#20, Jul 20 2001, 01:19:29) [MSC 32 bit (Intel)] on win32 Type "copyright", "credits" or "license" for more information. >>> import crash >>> crash.crash() - Gdb will point out where the segmentation fault happened APPENDIX A ---------- How to debug Python extensions on Cygwin. - You'll need Cygwin installed (the full development environment, including gcc, gdb, python, ...) - write a setup.py file (see above) - compile the extension with debugging options: $ python setup.py build --debug - $ cd build/lib.cygwin_nt-5.0-1.3.1-i686-2.1 - $ gdb python - Run the application - "import crash" - "crash.crash()" APPENDIX B ---------- Unresolved issues: - How to set breakpoints in extension modules	ESSENTIALAI-STEM
Churches in Sycamore Historic District As of 2007 there are five church buildings in the Sycamore Historic District, located in Sycamore, Illinois, United States which are listed as contributing properties to the district. The Sycamore Historic District was added to the U.S. National Register of Historic Places on May 2, 1978. When it was nominated to join the National Register there were seven church buildings within the district. One of those included is a residential structure that was utilized as a church when it was first constructed; the Arthur Stark House was once home to the Sycamore Universalist Church congregation. In the time since its listing, two churches have been destroyed or demolished. The Evangelical Lutheran Church of St. John was destroyed by fire in 2004 and the United Methodist Church in Sycamore is no longer extant, replaced by a modern office building. Evangelical Lutheran Church of St. John The Evangelical Lutheran Church of St. John formerly stood on Main Street in the Sycamore Historic District until it was "totally destroyed" by fire in February 2004. The 1937-38 building was one of the most notable structures within the historic district. Even as the church burned it made its mark on history. The fire's resulting backdraft caused an explosion and is the largest recorded backdraft incident in United States history. Two Sycamore firefighters were injured in the blaze. In addition to the destroyed St. John's church the Sycamore United Methodist Church, listed as a contributing property to the historic district in 1978 no longer exists. The area along Somonauk Street where it once stood now houses an office building. First Baptist Church The First Baptist Church in Sycamore, Illinois is within the boundaries of the Sycamore Historic District and considered a contributing property to the historic district. As of 2007 the old First Baptist Church building was occupied by the Bethel Assembly of God. The First Baptist Church's congregation was founded in 1852. In their early years they met in Franklin Township and then, later at Sycamore's schoolhouse and in the DeKalb County Courthouse. Finally the church decided it needed a permanent building. The First Baptist Church building, erected in 1899, stands at the corner of Maple and Elm Streets in Sycamore, on a lot that was originally purchased from local citizen Hosea Willard. Built in the Gothic Revival style the church features prominently arched windows. On both the west and south facades it feature large stained glass windows. St. Mary's Roman Catholic Church St. Mary's Roman Catholic Church in Sycamore, Illinois is considered a contributing structure to the historic integrity of the district and is one of seven Sycamore churches that were integral parts of the historic district when it was nominated for the National Register of Historic Places. St. Peter's Episcopal Church The Sycamore, Illinois St. Peter's Episcopal Church is listed as another contributing structure to the overall historic integrity of the Sycamore Historic District. The historic district was designated in 1978 when it joined the National Register of Historic Places. The church building was designed by Chicago architect George O. Garnsey. It was erected in 1878 and consecrated in 1879 as a memorial to its primary benefactor Sycamore businessman James Waterman. Waterman paid the entire $17,000 construction cost himself. The building is said to be the oldest church in DeKalb County. Constructed from Batavia stone the building's distinctive architectural integrity has been maintained through the years. It still features original walnut pews and stained glass. Old Congregational Church Old Congregational Church, also known as Sycamore Baptist Church or First Congregational Church, is located at the corner of High and Somonauk Streets in Sycamore, Illinois. The building, erected in 1884, was designed by Chicago architect George O. Garnsey. Garnsey designed several prominent structure in Sycamore and DeKalb, including the Ellwood House and the David Syme House. The plans for the church appeared in Garnsey's planbook journal, National Builder, at about the same time the building was constructed. After a 1978 lightning strike the building's main steeple underwent a renovation. Early church documents record members as staunchly abolitionists, having participated in the Underground Railroad as early as 1844. The building is designed in Victorian Gothic motif and its exterior is clad in stone. Universalist Church/Arthur Stark House The Universalist Church/Arthur Stark House is a residential structure in the DeKalb County, Illinois city of Sycamore. It is a contributing structure to the overall historic integrity of the Sycamore Historic District. This two-story Italianate home was constructed in 1855. Early in its history it served as the Universalist Church. Later, it was purchased by Arthur Stark, for whom it served as a residence. Alonzo Ellwood, another member of the famed Ellwood family, was an original trustee for the Universalist Church, which once occupied this house. Before the Civil War the Universalist congregation was active in the abolitionist movement. Arthur Stark turned the building into a livable home after the Universalist Church relocated. He remodeled the house adhering to the Italianate architecture in his remodel. Stark worked as secretary at Marsh Harvester, an important and early Sycamore industry.	WIKI
How To Loop Through XML in JavaScript When dealing with XML documents, a situation may arise where we need to parse and iterate through various text elements. Unfortunately, as a markup language, XML is quite unintuitive to iterate through. This mainly due to the text in each element being a node that needs to be traversed through. <name>Tommy Vercetti</name> So, how can you loop through XML in JavaScript? Well, we can traverse into the text node of each element to extract the text data in the following order: • Traverse into the XML text node • Create a text node with the text data in the DOM const getResponseXML = async () => { // retrieve XML }; // get XML const xml = await getResponseXML; // get users const names = xml.getElementsByTagName("name"); for (var i = 0; i < names.length; i++) { var name = names[i].firstChild.nodeValue; var div = document.createElement("div"); var textNode = document.createTextNode(name); div.appendChild(textNode); document.getElementById("wrapper").appendChild(div); } Lets breakdown what happens here: 1. Find element by tag name name 2. Loop through each name XML element 3. For each element, get the inner nodeValue which will give back the text 4. Create a new DOM node using createTextNode 5. Append this node to the DOM While XML isn’t particularly friendly to traverse through, it’s quite manageable using these steps. Additionally, if you are looking to test this method out with sample XML data. You can try the following snippet in your debugger tool: const getUsers = (xml) => { // get users const names = xml.getElementsByTagName("from"); for (var i = 0; i < names.length; i++) { var name = names[i].firstChild.nodeValue; var div = document.createElement("div"); var textNode = document.createTextNode(name); document.getElementById("wrapper").appendChild(div); } }; const getResponseXML = async () => { // get XML // retrieve XML const xml = await fetch("https://www.w3schools.com/xml/note.xml"); const parsedXML = await xml.text(); console.log(new window.DOMParser().parseFromString(parsedXML, "text/xml")); getUsers(new window.DOMParser().parseFromString(parsedXML, "text/xml")); }; getResponseXML(); Gareth Dunne Senior JavaScript Engineer and creator of JSdiaries. Passionate about the latest in web technologies and how it can provide value for my clients.	ESSENTIALAI-STEM
[swift-evolution] Pitch: Copy constructors for structs Charles Srstka cocoadev at charlessoft.com Wed Dec 23 15:03:34 CST 2015 Introduction: This is a request for a copy constructor mechanism for structs in Swift. Motivation: Suppose you have a class stored inside a struct, like so: class C { func copy() -> C { … } } struct S { var i: Int var c: C } and you create a couple of the structs, like so: let c = C() let foo = S(i: 1, c: c) var bar = foo bar.i = 2 Since the ‘bar’ variable was mutated, it now contains a copy of the original ‘foo’ struct. However, both structs still carry the same pointer to ‘c'. There may be cases where you would want a copy of the struct to make a copy of any reference types stored within; however, that does not seem to be possible currently. Proposed Solution: Adding a copy constructor to S that would be called when a copy of the struct is about to be made. This constructor would simply create a new instance, initialize it, and return it. The copy constructor would look like this: struct S { var i: Int var c: C copy { return S(i: self.i, c: self.c.copy()) } } Structs that do not implement the copy constructor would get the same behavior as they do currently. Impact on Existing Code: There should be no impact on existing code that does not implement the copy constructor. Charles More information about the swift-evolution mailing list	ESSENTIALAI-STEM
Theodor Marsson Theodor Friedrich Marsson (8 November 1816 – 5 February 1892) was a German pharmacist and botanist. Marsson was born in Wolgast, Prussian Pomerania, just a year after the Swedish Empire had de-occupied the city, which had been under Swedish control since the Thirty Years' War. He was father-in-law to physiologist Leonard Landois (1837–1902). The son of a pharmacist, he studied chemistry under Justus von Liebig (1803–1873) at the University of Giessen. After completing his studies he took charge of the pharmacy in his hometown of Wolgast. In 1840 he provided necessary information towards the publication of Wilhelm Ludwig Ewald Schmidt's Flora von Pommern und Rügen (Flora of Pomerania and Rügen). In 1856 he was awarded an honorary PhD from the University of Greifswald. In 1869 he published a botanical study on Neuvorpommern and the islands of Usedom and Rügen titled Flora von Neuvorpommern und den Inseln Usedom und Rügen. Around 1870 he sold the pharmacy in Wolgast and retired to private life in Greifswald, later relocating to Berlin. In retirement he turned to microscopical research, making contributions in the field of palaeontology. On the basis of fossils found in chalk deposits at Rügen he composed works on foraminifera (1878), ostracods and cirripedes (1880). In 1887 he published a highly regarded work titled Die Bryozoen der weissen Schreibkreide der Insel Rügen (Bryozoa of the white chalk of Rügen). Marsson's last scientific activity dealt with living organisms, involving microscopic research of diatoms. The mycological genus Marssonina was named after him by Paul Wilhelm Magnus, in 1906. Then in 1965, botanist Petrak published Cyclomarsonina (a fungus, in family Ascomycota).	WIKI
3 I have gone through Ken Thompson's compiler hack paper; can't we just go through the compiler's source code and check for any backdoor, what was the article's point? Can we be sure that there are no backdoors if we check the language's latest source code like Python or PHP? 6 No, because the source you can see doesn't necessarily match up with the binary you're using. The specific attack described in that paper involves multiple compiler source versions: there is a malicious one, which contains the code to inject backdoors into anything compiled using this compiler, and a clean one, which doesn't contain this code. The attacker first compiles the malicious version, generating a compiler which inserts a backdoor into any future builds of the compiler. They then compile the clean version, using the malicious compiler. The output of this is now also malicious, even though the source code was clean - the source and binary no longer match up, but checking that is difficult. You would need to reverse engineer the binary, looking for malicious commands. The added complexity here is that if the reverse engineering tools were compiled with a malicious compiler, they could well hide the additional functionality in the binary when used. So, an option might be to use reverse engineering tools from a completely different machine, compiled with a different version of the compiler. However, it's entirely possible that the different machine's compiler is also malicious, depending on when the original backdoor was made. For example, if they both run the same OS, they may well have the same compiler built in, which is compromised on both devices. If they don't, there may be earlier versions which were bootstrapped from a compromised compiler, or cross-compiled from a different OS which had a compromised compiler. The only way to be sure that the whole chain is uncompromised is to manually build a binary which the processor can run, then incrementally improve this to allow extra features: you can't rely on any third party software (the text editor might insert malicious code, then hide it from view when you look at the source code, the shell might hide the file sizes of modified source files, etc...). In fact, you can't even rely on third-party hardware - the CPU might backdoor anything that looks like a compiler being built, or the RAM, or the motherboard, or the network adaptor, or any other point on the network where the compiler code or binary passed through... Now, this is getting a bit paranoid, but in each case, as soon as there is a distinction between what source is written and what actually runs, you can't be 100% sure that the source you see and the binary that runs match up. Note that this doesn't mean the hack has happened, but suggests that there is no way we could verify if it had without building a computer from scratch and using that to verify everything - from scratch in this case means from raw materials, for absolute certainty, without using anything which could influence the output. A hammer is probably ok, but a CNC device might be malicious, or a fab plant, or those wires, or... puts on tin-foil hat, then realises it was made by someone else who might be compromised • So the issue of not having complete trust would always persist irrespective of the language, right? The paper was published using a lower level language like C, this would persist even on the latest powerful languages like python, isn't it? – user9355495 Feb 6 at 11:58 • Yep. Applies to interpreted languages too - at some point, there has been a compiler used to make the interpreter. Even applies to things like compcert.inria.fr which try to verify correctness and conformance to the input source. You can't be absolutely sure that the output isn't lying. – Matthew Feb 6 at 12:03 5 can't we just go through the compiler's source code and check for any backdoor, what was the article's point? The whole point of the article is that can't do that because the backdoor is not in the compiler's source code. Thompson explains this in various steps: 1. You put a backdoor in the source code of the login program. Obviously, when you examine the source code of login, you will find this backdoor. 2. Instead, you put some piece of code into the source code of the compiler, so that when it compiles the login program, it will insert this backdoor. Now, the backdoor does not show up anywhere in the source code of login. Obviously, when you examine the source code of the compiler, you will find this meta-backdoor. 3. Instead, you put some piece of code into the source code of the compiler that was used to compile the other compiler, so that when it compiles the compiler, it will insert the meta-backdoor which when it compiles the login program, will insert the backdoor. Now, the meta-backdoor will not show up in the source code of the compiler. Again, if you inspect the source code of the bootstrap compiler, you will find this meta-meta-backdoor. 4. And so on … BUT!!! Here's the thing: at some point, you will need a compiler that is already compiled so that you can compile your bootstrap compiler so that you can compile your compiler so that you can compile your login program. And you cannot compile this compiler yourself (because you would need another compiler for that), and thus, you cannot ensure that the source code you are inspecting is actually the one that was used to compile the compiler. And that is the problem: no matter how many intermediate compilers you insert and inspect their source code, there will be one ultimate "first" compiler that you cannot compile yourself and that you must trust. Later on in the paper, Thompson also explains that the compiler is just an example. Any entity that stores, reads, writes, transforms, manipulates, processes, displays, or in any other way touches code can be compromised in a similar manner. Instead of the compiler, I could use the dynamic linker, which when it detects the login program running, links it to a version of the C library that always returns true for string equality checks, for example, so that no matter what password I enter, it will let me in. Or, I could modify the memory bus on the motherboard, so that when it detects that the login program is transferred from RAM to the CPU, it modifies the instructions. Or, I could modify the CPU to detect the login program running. I could modify the harddisk's microcontroller, so that when it detects that I am loading the login program from disk, it modifies the program before sending it out over the SATA bus. Instead of trying to cleverly hide the backdoor by compilation, I could instead also modify your text editor, so that when you inspect the source code of login, it simply does not show you the backdoor. And I can do the same when it displays the source code of the compiler. And the editor itself, of course. And so on and so forth. The gist of it is: unless you build your entire computing system from individual wires and switches from scratch, there will be at least one component that you get from somewhere else, that processes code, and the backdoor can be in there. • So the issue would always persist irrespective if the language is higher or lower, right? – user9355495 Feb 6 at 11:49 • 1 The issue persists as long as you have at least one component that processes code that you haven't built yourself from scratch. I have no idea what a "higher" or "lower" language is. This has absolutely nothing whatsoever to do with languages. – Jörg W Mittag Feb 6 at 11:49 • The paper was published using a lower level language like C, after reading your answer i feel that this would persist even on the latest powerful languages like python – user9355495 Feb 6 at 11:53 3 A compiler creates a binary from source code. For a normal compiler, the binary is just another representation of the source code, and the behavior of the program is fully specified in the source. However, a malicious compiler can add extra functionality in the binary, functionality that is not present in the source and thus can not be detected by reading the source. This also applies to the source of the compiler. When compiling the compiler, the malicious compiler adds this malicious functionality to the target binary, and the circle is complete. Your Answer By clicking “Post Your Answer”, you agree to our terms of service, privacy policy and cookie policy Not the answer you're looking for? Browse other questions tagged or ask your own question.	ESSENTIALAI-STEM
> > > CACND Detailed outline Configuring ACI in the Cisco Nexus Data Center (CACND) Course Description Schedule Course Outline Detailed Course Outline Module 1: Introduction to Cisco ACI Lesson 1: Examining Cisco ACI Components • Describe the architecture of a switch fabric • Explain the basic operation of the Cisco ACI fabric • Describe the basic elements of the Cisco Nexus 9000 Series of data center switches • Explain the architecture and purpose of the Cisco APIC • Describe the purpose and function of application network profiles Lesson 2: Examining Cisco ACI Operations • Define the dynamics of virtualizing the network infrastructure • Explain the basics of a policy-based network management model • Describe the foundational building blocks of the Cisco ACI Policy Model Module 2: Cisco ACI Component Architecture • Lesson 1: Examining the Operation of the Cisco ACI Fabric • Describe the ACI fabric elements and basic operational characteristics of the Cisco ACI fabric • Review the packet makeup for virtual extensible LAN • Describe the forwarding mechanisms used in the Cisco ACI fabric for unicast • Describe the forwarding mechanisms used in the Cisco ACI fabric for multicast • Introduce layer 2 and layer 3 gateways • Describe how the ACI monitors and manages congestion using dynamic load-balancing Lesson 2: Exploring the Cisco Nexus 9000 Series Switches • Describe the Cisco Nexus 9000 Series switches • Describe the Cisco Nexus 9500 Series chassis • Describe the Cisco Nexus 9500 Series switch Supervisor Module • Describe the Cisco Nexus 9000 Series switch System Controllers • Describe the Cisco Nexus 9500 Series switch Fabric Modules • Describe the Cisco Nexus 9500 Series switch Card Modules • Describe the Cisco Nexus 9500 Series switch Power and Cooling • Describe the Cisco Nexus 9300 Series switch architecture Lesson 3: Examining the Cisco APIC • Describe the modules used by the Cisco APIC including Logical, Resolved and Concrete Models • Describe the architecture of the Cisco APIC • Describe the Cisco APIC DME architecture module • Configure Cisco APIC nodes in a clustered formation • Perform first-time setup and configuration on the Cisco APIC • Demonstrate access to the Cisco APIC using the GUI • Demonstrate access to the Cisco APIC using the CLI Lesson 4: Managing Cisco ACI • Describe the Management Information Model used in Cisco ACI • Configure and use the Cisco ACI management network to monitor and alter the infrastructure as needed • Identify faults and perform troubleshooting on the Cisco ACI system Module 3: Cisco ACI Configuration Lesson 1: Configuring the Cisco APIC from the GUI • Describe a Tenant • Configure and verify tenants in Cisco ACI from the APIC GUI • Describe a VRF and Bridge Domain • Configure and verify VRF and bridge domains in Cisco ACI from the APIC GUI • Describe an Application Profile • Configure and verify an Application Network Profile in Cisco ACI from the APIC GUI • Describe an EPG • Configure and verify an EPG in Cisco ACI from the APIC GUI • Describe a contract • Configure and verify a contract in Cisco ACI from the APIC GUI Lesson 2: Configuring the APIC from the CLI • Describe the benefits of a CLI, including scripting and user preference • Explore the documentation available for the CLI • Describe the difference between the older object-model CLI mode and the CLI mode of the Cisco NX-OS • Review an example of a configuration in which the CLI is used. Lesson 3: Configuring the APIC with the API • Describe the benefits of an API, including scripting • Explore the documentation available for the API • Use the API Inspector • Describe how to save XML or JSON • Describe an example of a configuration that uses Chrome Postman Lesson 4: Configuring Fabric Access • Describe the requirements for adding a device to a leaf cluster • Configure a VLAN pool on a leaf cluster by using Cisco ACI • Configure a physical domain (physical, virtual, external, etc.) on a leaf cluster by using Cisco ACI • Configure AAEP on a leaf cluster by using Cisco ACI • Configure an access port policy group on a leaf cluster by using Cisco ACI • Configure an interface profile or selector on a leaf cluster by using Cisco ACI • Configure a switch profile on a leaf cluster by using Cisco ACI Lesson 5: Configuring vPCs • Describe a traditional vPC deployment • Describe vPC in an ACI environment • Configure the vPC domain in ACI • Configure the vPC policy group Lesson 6: Configuring ACI Connectivity to External Networks • Explain inside and outside network policies in Cisco ACI • Describe a Layer 3 external connection • Configure a Layer 3 external connection • Describe considerations that exist for external Layer 3 routing • Describe a Layer 2 external connection • Configure a Layer 2 external connection • Describe considerations that exist for external Layer 2 routing Lesson 7: Troubleshooting Cisco ACI • Describe the approach to troubleshooting in Cisco ACI • Use the troubleshooting tools available in Cisco ACI • Configure and use the technical support features available in Cisco ACI Module 4: Cisco ACI Advanced Features Configuration Lesson 1: Configuring Microsegmentation and Intra-EPG Isolation • Describe how ACI enables segmentation • Explain how microsegmentation works within the Cisco ACI fabric • Provide use-case examples for microsegmentation • Describe the attributes of microsegmentation • Configure microsegmentation with Cisco ACI • Describe intra-EPG isolation enforcement that uses Cisco ACI • Configure intra-EPG isolation enforcement Lesson 2 – Examining Transit Routing • Describe the purpose of transit routing • Describe the capabilities of transit routing • Describe how MP-BGP is used to route traffic through the fabric • Describe how the fabric controls transit traffic • Describe the security features of transit traffic Lesson 3 – Configuring Policy-Based Redirect • Describe the purpose of Policy-Based Redirect • Describe physical topology examples for Policy-Based Redirect • Describe the function of a service graph • Configure a service graph template and a service graph provider endpoint group Lesson 4 - Configuring IP Multicast • Describe the use case for Layer 3 multicast functionality across bridge domains • Explain how PIM is used in the fabric • Describe the traffic flow of multicast traffic within the fabric • Configure multicast by using the web interface Lesson 5: Examining ACI Multi-fabric Options • Define the Cisco ACI multifabric design options • Describe the Cisco ACI Stretched Fabric • Describe the site-to-site connectivity options • Describe the Cisco ACI Multi-Pod solutions • Describe the Cisco ACI software and hardware and the limitations for running Multi-Pod • Describe the relationship between the APIC and Inter-Pod Network • Describe how data is shared across APICs • Describe zones and autopod configuration Module 5: Cisco ACI vCenter Plug-in Lesson 1: Examining VMware Fundamentals • Describe how the VMware servers connect to the ACI fabric • Describe the key components of VMware • Describe the properties of ESX-based virtual machines • Describe how networking works within the VMware environment • Describe how VMware uses virtual switches and VLANs Lesson 2: Configuring VM Connectivity • Configure a virtual switch in VMware • Describe network redundancy in VMware • Configure network redundancy, using NIC teaming in VMware • Connect a virtualized server to an access network based on Cisco Nexus switches Lesson 3: Performing and Verifying vMotion Migrations • Describe the migration options that are available in virtual machines • Describe how to use the Storage vMotion feature • Configure VMware for Server vMotion • Describe how to use the Server vMotion feature Lesson 4: Configuring ACI Integration with VMware • Describe the relationship between ACI components and VMware • Configure ACI to integrate with VMware Lab Outline • Lab 1: Exploring the Cisco ACI Fabric • Lab 2: Exploring the Cisco APIC • Lab 3: Operational Element Configuration from the GUI • Lab 4: Operational Element Configuration from the CLI • Lab 5: Cisco APIC API Configuration • Lab 6: Endpoint Physical Connectivity • Lab 7: Virtual Port Channels • Lab 8: Cisco ACI External Connectivity • Lab 9: Cisco ACI Troubleshooting • Lab 10: VM Integration with Cisco ACI Cookies help us deliver our services. By using our services, you agree to our use of cookies. Got it!	ESSENTIALAI-STEM
Network design help By GryRypa · 12 replies Sep 26, 2007 1. I have the following equipment and would like to set up a network with broadband internet access: - computer 1 with 2 HDD( 80g and 40g), on board gigabit lan port, win XP, 2.8 P4 processor,1 gb ram - computer 2 with 1 250g HDD, on board gigabit lan (p5b deluxe mobo), pentium D 805 proc, 1gig ram -cisco 2514 router -cisco 1900 router -broadband internet through a toshiba hi speed modem (time warner) I currently have a network with the cisco switch running but would like to mess around with with the router and do some NAT configurations in the process and also get some vlan experience with it. So if anyone could give me an idea of how to setup the equipment such as should I have the hi speed modem connected to one of the computers then the router between the two pcs or should the it be modem to router then pcs to modem. Any and all advice appreciated 2. tipstir tipstir TS Ambassador Posts: 2,472 +126 For help with configuring the cisco routers you can go to cisco site and read all about the commands and what they do. Do you have your CNNA? Most of work here is done through either GUI or telnet. 3. jobeard jobeard TS Ambassador Posts: 11,126 +982 you will find this much easier to admin; Code: modem --- either.router --- all other systems 4. GryRypa GryRypa TS Rookie Topic Starter thanks tipster. I have my CCNA and am reasonably familiar with the cisco commands. I am also able to telnet in to the router when connected. Before this current network setup (with switch only) I had the router in place with the two PCs connected to it but I couldn't file share between the 2 PCs using ICS coz, according to a post here, XP uses 192.168.x.x for its IP address in same subnet but for the router I had different subnets on e0 and e1.Thats why I would love an example of a configuration showing how the two PCs on different networks can be used to access the internet. Am assuming ICS wont work in this case if two different network address are used. joebeard I was also thinking of that design but it then definitely means some sort of NAT configuration has to come in or is there another way. 5. jobeard jobeard TS Ambassador Posts: 11,126 +982 NAT default is sufficient :) Your VPN will be the issues and controlled entirely there, not in the router :) 6. tipstir tipstir TS Ambassador Posts: 2,472 +126 Did you want to setup VLAN also? As for the firewall with NAT you have a Sandbox or Securied Cisco Firewall Box? 7. GryRypa GryRypa TS Rookie Topic Starter Yes I will be setting up a VLAN. I have an older machine running on a P3 @366mhz which I can upgrade to add to the network. As for the firewall and general security I have no ideas beyond setting up ACLs and would like some advice on that.Especially explain what a sandbox is. For know I am going to set the network up with static NAT for the PCs and with a range of IP addresses that my ISP provides by DHCP hopefully set up a range of ip addresses that will nbot loose the ISP outside connection. 8. tipstir tipstir TS Ambassador Posts: 2,472 +126 Sandbox is another type of Firewall hardware device. AT work I use CISCO 3750 Switch tie into CISCO Router. We have VLAN networks setup because of the number of connections have exceeded. VLAN1, VLAN60. There are scripts that you can use to setup the PCs on VLAN. Make sure you decided you change switch ports to what VLAN attached device you going to use. 9. GryRypa GryRypa TS Rookie Topic Starter thx tipstir. am just leaving for home from work so will post the progress shortly. 10. GryRypa GryRypa TS Rookie Topic Starter I discovered last night that for the 2514 router to obtain an ip address dynamically it needs interface configuration command "IP address dhcp" and this was only made available from IOS 12.1(2)T. I now have to install a new IOS image on the router. Good news is that the router can be used for internet access through any of its ethernet interfaces. So if there is anyone out there who knows a quick and easy way of installing the IOS on a router please HELP! 11. Hamsafar Hamsafar TS Rookie do u help me in same topic? 12. GryRypa GryRypa TS Rookie Topic Starter Almost there well so far the problem I've had is that my IOS was too old and didn't have the IP address dhcp command to handle my connection. Because I don't have any cisco license I can't download the image I need off there website so after searching the internet I finally found a free download of version 12.2(7a). Once down loaded I tried various TFTP server software like filezilla and Tftpd32 to copy the image to the router but they allfailed even to copy from router to tftp server. The only one that worked for me was cisco tftp server v1.1 with which I installled the image last nite so when I get off from work today I will set up the configuration and hopefully be up and running. Then I will immediately post the whole configuration up by tomorrow. 13. hankosky hankosky TS Rookie I am working on doing the same thing. I was able to find IOS via a t0rrent file. So once i get that loaded on my router i will let you know. As for TFTP, the program i useally use is the SolarWinds TFTP server . Its over at http://www.solarwinds.com/products/freetools/index.aspx Just make sure your Firewall dosent block the ports. Becuase the Windows Firewall Will! Topic Status: Not open for further replies. Similar Topics Add your comment to this article You need to be a member to leave a comment. Join thousands of tech enthusiasts and participate. TechSpot Account You may also...	ESSENTIALAI-STEM
Page:The American Cyclopædia (1879) Volume XV.djvu/687 TERBURG been isolated, and a majority of chemists at present discredit its existence. TERBURG, Gerard, a Dutch painter, born in Zwolle in 1608, died in Deventer in 1681. He painted cabinet size conversation pieces, musi- cal parties, and ladies at their toilets. In 1648 he painted a picture of the plenipotentiaries assembled at the congress of Munster, which led to his being invited to Madrid by Philip IV. He excelled in color and the finishing of his draperies, especially white satin. TERCEIRA, one of the Azore islands, near the centre of the group ; lat. 38 40' K, Ion. 27 10' W. ; extreme length 20 m., general breadth about 12 m. ; pop. about 50,000. The coast is generally bold and precipitous, and the central part of the island is mountainous, the summits consisting mostly of fertile plains. Many of the mountain masses are composed of soft pumice. The island is well watered, and the soil fertile. Grain, wine, and cattle are pro- duced, and it exports oranges and lemons. Capital, Angra. In 1829 Terceira became the seat of the regency for Dona Maria da Gloria during Dom Miguel's usurpation in Portugal, and Dom Pedro I. of Brazil collected there forces for the recovery of his daughter's throne. TEREDO. See SHIP WOEM. TERENCE (PuBLius TEKENTIUS AFEE), a Ro- man comic poet, born in Carthage about 195 B. C., died about 159. He became a slave of P. Terentius Lucanus, a Roman senator, who gave him an excellent education, and finally freed him. The Andria, his first play, was acted in 166, and its success introduced him into the best society of Rome, Laslius and the younger Scipio being among his associates. Later in life he went to Greece, and there translated 108 of Menander's comedies. The manner of his death is uncertain, though the common account ascribes it to grief at the loss of all his translations of Menander. Six of his comedies are extant, and besides the Andria (" The Woman of Andros "), the plot of which was adopted by Steele in his " Conscious Lov- ers," there are Hecyra ("The Stepmother"), produced in 165 ; Heauton - Timoroumenos ("The Self-Tormentor"), produced in 163; Eunuchus (" The Eunuch "), the most popular of his plays, for which he received 8,000 ses- terces, produced in 162 ; Phormio, produced in 162 ; and Adelphi (" The Brothers"), acted first in 160. The dramas of Terence all belong to kQfabula palliata, and with the exception of the last two were first performed at the Megalesian games. The plots were borrowed from Menander. Terence's Latinity is elegant, and his works have been handed down in a very correct state. There have been numer- ous imitations of his comedies by the mod- erns, and they have been translated into near- ly all the languages of Europe. The first edi- tion is probably that of Milan (fol., 1470). Re- cent editions of the text with notes are those of Davies (London, 1869), Wagner (London, 1869), and Umpfenbach (Berlin, 1870). Among TERMITES 657 English translations are those of Colman (Lon- don, 1765), Patrick (Dublin, 1829), and Riley (London, 1853). TERHUNE, Mary Virginia (HAWES), an Ameri- can novelist, under the pseudonyme of Marion Harland, born in Amelia county, Va., about 1835. At the age of 16 she 'published in " Godey's Lady's Book " a sketch entitled "Marrying from Prudential Motives," which was copied into an English periodical, trans- lated into French, retranslated into English, and published in England and America as an English tale. In 1856 she married the Rev. E. P. Terhune, and since 1859 has resided at Ne.wark, N. J. Her works are: "Alone" (Richmond, 1854; 19th ed., 1856); "The Hidden Path" (New York, 1855); "Moss Side" (1857); "Miriam" and "Nemesis" (1860); "Husks" (1863); "Husbands and Homes "(1865); "Sunnybank" (1866); "The Christmas Holly " (1867) ; " Ruby's Husband " (1868) ; " Phemie's Temptation " (1869) ; " Helen Gardner," " The Empty Heart," " Com- mon Sense in the Household, a Manual of Practical Housewifery," and ' ' At Last " (1 870) ; " True as Steel " (1872) ; " Jessamine " (1873) ; and "From my Youth Up" (1874). TERMIM-IMERESE (anc. TTiermce Himerenses), a town of Sicily, part of the ancient northern Himera, in the province and 20 m. S. E. of the city of Palermo, E. of the mouth of the San Lionardo ; pop. in 1872, 25,780. It has fine churches, a good harbor, fisheries, and an active trade in local products, including mac- caroni, which is the best in Sicily. After the destruction of the Greek city of Himera by Hannibal, the son of Gisco, in 409 B. C., the surviving inhabitants fled to the neighboring Thermae, so named from its celebrated hot sul- phur springs. The town appears to have ex- isted during the Roman empire, and consider- able portions of the Roman part are still visi- ble. The southern Therma3 or Therms Seli- nuntise is described under SCIACCA, its modern site. (See also HIMERA.) TERMITES, the proper name of the white ants, or the neuropterous insects of the family termitince. Though they resemble the com- mon ants (formica) in their social habits, they belong to a different order, and in many re- spects come near the orthoptera. In the genus termes (Linn.) the antennas are thread-shaped, with about 20 joints ; the eyes small but promi- nent, and the ocelli three; the mouth as in orthoptera; thorax distinct, and wings large, long, and membranous ; legs short with fonr- jointed tarsi ; abdomen with a pair of minute caudal appendages. They live in vast com- munities, principally in the tropics, and do great damage by devouring everything but metals and stone which comes in their way, gnawing even the interior of the beams of houses, leaving only a thin shell. According to Latreille there are five classes in their com- munities, males, females, workers, neuters, and soldiers. The males and females are at first	WIKI
Yvonne de Tréville Yvonne de Tréville (August 25, 1881 — January 25, 1954) was an American coloratura soprano, born Edyth Le Gierse. Early life Edyth Le Gierse was born in Galveston, Texas; her father was French-speaking, and her mother was from New Orleans, Louisiana. She studied voice with Mathilde Marchesi in Paris. Career Yvonne de Tréville made her debut in New York in 1897, and the next year was playing Mimi in the New York debut of Puccini's La Bohème. In 1902 she first appeared with the Paris Opéra-Comique as Lakmé. Over the following decade, she sang in Stockholm, St. Petersburg, Budapest, Nice, Berlin, Bucharest, Prague, Frankfurt, Cologne, Hanover, Cairo, and Brussels; she was noted for her strong language skills. She sang Mimi again at the Vienna Court Opera in 1909 and 1910. She returned to the United States in 1912. Tréville appeared on the Broadway stage in Carmen in 1918 and 1919. In her later career she focused on concert singing, touring, arranging songs, and teaching voice in New York. She was associated with the Interstate Grand Opera Company, to bring opera music to the American midwest. Composers Mary Carr Moore, Gertrude Ross, and Gena Branscombe composed and dedicated songs to Yvonne de Tréville, songs which she performed in her Three Centuries of Prime Donne show for several seasons. In 1914, she sang a recital at sea for the sailors, after her concert appearances in Honolulu, Hawaii. During World War I she was active performing for war relief causes. She gave a concert for the Aviation Corps in Mineola, New York, and at a rally for the American Red Cross. She also chaired a wartime committee promoting the writing of new patriotic songs. Personal life Yvonne de Tréville died in 1954, aged 72 years.	WIKI
Popularity 2.7 Growing Activity 0.2 Declining 0 3 0 Monthly Downloads: 574 Programming language: Haskell License: BSD 3-clause "New" or "Revised" License Tags: Algebra Time interval-algebra alternatives and similar packages Based on the "Algebra" category. Alternatively, view interval-algebra alternatives based on common mentions on social networks and blogs. Do you think we are missing an alternative of interval-algebra or a related project? Add another 'Algebra' Package README interval-algebra The interval-algebra package implements Allen's interval algebra in Haskell. The main module provides data types and related classes for the interval-based temporal logic described in Allen (1983) and axiomatized in Allen and Hayes (1987). A good primer on Allen's algebra can be found here. Design The module is built around three typeclasses designed to separate concerns of constructing, relating, and combining Intervals: 1. Intervallic provides an interface to the data structure of an Interval, defining how an Interval a (simply a pair (a, a)) is constructed. 2. IntervalAlgebraic provides an interface to the IntervalRelations, the workhorse of Allen's temporal logic. 3. IntervalCombinable provides an interface to methods of combining multiple Intervals. An advantage of nested typeclass design is that developers can define an Interval of type a with just the amount of structure that they need. Total Ordering of Intervals The modules makes the (opinionated) choice of a total ordering for Intervallic Intervals. Namely, the ordering is based on first ordering the begins then the ends. Axiom tests The package [includes tests](test/IntervalAlgebraSpec.hs) that the functions of the IntervalAlgebraic typeclass meets the axioms for intervals (not points) as laid out in Allen and Hayes (1987). Development This module is under development and the API may change in the future.	ESSENTIALAI-STEM
SniffCore.Input Namespace Click or drag to resize SniffCore.Input Namespace Provides WPF controls for user input like a number box and more. Classes ClassDescription Public classAlphaInputLimiter Allows only alpha input ([a-zA-Z ]) on a TextBox. Public classAlphaNumericInputLimiter Allows only numeric input ([a-zA-Z0-9 ]) on a TextBox. Public classCode exampleBrowseTextBox Adds a browse button to the TextBox. Public classCancelButton The button which calls the cancel command in the SearchTextBox. Public classCharInsertModificator Adjust the text in the TextBox that it always contains a dash every N position. Public classInputLimiter Allows or disallows user inputs on a TextBox. Public classLostFocusBehavior Defines the actions which should be done when the NumberBox lost the focus. Public classCode exampleNumberBox Displays a TextBox to accept numeric values only, so the text can be bound to a numeric property directly without converting. Public classNumberChangedEventArgs Holds the data passed when a NumberBox has changed its value. Public classNumberCheckBox Represents the check box shown in the NumberBox. Public classNumberResetButton Represents the reset to default button shown in the NumberBox. Public classNumberUnitLabel Represents the currency symbol shown in the NumberBox. Public classNumericInputLimiter Allows only numeric input ([0-9]) on a TextBox. Public classCode examplePasswordBox Hosts and enhances the PasswordBox to be able to bind the password value and show info text in the background. Public classSearchButton The button which calls the search command in the SearchTextBox. Public classCode exampleSearchTextBox Adds search and cancel buttons to the TextBox to represent a search box shown like in the Windows explorer. Public classCode exampleTextBox Enhances the TextBox by the possibilities to show background text, drop files and folders and place additional controls in. Public classTextModificator Allows modification of the text in the TextBox. Public classCode exampleTimeBox Shows textboxes to let the user input a time. Public classToLowerModificator Modifies the text to always lower in the TextBox. Public classToUppperModificator Modifies the text to always upper in the TextBox. Public classUpDownButton Represents a up or down button shown in the NumberBox control. Delegates DelegateDescription Public delegateNumberChangedEventHandler The event handler for the NumberChanged event. Enumerations EnumerationDescription Public enumerationDroppableTypes Represents what is possible to drop into the TextBox. Public enumerationInfoAppearance Defines when the InfoText in the TextBox and its derived controls is visible. Public enumerationModificationTime Defines when the TextModificator will be executed in the TextBox. Public enumerationNumberBoxCheckBoxBehavior Defines what should happen to the NumberBox if the internal checkbox is checked. Public enumerationNumberBoxSelection Defines how the automatic selection of the number in the NumberBox should behave. Public enumerationNumberType Defines which kind of numbers the NumberBox is accepting. Public enumerationTimeFormat Defines if the TimeBox contains a seconds box or not. Public enumerationUpDownBehavior Defines how the value in the NumberBox can incremented or decremented. Public enumerationUpDownDirections Represents the direction to be used for the up and down button in the NumberBox. Public enumerationValueBehavior Defines what the NumberBox should do when it lose the focus without a value (null). Public enumerationWhitespaceHandling Defines how to handle whitespaces in the TextBox.	ESSENTIALAI-STEM
Oxycodone is an opioid ache medication, sometimes referred to as a narcotic. Ibuprofen is a nonsteroid anti inflammatory medicine (NSAID). This medication works by reduce substances in the body that cause pain, fever, and also inflammation. You are watching: Can you take percocet and ibuprofen together Ibuprofen and oxycodone is a mix medicine offered short-term come relieve significant pain. This medicine is not for dealing with arthritis pain. Ibuprofen and also oxycodone may likewise be offered for objectives not detailed in this medicine guide. Oxycodone deserve to slow or avoid your breathing, and also may be habit-forming. MISUSE of NARCOTIC medication CAN cause ADDICTION, OVERDOSE, OR DEATH, especially in a child or other human being using the medicine without a prescription. Taking this medicine during pregnancy may reason life-threatening withdrawal symptom in the newborn. Fatal side effects can occur if you use this medicine with alcohol, or with various other drugs that reason drowsiness or slow-moving your breathing. Ibuprofen can increase your risk of fatal heart assault or stroke, especially if you use it long term or take it high doses, or if you have actually heart disease. Execute not usage this medication just before or after love bypass surgical procedure (coronary artery bypass graft, or CABG). Ibuprofen may additionally cause stomach or intestinal bleeding, which deserve to be fatal. These conditions can take place without warning while you space using ibuprofen, particularly in larger adults. Ibuprofen can increase your threat of deadly heart assault or stroke, particularly if you use it lengthy term or take it high doses, or if you have heart disease. Even civilization without heart disease or risk factors might have a hit or heart assault while taking ibuprofen and also oxycodone. Ibuprofen may likewise cause stomach or minister bleeding, which have the right to be fatal. These conditions can happen without warning while you are using this medicine, particularly in larger adults. You should not usage this medication if you are allergic come ibuprofen (Advil, Motrin) or oxycodone, or if you have ever before had an asthma attack or serious allergic reaction after taking aspirin or one NSAID. Do not usage this medication just prior to or after heart bypass surgery (coronary artery bypass graft, or CABG). To make certain this medicine is for sure for you, call your doctor if you have ever had: heart disease, high blood pressure, high cholesterol, diabetes, or if friend smoke;a love attack, stroke, or blood clot;a stomach ulcer or stomach bleeding;any kind of breathing trouble or lung disease;liver or kidney disease;fluid retention;a head injury, mind tumor, or seizures;a thyroid or adrenal gland disorder;urination problems; oralcoholism, medicine addiction, psychological illness. Some drugs can interact with oxycodone and also cause a serious condition called serotonin syndrome. Be sure your physician knows if you also take stimulant medicine, herbal products, or medicine for depression, psychological illness, Parkinson"s disease, migraine headaches, serious infections, or avoidance of nausea and also vomiting. Ask your doctor before making any type of changes in how or as soon as you take your medications. Taking ibuprofen throughout the critical 3 month of pregnant may injury the unborn baby. If you usage oxycodone when you room pregnant, her baby could become dependent ~ above the drug. This can reason life-threatening withdrawal symptom in the baby after the is born. Babies born dependence on habit-forming medicine may need clinical treatment for number of weeks. This medicine deserve to pass into breast milk and also cause drowsiness or breathing problems in a parenting baby. Tell your medical professional if you room breast-feeding. * Get emergency medical help if you have actually signs of an allergy reaction (hives, difficult breathing, ede in your challenge or throat) or a major skin reaction (fever, sick throat, burning in your eyes, skin pain, red or violet skin rash that spreads and also causes blistering and peeling). Get emergency medical help if you have signs that a heart assault or stroke: chest pain spreading to her jaw or shoulder, suddenly numbness or weakness on one side of the body, slurred speech, leg, swelling, feeling brief of breath. Stop using this medicine and also call your doctor at when if you have: weak or shallow breathing, sighing, slow-moving heartbeat;swelling or fast weight gain;the an initial sign of any type of skin rash, no matter exactly how mild;signs that stomach bleeding--bloody or tarry stools, sneeze up blood or vomit that looks like coffee grounds;liver problems--loss the appetite, diarrhea, upper stomach pain, tiredness, flu-like symptoms, dark urine, jaundice (yellowing the the skin or eyes);kidney problems--little or no urination, ede in your feet or ankles, feeling tired or brief of breath; orlow red blood cells (anemia)--pale skin, emotion light-headed or short of breath, rapid heart rate, problem concentrating. Seek medical attention ideal away if you have actually symptoms the serotonin syndrome, together as: agitation, hallucinations, fever, sweating, shivering, quick heart rate, muscle stiffness, twitching, loss of coordination, nausea, vomiting, or diarrhea. Serious side effects may be much more likely in larger adults and also those who room overweight, malnourished, or debilitated. Long-term usage of opioid medicine may influence fertility (ability to have actually children) in guys or women. the is not known whether opioid results on fertility space permanent. Common side effects may include: headache, dizziness, drowsiness;mild nausea, vomiting, uncomfortable stomach, constipation, diarrhea;blurred vision; ordry mouth. This is no a finish list of side effects and also others may occur. Speak to your doctor for medical advice about side effects. You may report side impacts to FDA at 1-800-FDA-1088. * This medication might impair your thinking or reactions. Avoid driving or operation machinery until you know just how the medication will impact you. Dizziness or serious drowsiness can reason falls or other accidents. Do no drink alcohol. dangerous side impacts or death might occur. Ask a physician or pharmacist before using any kind of cold, allergy, or ache medication. Many combination medicines save on computer aspirin or various other medicines comparable to ibuprofen. Taking particular products together can cause you to get too much of this form of medicine. Narcotic (opioid) medicine can interact with plenty of other drugs and also cause danger side results or death. Be certain your medical professional knows if you additionally use: other narcotic medications--opioid pain medication or prescription cough medicine;a sedative choose Valium--diazepam, alprazolam, lorazepam, Ativan, Klonopin, Restoril, Tranxene, Versed, Xanax, and others; ordrugs the make girlfriend sleepy or slow-moving your breathing--a sleeping pill, muscle relaxer, tranquilizer, antidepressant, or antipsychotic medicine. This perform is no complete. Other drugs may interact with ibuprofen and also oxycodone, including prescription and over-the-counter medicines, vitamins, and herbal products. Not all possible interactions are listed in this medicine guide. * Follow all directions on her prescription label. Oxycodone have the right to slow or stop your breathing. Never take it ibuprofen and also oxycodone in larger amounts, or for longer than prescribed. Use the lowest dose that is efficient in treating your condition. tell your doctor if the medicine seems to avoid working also in relieving her pain. Oxycodone may be habit-forming, also at continuous doses. Never share this medicine with one more person, particularly someone v a history of medicine abuse or addiction. MISUSE the NARCOTIC medication CAN cause ADDICTION, OVERDOSE, OR DEATH, particularly in a boy or other human using the medicine without a prescription. marketing or providing away ibuprofen and oxycodone is versus the law. If you require surgery, tell the operated doctor ahead that time the you are using ibuprofen and oxycodone. Store at room temperature away from moisture and heat. Store track of your medicine. Oxycodone is a drug of abuse and also you need to be aware if anyone is using your medication improperly or there is no a prescription. Do not store leftover opioid medication. Just one sheep can reason death in someone utilizing this medicine accidentally or improperly. Ask your pharmacist where to find a medicine take-back disposal program. If over there is no take-back program, flush the unused medicine down the toilet. Seek emergency medical attention or speak to the Poison aid line in ~ 1-800-222-1222. A oxycodone overdose can be fatal, especially in a kid or other human using the medication without a prescription. Overdose symptom may include vomiting, black or bloody stools, coughing up blood, confusion, muscle weakness, cold and also clammy skin, slow-moving heart rate, blue lips, very slow breathing, or coma. See more: How To Paint A Snow Globe Painting With Tracie Kiernan, How To Paint A Snow Globe Since this medicine is provided for pain, you are not likely to miss out on a dose. Skip any type of missed sheep if that is virtually time because that your next scheduled dose. Do not use extra medicine to consist of the to let go dose.	ESSENTIALAI-STEM
Leeward Islands Championships in Athletics The Leeward Islands Championships in Athletics is an athletics event organized by the Leeward Islands Athletics Association (LIAA) open for (but not restricted to) athletes from its member associations. Leeward Islands Athletics Association The Leeward Islands Athletics Association (LIAA) was founded in 2002, replacing the Leeward Islands Athletics Steering Committee that had previously organized the Leeward Island Championships. Member associations It comprises the following 8 member associations Nevis is an independent member, the athletes compete in an own team separately from Saint Kitts. Competitions The LIAA hold two different championships: so-called Leeward Islands Junior Championships (effectively junior (U20) and youth (U17) championships), and Leeward Islands Youth Championships (effectively age group championships U15, U13, and U11). Leeward Islands Junior/Youth Championships Leeward Islands Junior (U20) and Youth (U17) Championships, (dubbed Leeward Islands Youth Championships) have been held since 2001. * The 2004 event was announced, but no results could be retrieved. Might have been cancelled. Leeward Islands Age Group Championships Leeward Islands Age Group Championships for athletes U15, U13, and U11, (dubbed Leeward Islands Youth Championships) are held since 1993.	WIKI
User:Mayacaps/sandbox Women and Propaganda The propaganda and its ideological impacts on women and family life in World War I differed from country to country. British propaganda often promoted the idea that women and the family were threatened by the enemy, particularly the Germany army. British propaganda played on the fear of its citizens by depicting the German army as a ravenous force that horrified the towns and cities it passed through, raping women and tearing apart families. The terror ensued by this gendered propaganda influenced Britain’s international war policies henceforth; violence against the domestic sphere in wartime was seen as an inexcusable crime of war. In the Ottoman Empire, as in other countries such as the U.S., women were encouraged to enter the workforce, as the number of men within the empire grew smaller and smaller over the course of the war. The Ottoman government had a system that already incorporated the participation of women in governmental committees established in 1912 and 1913. Thus, when World War I began, the Ottoman government was able to spread patriotic propaganda through the women’s committees to women across the empire. Propaganda encouraged women to enter the workforce, both to support the Empire and to become self-sufficient through state-sanctioned work specified for women. American World War I propaganda often featured images of women, however they typically reflected traditional gender norms. While there was a call to increasingly employ women to replace the men at war, American propaganda also emphasized sexual morality. Women’s clubs often produced this anti-gambling and anti-prostitution attitudes. Shedden suggestions: You have added a good amount of information here. "dedicated to the promotion" might be a little strong. Explain that last sentence in the opening paragraph a bit better. One of your citations is off in the 2nd paragraph. "Messages propagated to women" is a little awkward. Watch verb tense is paragraph three. You could be slightly more specific with a few of your examples. Brandon peer review: remove all semi-colons. short sentences work better. I suggest to separate the comparison of women and propaganda into two different sub sections, and those two subsections can detail the role of women in the the allied powers and the central powers and their use of Propaganda.	WIKI
Church of the Holy Rosary, Kuala Lumpur Church of the Holy Rosary is a Catholic church situated at Jalan Tun Sambanthan, Kuala Lumpur, and is considered one of the finest examples of neo-gothic architecture in Malaysia. History In the early 1900s, the French missionary Father Francis Emile Terrien, who administered to the Chinese Catholic community in Kuala Lumpur, was given the task of constructing a new church for his parishioners. He raised funds from a number of sources including Chinese donors, lenders and from the nearby St. John's parish, sufficient to purchase a plot of land in Brickfields, and together with Father L. Lambert, who had trained as an architect, they began designing the new church. Construction began in 1903 when Bishop Rene Fee, Bishop of Malacca, laid the foundation stone. After eighteen months the church was complete although at this point it lacked many of its current features including the steeple, bell tower and transepts. The parsonage was an attap building and the belfry housing the bell was placed on the ground next to the church which had a flat roof. However, the five stained-glass windows designed by Lambert, which can be seen today behind the altar, were installed at this time representing five themes of the Rosary. Bishop Monsignor Emile Barillon blessed the new church in 1904 and it was named "Church of Our Lady of the Rosary". After the church was damaged during the Second World War, the stained glass windows having been removed for safekeeping by Father Girard, the years following the war saw an expansion in size of the congregation and the church was enlarged to accommodate the growing numbers. Supervised by Father Moses Koh to the design of architect Robert B. Pereira, two new transepts were added, the steeple was erected, a belfry was built above the entrance, and the flat roof was replaced by a sloping gabled roof. Timber supports were replaced by plaster vaulting. The new design, which we see today, was blessed at a ceremony by Bishop Olcomendy of Malacca. During the 1960s, further expansion was carried out on the site, following fundraising by Father Edourd Giraud, with the construction of a parish hall and a presbytery. Later, Father John Hsiong carried out renovations, moved the organ and choir to the ground floor, built a raised pulpit, and removed the altar rails. In order to generate income for future maintenance of the church he opened a four-storey hostel next to the church named "Terrien House" after the founder of the church, Father Terrien. In 2003, part of the church was closed after wooden beams and louvres were found to be affected by termite infestation and were replaced, and later 22 new stained glass windows were installed. Architecture The design of the church is based on the Gothic architectural style with characteristic lancet doors and windows with tracery and pointed arches. The shape follows the traditional cruciform plan with nave and transepts. A projecting bell tower is positioned above the entrance as part of the steeple which is surmounted by a cross finial. Mandarin characters were added in the 1950s on the facade reflecting its Chinese parishioner base. The interior has a rib-vaulted nave with double aisles and Romanesque columns. Statues of disciples stand around the walls, and stained glass windows portray themes of the Rosary, including the oldest dating from the founding of the church behind the altar portraying: "the Annunciation", "the Nativity", "the Visitation", "the Presentation at the Temple", and "the Finding of the Child Jesus at the Temple".	WIKI
Sub Rang Society Sub Rung Society is a non-profit organisation working for advocacy, awareness, and employment of the Pakistani transgender community. The organization is opening trans-led salons through the economic project 'Trawah'. Trawah is a code word within the trans-community, which means makeup. Under this project, they have launched a salon in Karachi. The salon has both transgender and non-transgender employees. The organization also collaborates as a local partner for organizing International Minorities Festival in Pakistan.	WIKI
Page:Philosophical Review Volume 1.djvu/380 364 said that the pure ego and the "Ding an sich" are artificial concepts corresponding to nothing in experience. Ideation and matter are expressions derived from facts of experience; but there is no faculty of feeling or perceiving which exists alongside of that which is felt or perceived. The formal standpoint presents the forms of subjective idealism and of materialism as its extremes. This standpoint is an arbitrary solution of the problem which puts out of sight the essential conditions; the force of the opposition between the "in me" and the "outside of me" is here not operative. Psychologically, subjective idealism rests on an inverted concept of the development of self-consciousness; logically, it errs in asserting that everything perceivable is only an idea of the ego, because it does not take into account the relations of the objects of perception or ideation to one another. The considerations urged against an exclusive "in me" hold good, ''mut. mutan.'', against the exclusive "outside of me" of materialism. More than any line of philosophic thought has materialism forgotten that the concepts of natural science and psychology are only imperfect theories of what experience is, and are not the experiences themselves, and that we attain to and grasp reality only in what has been or can be experienced. Plato's writings are less important for our knowledge of the philosophy of his predecessors and contemporaries than those of Aristotle, partly because Plato attached less worth to facts as such than Aristotle, — he is less scholar than poet. Further, the form in which his thought is cast is not adapted for considerable treatment of historical views; again, opinions are presented and discussed not in his own name, and he takes no part in the dialogue. When views of other philosophers are mentioned, it is sometimes without specification of the source; sometimes with expressed reference to the work from which the statement has been derived; and again, as if the view had no other authority than current tradition. Sokrates mentions the maxims of the Seven Wise Men (Protag., 343 A f.) and the discoveries of Thales and Anacharsis (Rep., X, 600 A) merely as something universally accepted. Z. quotes references in Theaitetos, Parmenides, Kratylos, Sophistes, Timaios, etc., to various doctrines of Plato's predecessors, which are recounted in the traditional form of historical narrative, and points out that these communications of Plato on the older philosophers are to be regarded as historical reports. Author	WIKI
Page:History of Oregon Newspapers.pdf/270 Rh press, in at the birth of almost all the pioneer papers; a few fonts of type, and a hand-inking job press. In his opening editorial Mr. Sutton said: "Believing that there is ample room in southern Oregon for a good independent family newspaper, we have resolved to make our effort to establish such a one." The paper continued independent in politics until the late eighties, when, following the suspension of the old Jacksonville Sentinel, it became a Republican organ. The Tidings has not been without competitors through the years. E. J. Kaiser, well-known southern Oregon newspaper man, started the Valley Record as a Thursday weekly in 1888 while Mr. Leeds was publishing the Tidings. This newspaper ran under Mr. Kaiser's direction until 1912, when he became postmaster at Ashland and Charles B. Wolf took hold of the paper. Mr. Wolf dropped the Valley from the title on taking control. The paper was suspended in 1919 by W. M. Barber, who had succeeded Mr. Wolf as owner. Mr. Kaiser was back in control during 1917, on retiring from the postmastership. The Tribune, founded in 1896 as a weekly, ran along, part of the time as a Wednesday-Saturday semi-weekly, until 1906. A. C. Jacobsen and J. M. Potter, successively, were editors. Town Talk, a weekly, started in 1896 and suspended in 1902, had for one of its publishers George C. Stanley, who later became interested in mining and merchandising. Dallas.—A Baptist Democratic weekly, the Religious Expositor, was Polk County's first contribution to Oregon journalism. It was published at Eola, a little town near the Marion county line, by C. M. Mattoon, in 1856. The first number, which was closer to the last than the hopeful publisher had any inkling, appeared May 6. After a few issues the paper was moved, July 19, to Corvallis, where it died October 11, a few months before the appearance of J. C. Avery's Occidental Messenger. The Dallas Weekly Itemizer, which survives as a part of Earle Richardson's Polk County Itemizer-Observer, published at Dallas, was the county's next newspaper, the first one of any real significance. The first number appeared in 1868. It was founded, like so many other newspapers, by J. H. Upton, and its first name was the Polk County Signal. The Signal was a political newspaper, Democratic, "born," Vivian Fiske says, "for the political campaign in which Joseph E. Smith defeated David Logan for congress." It was a four-page seven-column paper, issued on Mondays, and Mr. Upton was asking $3 a year.	WIKI
War diary A war diary is a regularly updated official record kept by military units of their activities during wartime. The purpose of these diaries is to both record information which can later be used by the military to improve its training and tactics as well as to generate a detailed record of units' activities for future use by historians. War diaries are focused on the administration and operations of the unit they cover, but may also contain information about individual personnel. War diaries (Kriegstagebuch, plural Kriegstagebücher) were invented by the Prussian Army. On 22 April 1850, the Prussian Minister of War, August von Stockhausen, ordered that all commanders of major units should keep war diaries. All significant military actions, relocations, important messages and orders, casualties, material losses, reinforcements etc. were to be recorded. Subsequent regulations of 1870 in Prussia, of 1895 and 1916 in the German Empire, and of 1940 in Nazi Germany were largely identical to the Prussian 1850 regulations. The British Army first required that its units keep war diaries in 1907 as a means of preventing its mistakes of the Second Boer War from being repeated, and units operating in war zones continue to maintain such diaries. The war diaries kept by Australian military units are normally maintained by the unit's adjutant or intelligence officer and contain a regularly updated narrative of its activities as well as copies of reports, messages received and maps. World War II War Diaries from units of the US Navy (including all ships) and Marine Corps were declassified on December 31, 2012 by the Office of the Chief of Naval Operations (OCNO) and made available to the public through the National Archives and Records Administration (NARA). These war diaries are part of a larger collection of records from the OCNO at NARA, currently spanning 1875 to 2006.	WIKI
Italian Senate Extends Funding for Afghanistan, Libya Missions The Italian Senate voted to extend funding for foreign military missions, supporting forces in Iraq, Afghanistan , Lebanon and a NATO-led effort in Libya. The vote came a day after an Italian paratrooper was killed in Afghanistan, the 41st Italian soldier to die while serving there. Legislators held a minute of silence before debating the measure and casting the ballot for another six-month extension. Prime Minister Silvio Berlusconi’s Northern League allies voted to back the extension, signaling support for the premier amid tension within the ruling coalition. The League has been critical of the peacekeeping missions and called for troops to be brought home. The opposition Democratic Party also approved the measure. Italy’s 9,250 troops currently serving abroad will be reduced to 7,222, newspaper Corriere della Sera reported yesterday. Today’s vote, which must be followed by backing in the lower house Chamber of Deputies, approved 694 million euros ($1 billion) in funding for the missions, down from 911 million euros in the first half. To contact the reporter on this story: Andrew Davis in Rome at abdavis@bloomberg.net . To contact the editor responsible for this story: Craig Stirling at cstirling1@bloomberg.net .	NEWS-MULTISOURCE
VLAN question Unanswered Question Jan 14th, 2008 User Badges: is it possible to have a static ip address device connected to a vlan without the vlan ip address assigned. im trying to have all network traffic go to this particular device. • 1 • 2 • 3 • 4 • 5 Overall Rating: 0 (0 ratings) Loading. dabels Mon, 01/14/2008 - 12:11 User Badges: it would be nice to know what type of device you are talking about. if you are using a switch running IOS then yes you can connect a device to a switchport in a vlan and not have the interface have a ip address assigned to it. avionics Mon, 01/14/2008 - 13:17 User Badges: the device that will be connected is a skyX gateway for tcp acceleration. how would i make all the traffic flow through this device. current config attached. the port is fa1/0 where the device resides. Is this possible to have all traffic be routed through fa1/0??? Attachment: dabels Mon, 01/14/2008 - 13:42 User Badges: so you are wanting all traffic coming in to this router from every interface to get routed to the accelerator? if that is correct do they not support something like wccp redirection to force the traffic there? otherwise you may want to have a default route from the route to point to the fa1/0 (this is not a clean way though I would not think). avionics Mon, 01/14/2008 - 13:49 User Badges: the router platform is a 2800 series and i am unsure if it supports the wccp feature. How would i make a default route to direct the traffic through the device? Or how would i configure wccp? what is the best method for what i am trying to do? chris.cumbaa Mon, 01/14/2008 - 14:07 User Badges: If you WANT to configure WCCP, here's a short primer: http://articles.techrepublic.com.com/5100-1035_11-6175637.html I wouldn't think this would be necessary if you are just using the gateway as a web proxy. If you're running a Windows network, you could just push down a group policy with the proxy settings to all of your users. If you want absolutely all outbound traffic diverted to this gateway, then you could configure the default route to point to it: ip route 0.0.0.0 0.0.0.0 avionics Mon, 01/14/2008 - 14:16 User Badges: would i delete the ip classless from my config? what command could i use to diagnose that the traffic is flowing to the right port. avionics Mon, 01/14/2008 - 15:14 User Badges: would i delete the ip classless from my config? what command could i use to diagnose that the traffic is flowing to the right port. chris.cumbaa Tue, 01/15/2008 - 07:20 User Badges: If you are running only strict class A B or C networks, you shouldn't need ip classless on your router. If you are further subnetting any class A B or C networks, then you must use IP classless. If the skyX gateway is between your outbound router interface and the internet then you know the traffic is going through it. If the skyX gateway is networked on the same subnet as the outbound router interface and your default gateway and the new default route has been configured, then all outbound traffic will flow to the skyX gateway. avionics Tue, 01/15/2008 - 08:33 User Badges: could you give me an example of how this config of the interfaces? i listed a config on the prior post. could you help on routing traffic to the fa1/0 port. chris.cumbaa Tue, 01/15/2008 - 08:58 User Badges: If all of fa1/1 - 8 are configured to switchport access vlan 1, then you would have to ip your "interface vlan 1" on your router to the same subnet as your hosts on the fa1/1 - 8 ports. Configure this IP address as the default gateway on your hosts. The default route that I gave you earlier will push all traffic destined for an IP network not known to your router's route table through to the skyx accelerator. If you would like to use a different vlan than 1, just replace all instances of "vlan 1" with "vlan x". Another thing you could do is put the hosts and the skyx gateway device on the same subnet and vlan and use the gateway as your default gateway on your hosts. If you are still having problems, post your current config. avionics Tue, 01/15/2008 - 09:55 User Badges: here is the current config. the sxy x is fa1/0 where all traffic needs to go through. interface FastEthernet0/0 description unsecured test configuration no ip address duplex auto speed auto bridge-group 50 ! interface FastEthernet0/1 no ip address duplex auto speed auto bridge-group 50 ! interface FastEthernet1/0 description "ACCELERATOR" switchport access vlan 100 ! interface FastEthernet1/1 description "DV2" ! interface FastEthernet1/2 description "STAFF4" ! interface FastEthernet1/3 description "STAFF2" ! interface FastEthernet1/4 description "DV1" ! interface FastEthernet1/5 description "STAFF3" ! interface FastEthernet1/6 description "STAFF1" ! interface FastEthernet1/7 description "CSOSTATION" ! interface FastEthernet1/8 shutdown ! interface FastEthernet1/9 shutdown ! interface FastEthernet1/10 shutdown ! interface FastEthernet1/11 shutdown ! interface FastEthernet1/12 shutdown ! interface FastEthernet1/13 shutdown ! interface FastEthernet1/14 shutdown ! interface FastEthernet1/15 shutdown ! interface Vlan1 no ip address bridge-group 50 ! interface Vlan100 ip address 10.10.11.1 255.255.255.0 ! interface BVI50 ip address 10.10.10.2 255.255.255.0 ! ip classless ! ip http server ! ! control-plane ! bridge 50 protocol ieee bridge 50 route ip ! line con 0 password 5152 login line aux 0 line vty 0 4 privilege level 15 password 5152 login transport input telnet line vty 5 15 password 5152 login transport input telnet ! scheduler allocate 20000 1000 ! end SIPRNet# chris.cumbaa Tue, 01/15/2008 - 10:53 User Badges: Throw one of your devices on vlan 100 and give it an IP address in that subnet. Set the gateway to your accelerator. Test the connection. I assume there is some way to view connections on the accelerator. If that works, create a user vlan. IP the vlan interface. Make that IP address the default gateway for your users. Place your user interfaces in the newly created user vlan. Enter in the default route in global config mode: ip route 0.0.0.0 0.0.0.0 10.10.11.2 --Change the 10.10.11.2 to the ip address of your accelerator. Actions This Discussion	ESSENTIALAI-STEM
Summary Eligibility for people ages 18-65 (full criteria) Location at UCLA Dates study started estimated completion Principal Investigator by Michelle Craske (ucla) Description Summary Specific phobias and other anxiety disorders represent a major mental health problem, and present a significant challenge to researchers because effective treatment usually involves repeated exposure to feared stimuli, and the high levels of associated distress can lead to termination of treatment. Recent advances in computational functional magnetic resonance imaging (fMRI) provide a method by which individuals may be unconsciously exposed to fearful stimuli, leading to effective fear reduction while eliminating a primary cause of attrition. The objective of the current study is to use the novel approach of neuro-reinforcement based on decoded fMRI information to reduce fear responses to fearful stimuli (e.g., spiders, heights) in individuals with phobias, directly and unconsciously in the brain, without repeatedly exposing participants to their feared stimuli. Participants will be randomized into one of three groups of varying neuro-reinforcement sessions (1, 3, or 5). They will complete tests of subjective fear and directed attention while being scanned by fMRI to measure engagement of amygdala activity to fearful stimuli as well as measured through other indicators of fear such as skin conductance response. Details Anxiety disorders, the most common group of mental disorders in the United States, represent a major mental health problem. Phobias, in which fear and anxiety are triggered by a specific stimulus or situation, are the largest category of anxiety disorders and affect 5 - 12% of the world's population. Exposure-based therapies are effective in reducing symptoms, but their effectiveness depends on the individual's capacity or willingness to consciously confront their feared object. The associated distress can be so extreme that it prevents patients from seeking treatment, and contributes to attrition from exposure once treatment begins. As a result, there is an unmet need for treatment that minimizes attrition and subjective patient discomfort. The current study uses a novel technique of neuro-reinforcement based on decoded fMRI information to reduce fear responses to fearful stimuli directly and unconsciously without repeatedly exposing participants to those stimuli. The goals are to (1) confirm that our method decreases amygdala reactivity to images of phobic stimuli as well as (2) determine dosage-response optimization. Keywords Phobia unconscious fear extinction anxiety disorders decoded neuro-reinforcement Phobic Disorders Unconscious Neuro-reinforcement Eligibility You can join if… Open to people ages 18-65 • Individual has normal or corrected to normal vision • Individual has normal or corrected to normal hearing • Individual is competent to understand informed consent You CAN'T join if... • Individual is unable to fill in consent form correctly • Individual is unable to respond adequately to screening questions • Individual is unable to maintain focus or to sit during assessment • Individual has history of: neurological disease or defect (e.g., stroke, traumatic brain injury, schizophrenia or other psychological disorders, or seizures) • Individual has vision problems (including cataracts, amblyopia, or glaucoma) • Individual presents with: PTSD, Obsessive Compulsive Disorder, Substance Use Disorder, Current Major Depression, Bipolar Disorder, Psychosis, neurologic diagnoses or unstable serious medical conditions • Individual does not present with more than one object of specific phobia • Individual can touch the phobic object category during the pre¬treatment Behavioral Approach Test without presenting significant distress • Individual is currently prescribed psychotropic medication Location • University of California, Los Angeles accepting new patients Los Angeles California 90095 United States Lead Scientist at University of California Health Details Status accepting new patients Start Date Completion Date (estimated) Sponsor University of California, Los Angeles ID NCT03655262 Study Type Interventional Participants Expecting 30 study participants Last Updated	ESSENTIALAI-STEM
How to fix Laravel showing the directory structure on Apache Prevent Laravel from showing the directory structure and instead show your application when using Apache. Fix laravel showing directory filesThis is done by creating and assigning a new virtual host, to incorporate the /public directory. Once you have downloaded/composer installed the Laravel project or app into /var/www/html Navigate to the Apache virtual hosts configuration directory cd /etc/apache2/sites-available Create a new Apache virtual hosts file sudo nano the_project.conf Add (and edit) in the following and save it <VirtualHost *:80> ServerName domain.com ServerAdmin webmaster@domain.com DocumentRoot /var/www/html/public <Directory /var/www/html> AllowOverride All </Directory> ErrorLog ${APACHE_LOG_DIR}/error.log CustomLog ${APACHE_LOG_DIR}/access.log combined </VirtualHost> Disable the default virtual hosts configuration file for Apache2 sudo a2dissite 000-default.conf Now enable the one created above with sudo a2ensite the_project Enable the Apache rewrite module sudo a2enmod rewrite Restart Apache sudo systemctl restart apache2 When you navigate to the domain or IP address instead of the Laravel files and folders showing it will be the app homepage.	ESSENTIALAI-STEM
Ticketfly takes its websites offline as it scrambles to recover from hack Events ticketing company Ticketfly has been compromised by a digital attack, according to an announcement today on Twitter. “Following recent site issues,” the statement reads, “we determined that Ticketfly has been the target of a cyber incident. To protect our clients and fans, and to secure the website and related data, we have temporarily taken all Ticketfly systems offline.” Billboard says users began noticing site defacement yesterday around 9PM PST. The hacker, who called themselves IsHaKdZ, replaced Ticketfly’s website with a picture of Guy Fawkes and a warning that read “Your Security Down im Not Sorry.” The hacker also left a yandex.com email account and cautioned that they had access to a database titled “backstage,” which holds client information for all of the venues, promoters, and festivals that utilize Ticketfly’s services. Check the homepage. pic.twitter.com/KPDu6PsjIJ The hacker appears to have compromised Ticketfly’s webmaster, as the defaced sites are served with Ticketfly’s HTTPS certificate intact. The hack also affected a number of Ticketfly’s sites simultaneously — including Brooklyn Bowl, Pearl Street Warehouse, and Lafayette Theater — which may have served through the same system. Billboard says engineers were up all night dealing with the damage, and the company has taken everything offline while it continues to investigate. Personal data appears to have been compromised. Motherboard reports it had an email conversation with the hacker, who asked for one bitcoin in exchange for details on Ticketfly’s vulnerability. While the hacker did not respond to this, they pointed toward a server that held allegedly hacked files, including several CSVs with names, home and email addresses, and phone numbers of employees at music venues. The validity of this information has yet to be determined. The Verge reached out to Ticketfly for a statement on the hack. A spokesperson for the company reiterated it was the target of a cyber incident, but was unable to comment on whether anyone’s personal information was breached, saying, “The security of client and customer data is our top priority. We are working tirelessly, and in coordination with leading third-party forensic experts, to get our clients back up and running.” Following recent site issues, we determined that Ticketfly has been the target of a cyber incident. To protect our clients and fans, and to secure the website and related data, we have temporarily taken all Ticketfly systems offline. We’ll keep you updated.	NEWS-MULTISOURCE
Caularthron Caularthron Raf. (1837), abbreviated Cau. in the horticultural trade, is a genus of orchids with 4 species. They are epiphytic orchids with specialized hollow pseudobulbs that house ants. The genus is exclusively found in the tropical regions of southern Mexico, Central America, the West Indies, and northern South America. List of species Species accepted as of May 2014:	WIKI
0 I understand how to register a custom post type, customize the slug and decide whether to add the 'front' (the WP permalink settings) or not. What I'd like to do is customize the permalink by adding ?username At the end of the custom post type's url. Now I know the cleaned up Author Name can be added in the WP permalink settings but I don't want that - I'm looking for the username used to login. For example: I create a custom post type called 'Home' (singular) with the custom slug 'homes.' The url would be: www.mydomain.com/homes/postname I want the url to look like this instead: www.mydomain.com/homes/postname?username I'm not sure how to do it by modifying the usual method of registering a content type: add_action( 'init', 'create_posttype' ); function create_posttype() { register_post_type( 'home', array( 'labels' => array( 'name' => __( 'Homes' ), 'singular_name' => __( 'Home' ) ), 'public' => true, 'has_archive' => true, 'rewrite' => array('slug' => 'homes'), ) ); } I experimented a bit and ended up making my site completely inaccessible so I decided some help would be worth asking for :P 1 • btw I did try setting the WP permalink settings to %postname%?%authorname% Which resulted in 404s. Aug 31, 2014 at 13:47 2 Answers 2 0 Note to curators/admin: I wanted to leave a comment but I didn't have enough reputation. I know I am not formally providing an answer, but attempting to help the person asking the question along. Are you using any membership plugins? Can you give us a little more information on the overall site map and functionality? We are seeing a very narrow field of a bigger question to assess. You're on the right path with the custom post type, but I think there is a better way to go about the situation. I will assume from your provided code example that you have a decent understanding of PHP/Wordpress codex to best help explain what I mean to say would be the best idea here. A more practical approach to generating public facing user profile pages would be a controlling theme function such as /profile/<foo> that looks up relevant user information. From there, you would pass permissions to each profile page to the user, who would need to login and edit their information either through the Wordpress dashboard. Or, users fill out profile information from another front-end page that feeds the public page. If you are getting confused writing custom post types, you may want to install a turn-key solution. Without mentioning any brand names, there are many existing (and free) membership plugins that give the user a public profile + account management area. 1 • The use-case is this: a tutorial website using a membership plugin (Paid Memberships Pro) with an affiliate program. Tutorial authors are the only affiliates and by adding their usernames to the permalink, my goal is to guarantee them commissions from their content. Aug 31, 2014 at 13:45 0 To add query strings to post permalink you should use the post_link filter in combination with the add_query_arg function. add_filter( 'post_link', 'cyb_append_query_string', 10, 3 ); function cyb_append_query_string( $url, $post, $leavename ) { //Change for the post type you want if ( $post->post_type == 'home' ) { $url = add_query_arg( 'username', 'username_value', $url ); } return $url; } If you want to use that query argument in wp_query you should also run the query_vars filter: add_filter( 'query_vars', 'cyb_query_vars' , 10, 1 ); function cyb_query_vars( $qvars ) { $qvars[] = 'username'; return $qvars; } Now you can get the username query var like this: $username = get_query_var( 'username' ); //Or, if working with a WP_Query object $username = $wp_query->get( 'username' ); Your Answer By clicking “Post Your Answer”, you agree to our terms of service, privacy policy and cookie policy Not the answer you're looking for? Browse other questions tagged or ask your own question.	ESSENTIALAI-STEM
I am running a secure kernel version of Mandrake 9.2 (security level 4). When I open a browser page that uses Java scripts or try to run Java programs from the command-line, the kernel kills the app. Below are 2 examples from the /var/log/messages file. One is from Netscape 7.1 being killed by the kernel and the other is from a Java program being killed by the kernel. Does anyone know how to adjust the kernel resource allocations, so that the kernel won't kill my user apps. example 1: Here is /var/log/messages after netscape is kill by the kernel... --snip-- May 2 18:13:42 lt kernel: grsec: signal 11 sent to (java_vm:22598) UID(501) EUID(501), parent (netscape-bin:32224) UID(501) EUID(501) May 2 18:13:42 lt kernel: grsec: signal 11 sent to (java_vm:22598) UID(501) EUID(501), parent (netscape-bin:32224) UID(501) EUID(501) May 2 18:13:42 lt kernel: grsec: signal 6 sent to (java_vm:22598) UID(501) EUID(501), parent (netscape-bin:32224) UID(501) EUID(501) May 2 18:13:42 lt kernel: grsec: attempted resource overstep by requesting 4096 for RLIMIT_CORE against limit 0 by (java_vm:22598) UID(501) EUID(501),parent (netscape-bin:32224) UID(501) EUID(501) --end snip-- example 2: The below example of the kernel killing a Java program... $ java FileViewer # # HotSpot Virtual Machine Error, Internal Error # Please report this error at # http://java.sun.com/cgi-bin/bugreport.cgi # # Java VM: Java HotSpot(TM) Client VM (1.4.2-b28 mixed mode) # # Error ID: 4F533F4C494E55580E43505001C9 # Heap at VM Abort: Heap **************** Another exception has been detected while we were handling last error. Dumping information about last error: ERROR REPORT FILE = (N/A) PC = 0x48e68a88 SIGNAL = 11 FUNCTION NAME = (N/A) OFFSET = 0xFFFFFFFF LIBRARY NAME = (N/A) Please check ERROR REPORT FILE for further information, if there is any. Good bye. Abort /var/log/mesages May 2 19:17:21 lt kernel: grsec: signal 11 sent to (java:28050) UID(501) EUID(501), parent (ksh:15836) UID(501) EUID(501) May 2 19:17:21 lt kernel: grsec: signal 11 sent to (java:28050) UID(501) EUID(501), parent (ksh:15836) UID(501) EUID(501) May 2 19:17:21 lt kernel: grsec: signal 6 sent to (java:28050) UID(501) EUID(501), parent (ksh:15836) UID(501) EUID(501) May 2 19:17:21 lt kernel: grsec: attempted resource overstep by requesting 4096 for RLIMIT_CORE against limit 0 by (java:28050) UID(501) EUID(501), parent (ksh:15836) UID(501) EUID(501)	ESSENTIALAI-STEM
Johnny Pacar Johnny Edward Pacuraru (Păcuraru; born June 6, 1981), known as Johnny Pacar, is an American film and television actor and musician of partial Romanian descent who is best known for his roles as Cody Jackson in the television series Flight 29 Down and as Damon Young on ABC Family's television series Make It or Break It. He also starred in the Disney Channel Original Movie Now You See It..., and had a recurring role as Jimmy Francis in American Dreams. Biography Johnny Pacar was born on June 6, 1981. As a youth he always wanted to entertain people. He was an avid hockey player and always dreamed about one day playing in the NHL. However, he chose a different path when he started acting in drama and local theatre. In high school he formed a few bands driven by his punk rock influences, also getting into drama at school where he began doing high school and local theatre. After graduating at Wayne Memorial High School, he moved from Michigan to Los Angeles in May 2001. After two months there, he got an agent and filmed an international commercial for Sprite and landed a recurring role in Boston Public. Pacar also landed guest roles in Tru Calling, Judging Amy, George Lopez, CSI: Miami, Medium, Eli Stone, and starred in the Disney Channel movie Now You See It... Pacar is best known for being cast as Jackson, a regular on the series Flight 29 Down for NBC/ Discovery Kids. Pacar starred as Damon Young on ABC Family's Make It or Break It, a series about teenage gymnasts striving for the 2012 Olympics. In 2011 he guest-starred in an episode of Warehouse 13 as Dwayne Maddox. The same year he starred opposite Ving Rhames in syfy's Zombie Apocalypse. In 2012 he landed a role in the action thriller Channeling and in the same year his film Playback, opposite Christian Slater, was released. He next starred in the Sony thriller The Remaining, which was released 2014. Pacar won the "Best Supporting Actor" award at the Orlando Film Festival for his performance in Love Hurts. Pacar is pursuing a music career. He released his own solo mini album "Moment of Time" on iTunes, and is in the band "Forever The Day" (formerly "Fairlene" ), along with fellow Make it or Break it co-star Cody Longo. "Forever The Day" released their first EP "Under The Afterglow" on August 16, 2010, and released a second part named "Letters of Letting Go" on February 13, 2012. Pacar released a new solo album named Give It Our Love on March 11, 2013. He currently lives in Los Angeles.	WIKI
Persma Manado Persatuan Sepakbola Manado (simply known as Persma Manado) is an Indonesian football club based in Manado, North Sulawesi. The club was founded in 1960 and currently competes in the Liga 3.	WIKI
1992–93 NCAA Division III men's ice hockey season The 1992–93 NCAA Division III men's ice hockey season began in October 1992 and concluded on March 27 of the following year. This was the 20th season of Division III college ice hockey. The NCAA restarted the Division II Championship for this season and all programs from Division II schools were required to submit bids to the second-tier championship despite continuing to play in a majority Division III conference. Due to the low number and sometimes vast distance between the schools, no Division II conferences were formed, even from the few programs that became independent. The records for all Division II schools that remained in their previous conferences are listed here. Due in part to this new arrangement, ECAC West split and the State University of New York Athletic Conference began officially sponsoring ice hockey. While both conferences, along with ECAC East fell under the ECAC umbrella, ECAC East stopped counting inter-conference games in their standings while ECAC West continued to count games against SUNYAC teams for this season before dropping the practice entirely. The SUNYAC had already been holding a conference schedule to determine which teams participated in the SUNYAC tournament and the conference simply stopped counting non-SUNYAC games for their standings. The NCAA began naming a national Division III player of the year, a counterpart to the Hobey Baker Award. Standings Note: Mini-game are not included in final standings 1993 NCAA tournament Note: * denotes overtime period(s)	WIKI
Lebanese Academy of Sciences The Lebanese Academy of Sciences, known officially by its French name Académie des Sciences du Liban (ASL), is a learned society dedicated to promoting the growth, invigoration, and dissemination of the sciences in Lebanon, and to fostering a world-class scientific culture in the country. The ASL was recognized by a decree of the Government of the Republic of Lebanon in August 2007. Membership in the ASL is a merit-based high honor conferred by election. Mission According to its charter, the ASL aims to * Provide independent advice and guidance to governmental and private institutions on matters of scientific research and education. * Encourage, initiate and aid research and educational programs in the sciences. * Help the dissemination and promulgation of the results of scientific research. * Facilitate the exchange of ideas and results with similar institutions around the world. * Bestow awards and honors on distinguished scientists. * Exhort young Lebanese men and women to consider careers in the sciences. * Strengthen the links between the sciences and society by addressing the needs of the population, public health, the economy and the environment. History The formation of the ASL was shepherded by the French Academy of Sciences, which also hosted the first meeting of the ASL in Paris on June 27, 2008. The first meeting of the ASL's Executive Committee was held in Beirut, Lebanon on October 29–31, 2008. The ASL is broadly fashioned after the French Academy of Sciences, with which it continues to develop joint programs. Members The members of the ASL are prominent Lebanese scientists working inside and outside of Lebanon, as well as distinguished foreign scientists, including some who are of Lebanese origin, or who are keen to contribute to the growth of the sciences in Lebanon. All ASL academicians provide their services pro bono, i.e. voluntarily and without payment, as a public service. ASL Members: * Huda Akil * Sir Michael Atiyah* (deceased 2019) * Jean-François Bach* * Kamal Badr * Georges Bahr (Home Secretary, 2007--, Section of Health/Environment)* * Catherine Bréchignac * André Capron * Ali Hani Chamseddine (Home Secretary, 2018--, Section of Fundamental Sciences/Energy) * Moustafa Chahine (deceased 2011) * Edgar Choueiri (Founding President, 2007-2014)* * Jean Dercourt* (retired) * Charles Elachi * Charbel Farhat * Nesreen Ghaddar (Vice-President) * Makhluf Haddadin * Mohamed Hassan* * George Helou (President, 2014-2018) * Samia Khoury * Fadlo Khuri * André Megarbane * June Nasrallah * (President, 2018--) * Mona Nemer* * Jean-Loup Puget * Yves Quéré* * Mohamed Sayegh * Edward Sion* (Treasurer) * Makram Suidan * Samir Zard* * Hussein M. Zbib * Fuad Ziyadeh * Huda Zoghbi asterisk (*) denotes founding member	WIKI
User:Vanished user 7449738/Evaluate an Article Which article are you evaluating? Harley Davidson and the Marlboro Man Why you have chosen this article to evaluate? I chose this article by (somewhat randomly) looking through C-class articles, under the "Australian Cinema" category. I recalled that this film is set in a future wasteland, making it relevant to our class investigation of post-apocalyptic narratives. Evaluate the article Lead Section: Introductory sentence covers the bases well but there is no lead in to the article sections and several are unaddressed. Otherwise, it is concise and reflects the subject. Content: The article content is relevant to the subject and essentially up to date, considering that the film is over thirty years old. It does not connect to any Wikipedia equity gaps. One potential addition could be star Mickey Rourke's 2016 interview with Alec Baldwin where he discussed his hatred of the film: https://ew.com/article/2016/02/09/alec-baldwin-mickey-rourke-podcast/ Tone and Balance: Article is neutral in tone, particularly since this is a pretty uncontroversial subject. No excessive claims or argumentation. Sources and References: All references are related to technical aspects of production and film reviews, rather than direct information. Several of the included press links (LA Times, NYT, EW) no longer connect to the cited materials due to paywalls and 404 errors. Archived links to those pages would be helpful because there is little recent discussion of this film and contemporary reviews are most pertinent to its reception. Given the nature of the subject, there is little concern regarding peer-reviewed sources or more diverse authorship. Organization and Writing Quality: The plot synopsis is very in-depth, more than I would consider necessary for a wikipedia article on this subject, and written from a somewhat personal (film viewer) point-of-view. I couldn't locate any grammatical or spelling issues beyond some questionable phrasing in the synopsis. The page is properly divided into relevant sections. Images and Media: Article contains a single image, the theatrical poster for the film which is properly attributed and captioned. The article doesn't necessarily require additional images to get its point across but another might make the page "stand out" more. Talk Page Discussion: There are two notes on the talk page, one related to a grammatical/phrasing issue and another related to some of the issues I described with the article's plot synopsis. The article is described as C-Class, lacking proper referencing/citation and coverage/accuracy. It falls within the scope of WikiProject Film and is supported by the American and Australian Cinema Task Forces. The technical note about phrasing was interesting to me, in that it related to a detail I probably wouldn't notice or think to investigate (in regard to the radio station call sign). Wikipedeans are certainly thorough. Overall Impressions: The article is strong but could use some focus and better integration of outside sources. It's quite detailed and comprehensive in its scope, containing information about the film's soundtrack, reception, and use of advertising figures. The biggest issue is that the plot synopsis reads like a friend excitedly telling you the story, rather than a more balanced, encyclopedic tone. I think honing down the synopsis and bringing in some more formal references, if any exist. I would call the article well-developed, since it primarily needs tweaks here and there to bring it to B-Class rather than total redevelopment.	WIKI
Adaptive Spectral Transform for Wavelet-Based Color Image Compression Bayazit U. IEEE TRANSACTIONS ON CIRCUITS AND SYSTEMS FOR VIDEO TECHNOLOGY, vol.21, no.7, pp.983-992, 2011 (SCI-Expanded) identifier identifier Abstract Since different regions of a color image generally exhibit different spectral characteristics, the energy compaction of applying a single spectral transform to all regions is largely inefficient from a compression perspective. Thus, it is proposed that different subsets of wavelet coefficients of a color image be subjected to different spectral transforms before the resultant coefficients are coded by an efficient wavelet coefficient coding scheme such as that used in JPEG2000 or color set partitioning in hierarchical trees (CSPIHT). A quadtree represents the spatial partitioning of the set of high frequency coefficients of the color planes into spatially oriented subsets which may be further partitioned into smaller directionally oriented subsets. The partitioning decisions and decisions to employ fixed or signal-dependent bases for each subset are rate-distortion (R-D) optimized by employing a known analytical R-D model for these coefficient coding schemes. A compression system of asymmetric complexity, that integrates the proposed adaptive spectral transform with the CSPIHT coefficient coding scheme yields average coding gains of 0.3 dB and 0.9 dB in the Y component at 1.0 b/p and 2.5 b/p, respectively, and 0.9 dB and 1.35 dB in the U and V components at 1.0 b/p and 2.5 b/p, respectively, over a reference compression system that integrates the single spectral transform derived from the entire image with the CSPIHT coefficient coding scheme.	ESSENTIALAI-STEM
This Week in Science Science 18 Feb 2005: Vol. 307, Issue 5712, pp. 1009 1. Rabbits and Rodents Arose Relatively Recently CREDIT: ASHER ET AL. Rodents and their close relatives, including rabbits, make up much of the diversity of mammals, but their fossil record is sparse, and the time of divergence from other placental mammals has been controversial, with estimates spanning from near the Cretaceous-Tertiary (K-T) boundary to much earlier times. Asher et al. (p. 1091) now describe several specimens of a fossil rabbit dating to about 50 million years ago that collectively provide a more complete view of early glires (rabbits and rodents). Its primitive features imply that this group had diverged from placental mammals near the K-T boundary. 2. Origins of Olmec Pottery Olmec ceramics are associated with the origination of culture and language in Mesoamerica. Their widespread distribution has raised the questions of whether cultural development was concentrated along the Gulf Coast or arose from the interactions of several societies. Blomster et al. (p. 1068; see the Perspective by Diehl) tested these ideas by using trace-element chemistry of numerous Olmec ceramics to determine their provenance. The data show that all Olmec ceramics originated from the San Lorenzo region of the Gulf Coast, and other wares were not imported into this region. 3. Slicing Through Ammonia During the last 40 years, late transition-metal catalysts have been developed to insert small molecules into H2 and into Si-H, B-H, and C-H bonds. However, a homogeneous catalyst to break the N-H bond in ammonia remains elusive. Zhao et al. (p. 1080) have prepared an iridium compound with an electron-rich alkyl ligand that reacts with ammonia in room-temperature solution. Kinetic and isotopic labeling studies to show that the N-H insertion process occurs from a 14-electron Ir(I) intermediate. The studies could point the way toward a catalyst for ammonia transfer to olefins and other organic substrates. 4. Walking the Walk Conventional walking robots require large amounts of energy and complex control mechanisms. In the 1990s, researchers developed gravitationally propelled bipedal passive-dynamic walking machines that mimic human walking without active control. Collins et al. (p. 1082) have extended these passive-dynamic designs by including simple powered actuators and controllers. The bipedal robot walkers exhibit improved energy efficiency and offer insights into the mechanics of human walking. 5. Oceanic Iron and Atmospheric Oxygen The oxygenation of Earth's atmosphere began 2.3 billion years ago, and some evidence, such as the presence of banded iron formations (BIFs), suggests the oceans remained largely anoxic until 1.8 billion years ago. Rouxel et al. (p. 1088; see the Perspective by Kump) present evidence from sedimentary sulfides which shows that the rise of atmospheric O2 had a direct affect on iron cycling in the ocean and the ocean's redox state. Based on changes they see in the Fe isotopic composition of these rocks, they conclude that most of the Paleoproterozoic ocean became strongly stratified after 2.3 billion years ago, and that BIFs continued to form until 1.8 billion years ago by upwelling of ferrous Fe-rich plumes and rapid oxidation in the oxygenated upper layer of the ocean. 6. High-Energy Flashers In 1994, researchers operating NASA's Compton Gamma-Ray Observatory detected gamma rays emitted toward space from Earth's atmosphere. These unusual emissions appeared to be correlated with lightning and other electrical discharges such as sprites and blue jets. Smith et al. (p. 1085; see the Perspective by Inan) have observed a series of gamma-ray events at energies up to 20 million electron volts in their data from the Reuven Ramaty High Energy Solar Spectroscopic Imager (RHESSI) satellite launched in 2002 to study solar flares. The data lend support to the explanation that a powerful electron-accelerating mechanism in the atmosphere propels particles to relativistic velocities. 7. A Rainbow of Human Variation Individual differences in DNA sequence are the genetic basis of human variability. Hinds et al. (p. 1072; see the cover, the Policy Forum by Duster, and the Perspective by Altshuler and Clark) describe a large, publicly available collection of human genetic variation data consisting of 1.58 million single-nucleotide polymorphisms genotyped in each of 71 individuals. They present an initial characterization of the structure of variation within and among three human populations, and explore the application of these data for uncovering the genetic basis of complex traits. These results represent the first draft of what will eventually be a detailed haplotype map describing human variation. 8. Modeling Conflict, Error, and Decision-Making We constantly have to make decisions based on integrating many types of information (see the Perspective by Ridderinkhof and van den Wildenberg). The anterior cingulate cortex (ACC) and neighboring areas play a role in monitoring and controlling goal-directed behavior, but how it knows that an error has occurred, or that a given set of response processes are in conflict with each other, is unclear. Brown and Braver (p. 1118) developed a computational model that shows how the ACC might represent a prediction of error-likelihood, such that its response to a given task condition is proportional to the perceived likelihood of an error in that condition. Machens et al. (p. 1121) studied a two-stimulus interval decision task in which subjects first perceived an initial stimulus, then held it in working memory, and finally made a decision by comparing it with a second stimulus. A simple mechanistic model for how primates may solve two-interval discrimination tasks suggests a testable mechanistic architecture that bridges the gaps from neural mechanism to neural phenomenology to behavior. 9. Prions at Sites of Inflammation So-called prion diseases, like bovine spongiform encephalopathy (“mad cow” disease), are thought to be caused by infectious proteins (prions) that accumulate in the brain. Neuronal and lymphoid organs have thus been excluded from the food chain with the aim of protecting public health. Under inflammatory conditions, however, immune cells are not confined to lymphoid organs, which suggests that inflammation could shift the tissue tropism of prions. Heikenwalder et al. (p. 1107, published online 20 January 2005) report that in mouse models of prion diseases, conditions that lead to inflammation of the liver, pancreas, or kidney can indeed lead to the accumulation of high levels of prion infectivity within the affected organs through the infiltration of prion-infected immune cells. The findings have far-reaching implications for prion biosafety, for example, if prion-infected farm animals have ongoing inflammation. 10. The Attractive Cockroach The cockroach is despised for good reason, as it is a vector for pathogens and a major cause of allergic disease. Nojima et al. (p. 1104; see the news story by Pennisi) have characterized a sex pheromone from the German cockroach Blatella germanica that may provide a new tool in pest control. The pheromone (blattelaquinone) was purified from adult female cockroaches and characterized as gentisyl quinone isovalerate. In field tests on a cockroach-infested pig farm, adult males, but not nymphs or adult females, were attracted to traps baited with synthetic pheromone. 11. The Roots of Patterning CREDIT: KWAK ET AL. Root hairs develop on the emerging roots of Arabidopsis plants in a regular pattern of tidy files of neatly spaced hairs. A suite of transcription factors manages the fates of root cells in response to lateral inhibition. Kwak et al. (p. 1111, published online 23 December 2004) have now identified a gene termed SCRAMBLED, which encodes a putative receptor-like kinase protein that seems to function as a regulator of the overall transcriptional response. Scrambled enables the developing epidermal cells to interpret their position and establish the appropriate cell type pattern. 12. Keeping Hair Cells Cycling In the mammalian ear, the hair cells critical for hearing and for maintaining balance cease proliferating and differentiate early in life. Thus, hearing loss caused by damaged hair cells is irreversible. Sage et al. (p. 1114, published online 13 January 2005; see the Perspective by Taylor and Forge) have now analyzed the relation between proliferation and differentiation in the mouse by manipulating the expression of one of the retinoblastoma protein family members, which can regulate cell cycle exit. In the absence of the relevant retinoblastoma protein, hair cells of the inner ear can differentiate and yet continue to proliferate. Further research is required to determine whether this effect can be extended to later in life. 13. Trading Bases The action of cytidine deaminase enzymes on nucleic acids and subsequent repair of the resulting lesion can lead to base-pair modification, or “editing” of coding sequences. This process can have beneficial results, as in the case of class switching and somatic mutation of immunoglobulin loci. For a retroviral genome, however, related intracellular editing enzymes can be detrimental to viral replication, and such viruses have evolved mechanisms to counteract the activity of these host proteins. Turelli and Trono (p. 1061) review the evolution and relation of the diverse activity of cytidine deaminases in these different contexts of host defense. 14. Golgin with the Flow There has been much discussion concerning the mechanism of transport through the Golgi apparatus, a stack of flattened membrane cisternae involved in the modification and packaging of secretory and membrane proteins. Malsam et al. (p. 1095) developed a biochemical approach that allows subpopulations of Golgi vesicles bearing proteins known as golgins to be isolated and characterized. Golgin tethers were used as affinity ligands to isolate Golgi vesicles and further analysis revealed the existence of two subpopulations that appear to modulate different flow patterns in the Golgi. The flow patterns through the Golgi will determine the nature and extent of posttranslational modifications within the Golgi complex and so determine the chemical fingerprint of the cell surface. 15. Getting in on the Akt Akt/protein kinase B (PKB) is deregulated in many human cancers. Sarbassov et al.(p. 1098) have identified an enzyme in Drosophila and human cells that initiates its activation. Upon association with the cytoplasmic protein rictor, the cytoplasmic kinase mammalian target of rapamycin (mTOR) phosphorylates a critical hydrophobic motif in Akt/PKB. This modification is required for full activation of Akt/PKB and its subsequent regulation of cell survival. In contrast, association of mTOR with another cytoplasmic protein, raptor, does not target Akt/PKB and is sensitive to the drug rapamycin. Reduced expression of mTOR or rictor blocked Akt/PKB activity, which suggests that the complex may serve as an effective target in cancer cells for drug development. 16. Long-Lived Bone Marrow Precursors Hematopoietic stem cells (HSCs) give rise to all of the cells of the blood, including those of the immune system. The abundance of these cells is determined not only by proliferation, but by whether the developing cells undergo apoptosis, or programmed cell death. Opferman et al. (p. 1101) show that MCL-1 is a critical regulator of this cell death decision in HSCs. MCL-1 is an antiapoptotic factor that prevents activation of the apoptosis-inducing proteins BAX and BAK. Conditional deletion of the MCL-1 gene in mice caused loss of HSCs. When cells lacking MCL-1 were isolated from conditional knockout animals and cultured in vitro, MCL-1 was required to allow stem cell factor to promote survival of bone marrow cell progenitors. Log in to view full text Via your Institution Log in through your institution Log in through your institution	ESSENTIALAI-STEM
Page:To The Lighthouse.pdf/251 was real; the boat and the sail with its patch; Macalister with his earrings; the noise of the waves—all this was real. Thinking this, she was murmuring to herself, "We perished, each alone," for her father's words broke and broke again in her mind, when her father, seeing her gazing so vaguely, began to tease her. Didn't she know the points of the compass? he asked. Didn't she know the North from the South? Did she really think they lived right out there? And he pointed again, and showed her where their house was, there, by those trees. He wished she would try to be more accurate, he said: "Tell me—which is East, which is West?" he said, half laughing at her, half scolding her, for he could not understand the state of mind of any one, not absolutely imbecile, who did not know the points of the compass. Yet she did not know. And seeing her gazing, with her vague, now rather frightened, eyes fixed where no house was Mr. Ramsay forgot his dream; how he walked up and down between the urns on the terrace; how the arms were stretched out to him. He thought, women are always like that; the vagueness of their minds is hopeless; it was a thing he had never been able to understand; but so it was. It had been so with her—his wife. They could not keep anything clearly fixed in their minds. But he had been wrong to be angry with her; more- 249	WIKI
Mnuchin warns of ‘potential’ trade war with China Treasury Secretary Steven Mnuchin insisted on Friday that the U.S. is not currently in a trade war with China — but warned it soon could be. “There is the potential of a trade war,” Mnuchin said during a CNBC interview. “On the one hand, we’re willing to continue negotiations. And on the other hand, the president is absolutely prepared to defend our interests.” The comments come a day after the White House released a statement on Thursday evening saying that President Donald Trump had directed his top trade official to consider whether an additional $100 billion in taxes on Chinese imports would be appropriate under a trade crackdown. Trump‘s threat came after China earlier this week outlined $50 billion in tariffs that it would impose on U.S. exports — including on dozens of agricultural products produced in Trump’s heartland political base — if the White House goes ahead with an earlier wave of planned taxes on $50 billion in Chinese goods. The prospect of a protracted trade war between the world’s two largest economic powers caused global financial markets to drop off sharply in recent days. Although Chinese officials insisted they don’t want a trade war, they are saying that no talks are taking place to ease the trade tensions. That vacuum is worrying political leaders, investors and businesses and workers who rely on exports for their livelihoods. “It seems that the U.S. side has misread the situation and taken an extremely wrong move,” Foreign Ministry spokesman Lu Kang said during a press conference on Friday. “China is well prepared, and we would immediately fight back with force and without hesitation, should the U.S. publish a list of products for the $100 billion tariff increase. We warned the U.S. before that it should not leave anything to chances.” Mnuchin told CNBC he was “in communications” with Beijing, but wouldn’t elaborate further on the talks. He also disputed the claim that the two countries weren’t working toward a compromise on the trade standoff. By the time the markets closed, the Dow Jones industrial average was down more than 570 points, or 2.3 percent, while the broader Standard & Poor’s 500 index was off about 2.2 percent on Friday. Global financial markets have been see-sawed all week as the world's two biggest economies squared off in a war of words while Trump administration officials tried to soothe nervous investors. The market sell-off of Friday was also influenced by weaker-than-expected job creation numbers from the Labor Department. Trump has at times used the stock market performance as an barometer of his economic success, but on Friday, he minimized the drop, saying that the markets have soared under his presidency. “I'm not saying there won’t be a little pain," Trump said on a morning show on 77 WABC Radio New York. "We may take a hit, and you know, ultimately we're going to be much stronger for it, but it's something we have got to do." Any tariffs would not take effect until late May at the earliest, as the administration has pledged to invite public comments and to negotiate with Chinese officials on resolving the trade concerns. The Trump administration argues that Beijing’s policies force U.S. companies to cough up valuable intellectual property in order to do business in the country. Trump, in remarks in West Virginia on Thursday afternoon, complained that Chinese trade policies resulted in the U.S. running a trade deficit with Beijing last year of “almost $500 billion.” He said that most Americans aren’t familiar with the technical points of China’s intellectual property practices, but they understand the outcome. “It doesn’t matter if you understand it or not,” the president said. “You understand the concept of being taken advantage of, and we can’t be taken advantage of any longer.” In comments with reporters on Friday at the White House, National Economic Council Director Larry Kudlow said that tariffs might not be necessary. The administration is weighing whether to give China a list of changes it could make on technology transfer requirements to address the global concerns. “The United States may provide a list of suggestions to China as to what we would like to have come out of this,” Kudlow said. “I cannot guarantee that but it’s something that is under discussion.” He added that tariffs were certainly an option. “I’m not a tariff guy. I don’t like to use tariffs. But sometimes you have to use tariffs to bring countries to their senses,” he told reporters. “I hope this process might not include tariffs. But it may.” He later added that Trump has a good relationship with Chinese President Xi Jinping but up to this point, but that efforts so far to have China change its practices have been "highly unsatisfactory." He anticipates “several months of discussion” with Xi, a process that he hopes will get “China to open up and stop bad practices.” A Chinese official said, however, that the two countries were not engaged in talks on the trade. “For a period of time, financial and economic officials from both sides haven’t had any negotiations on any economic or trade issues,” Chinese Ministry of Commerce spokesman Gao Feng said during a briefing Friday in Beijing, according to Bloomberg. A big question, which American business officials say is still very much in doubt, is whether China is actually willing to negotiate changes to its industrial policies that are the root cause of business complaints from around the world. The Chinese government has said it was open to negotiations, but insisted that the U.S. fiscal policies and export controls are mostly to blame for the huge U.S. trade deficit with China, which totaled a record $375 billion last year. White House trade adviser Peter Navarro had said on Thursday that Mnuchin and U.S. Trade Representative Robert Lighthizer would be leading those talks, but neither the Treasury Department nor the Office of the U.S. Trade Representative has said when and where meetings would take place. Navarro on Friday said Trump hopes to broker a negotiated settlement, but noted that past efforts to resolve U.S. trade concerns through dialogue with Beijing went nowhere. “He’s sending a very clear message to China,” Navarro said of Trump. “He has a great relationship with the president of China. [But] this is business, and this is the kind of business where we have to stand firm against China’s unfair trade practices.” Kudlow, speaking on Fox Business Network on Friday morning, sought to placate free trade advocates and conservatives skeptical of the president’s tactics. He urged them to “just give us another 24 to 48 hours” before the administration’s approach begins yielding results. “This is not a trade war,” he said, reiterating a point that Trump has also made. “You’re going to see what I call a ‘trade coalition of the willing.’” Trump, determined to rebalance America’s trade relationships, has also said he is unafraid of trade wars, which he said last month “are good, and easy to win.” He has suggested that the trade deficit that the U.S. runs with China means any trade war would only hurt Beijing, writing on Twitter that “when you’re already $500 Billion DOWN, you can’t lose!” “We are not in a trade war with China, that war was lost many years ago by the foolish, or incompetent, people who represented the U.S.,” Trump wrote in a different online post earlier this week. “Now we have a Trade Deficit of $500 Billion a year, with Intellectual Property Theft of another $300 Billion. We cannot let this continue!” On Friday morning, Trump took aim at the World Trade Organization, repeating his argument that the international body is unfair to U.S. interests. “China, which is a great economic power, is considered a Developing Nation within the World Trade Organization. They therefore get tremendous perks and advantages, especially over the U.S.” he said in a tweet. “Does anybody think this is fair. We were badly represented. The WTO is unfair to U.S.” While Trump may not fear a trade war, farmers and ranchers across the U.S. heartland are increasingly nervous that a prolonged trade dispute with Beijing would hurt their exports at a time when they are suffering through a long-term slump in commodities prices. “Escalating the potential of a trade war w/ China is reckless and it gambles the livelihoods of US farmers & ranchers across rural America,” Sen. Heidi Heitkamp (D-N.D.) wrote in a tweet, adding that 60 percent of North Dakota’s exports to China are agricultural products. “China’s unfair trade policies need to be reined in but this isn’t the way to do it.” Sen. Ben Sasse (R-Neb.) made a similar argument in a statement on Thursday night. “China is guilty of many things, but the president has no actual plan to win right now,” Sasse said. “He’s threatening to light American agriculture on fire.” Lorraine Woellert, Doug Palmer, Adam Behsudi and John Lauinger contributed to this report.	NEWS-MULTISOURCE
Talk:dibyn dobyn This should be "dibyn-dobyn" with a hyphen See here, with citation: Arafsymudwr (talk) 23:59, 4 November 2023 (UTC)	WIKI
OneFS SupportAssist Provisioning – Part 2 In the previous article in this OneFS SupportAssist series, we reviewed the off-cluster prerequisites for enabling OneFS SupportAssist: 1. Upgrading the cluster to OneFS 9.5. 2. Obtaining the secure access key and PIN. 3. Selecting either direct connectivity or gateway connectivity. 4. If using gateway connectivity, installing Secure Connect Gateway v5.x. In this article, we turn our attention to step 5 – provisioning SupportAssist on the cluster. Note that, as part of this process, we’ll be using the access key and PIN credentials previously obtained from the Dell Support portal in step 2 above. Provisioning SupportAssist on a cluster SupportAssist can be configured from the OneFS 9.5 WebUI by navigating to ‘Cluster management > General settings > SupportAssist’. To initiate the provisioning process on a cluster, click on the ‘Connect SupportAssist’ link, as below: Note that if SupportAssist is unconfigured, the Remote Support page displays the following banner warning of the future deprecation of SRS: Similarly, when unconfigured, the SupportAssist WebUI page also displays verbiage recommending the adoption of SupportAssist: There is also a ‘Connect SupportAssist’ button to begin the provisioning process. 1. Accepting the telemetry notice. Selecting the ‘Configure SupportAssist’ button initiates the following setup wizard. The first step requires checking and accepting the Infrastructure Telemetry Notice: 1. Support Contract. For the next step, enter the details for the primary support contact, as prompted: Or from the CLI using the ‘isi supportassist contacts’ command set. For example: # isi supportassist contacts modify --primary-first-name=Nick --primary-last-name=Trimbee --primary-email=trimbn@isilon.com 1. Establish Connections. Next, complete the ‘Establish Connections’ page This involves the following steps: • Selecting the network pool(s). • Adding the secure access key and PIN, • Configuring either direct or gateway access • Selecting whether to allow remote support, CloudIQ telemetry, and auto case creation. a. Select network pool(s). At least one statically-allocated IPv4 network subnet and pool is required for provisioning SupportAssist. As of OneFS 9.5, does not support IPv6 networking for SupportAssist remote connectivity. However, IPv6 support is planned for a future release. Select one or more network pools or subnets from the options displayed. For example, in this case ‘subnet0pool0’: Or from the CLI: Select one or more static subnet/pools for outbound communication. This can be performed via the following CLI syntax: # isi supportassist settings modify --network-pools="subnet0.pool0" Additionally, if the cluster has the OneFS 9.5 network firewall enabled (‘isi network firewall settings’), ensure that outbound traffic is allowed on port 9443. b. Add secure access key and PIN. In this next step, add the secure access key and pin. These should have been obtained in an earlier step in the provisioning procedure from the following Dell Support site: https://www.dell.com/support/connectivity/product/isilon-onefs.: Alternatively, if configuring SupportAssist via the OneFS CLI, add the key and pin via the following syntax: # isi supportassist provision start --access-key <key> --pin <pin> c. Configure access. i. Direct access. From the WebUI, under ‘Cluster management > General settings > SupportAssist’ select the ‘Connect directly’ button: Or from the CLI. For example, to configure direct access (the default), ensure the following parameter is set: # isi supportassist settings modify --connection-mode direct # isi supportassist settings view \| grep -i "connection mode" Connection mode: direct ii. Gateway access. Alternatively, to connect via a gateway, check the ‘Connect via Secure Connect Gateway’ button: Complete the ‘gateway host’ and ‘gateway port’ fields as appropriate for the environment. Alternatively, to set up a gateway configuration from the CLI, use the ‘isi supportassist settings modify’ syntax. For example, to configure using the gateway FQDN ‘secure-connect-gateway.yourdomain.com’ and the default port ‘9443’: # isi supportassist settings modify --connection-mode gateway # isi supportassist settings view \| grep -i "connection mode" Connection mode: gateway # isi supportassist settings modify --gateway-host secure-connect-gateway.yourdomain.com --gateway-port 9443 When setting up the gateway connectivity option, Secure Connect Gateway v5.0 or later must be deployed within the data center. Note that SupportAssist is incompatible with either ESRS gateway v3.52 or SAE gateway v4. However, Secure Connect Gateway v5.x is backwards compatible with PowerScale OneFS ESRS, which allows the gateway to be provisioned and configured ahead of a cluster upgrade to OneFS 9.5. d. Configure support options. Finally, configure the desired support options: When complete, the WebUI will confirm that SmartConnect is successfully configured and enabled, as follows: Or from the CLI: # isi supportassist settings view Service enabled: Yes Connection State: enabled OneFS Software ID: ELMISL0223BJJC Network Pools: subnet0.pool0, subnet0.testpool1, subnet0.testpool2, subnet0.testpool3, subnet0.testpool4 Connection mode: gateway Gateway host: eng-sea-scgv5stg3.west.isilon.com Gateway port: 9443 Backup Gateway host: eng-sea-scgv5stg.west.isilon.com Backup Gateway port: 9443 Enable Remote Support: Yes Automatic Case Creation: Yes Download enabled: Yes Leave a Reply Your email address will not be published. Required fields are marked *	ESSENTIALAI-STEM
Woodhead railway station Woodhead railway station was a railway station that served the hamlet of Woodhead on the Woodhead Line. History The station was opened on 8 April 1844 by the Sheffield, Ashton-under-Lyne and Manchester Railway. It was served by stopping passenger trains operating on the route from Manchester London Road to Sheffield Victoria. The station was later operated by the Great Central Railway and the London and North Eastern Railway. Second station A new station was opened in 1953 by the Eastern Region of British Railways on a different site in conjunction with the opening of the new Woodhead Tunnel and electrification of the line. The station was closed on 27 July 1964 but the line remained open for passengers trains until 1970 and to freight traffic until 1981.	WIKI
Page:The pink fairy book (IA pinkfairybooklan00lang).pdf/30 14 branches far above the student. Every leaf was alive, and every flower was a beautiful girl’s head, some with dark and shining eyes, others with wonderful blue ones. Every fruit was a glittering star, and there was a marvellous music in the student’s room. The little Goblin had never even dreamt of such a splendid sight, much less seen it. He stood on tiptoe gazing and gazing, till the candle in the attic was put out; the student had blown it out and had gone to bed, but the Goblin remained standing outside listening to the music, which very softly and sweetly was now singing the student a lullaby. ‘I have never seen anything like this!’ said the Goblin. ‘I never expected this! I must stay with the student.’ The little fellow thought it over for he was a sensible Goblin. The he sighed, ‘The student has no jam!’ And on that he went down to the grocer again. And it was a good thing that he did go back, for the tub had nearly worn out the tongue. It had read everything that was inside it, on the one side, and was just going to turn itself round and read from the other side when the Goblin came in and returned the tongue to its owner. But the whole shop, from the till down to the shavings, from that night changed their opinion of the tub, and they looked up to it, and had such faith in it that they were under the impression that when the grocer read the art and drama critiques out of the paper in the evenings, it all came from the tub. But the Goblin could no longer sit quietly listening to the wisdom and intellect downstairs. No, as soon as the light shone in the evening from the attic it seemed to him as though its beams were strong ropes dragging him up, and he had to go and peep through the key-hole. There he felt the sort of feeling we have looking at the great rolling sea in a storm, and he burst into tears. He could not himself say why he wept, but in spite of his	WIKI
Finnish Aviation Museum The Finnish Aviation Museum (Suomen ilmailumuseo, Finlands flygmuseum) is a museum specialising in aircraft, located near Helsinki Airport in Veromies, Vantaa, Finland. History The Aviation Museum Society (Ilmailumuseoyhdistys ry) was founded on 4 December 1969. Opened in 1972, the museum was initially located in the basement of the Helsinki Airport terminal but received its own facilities in 1981. The museum has constantly expanded and today has an office wing, research rooms, aviation library, archive, and an auditorium for 200 people. Currently the museum is owned by the Finnish Aviation Museum Foundation (Suomen Ilmailumuseosäätiö), founded in 1996. Exhibition The museum displays some 9,600 items, and the library has over 16,000 books and 160,000 aviation-related magazines. Furthermore, the museum has a large collection of flight instruction and service books. There are also some 78,000 photographs, negatives, and slides. The archive spans some 1,800 shelf metres. The whole collection comprises some 80 aircraft, of which 22 are gliders. The following is a list of some of the more noteworthy aircraft: A complete list can be found at the museum's web page.	WIKI
Optimal bounds for the colorful fractional Helly theorem Denys Bulavka KAM December 10, 2020, 12:30 in Zoom (Meeting ID: 961 1803 1616; Passcode: 792068 ) Abstract The well known fractional Helly theorem and colorful Helly theorem can be merged into so called colorful fractional Helly theorem. It states: For every alpha in (0, 1] and every non-negative integer d, there is beta = beta(alpha, d) in (0, 1] with the following property. Let F_1, ..., F_{d+1} be finite nonempty families of convex sets in R^d of sizes n_1, ..., n_{d+1} respectively. If at least alpha n_1 n_2 ... n_{d+1} of the colorful (d+1)-tuples have a nonempty intersection, then there is i in [d+1] such that F_i contains a subfamily of size at least b n_i. (A colorful (d+1)-tuple is a (d+1)-tuple (C_1,...,C_{d+1}) such that C_i belongs to F_i for every i.) The colorful fractional Helly theorem was first stated and proved by Bárány, Fodor, Montejano, Oliveros, and Pór in 2014 with beta = alpha/(d+1). In 2017 Kim proved the theorem with better function beta, which in particular tends to 1 when alpha tends to 1. Kim also conjectured what is the optimal bound for beta(alpha, d) and provided the upper bound example for the optimal bound. The conjectured bound coincides with the optimal bounds for the (non-colorful) fractional Helly theorem proved independently by Eckhoff and Kalai around 1984. We prove Kim's conjecture by extending Kalai's approach to the colorful scenario. Moreover, we obtain bounds for other collections of sets, not just colorful (d+1)-tuples. This is a joint work with Afshin Goodarzi and Martin Tancer.	ESSENTIALAI-STEM
[Date Prev][Date Next][Thread Prev][Thread Next][Date Index][Thread Index] [modeller_usage] model.loops crosses chains Hello -- In the process of using model.loops to identify regions that I will need to model in a multi-chain situation, I have noticed that it returns insertions between chains as a single loop. Furthermore, when specifying insertion_ext > 0, if the loop is at the N- or C-terminus of a chain in the middle of the molecule, the extension crosses to the next chain. Are these two intended behaviors? For the first case, this complicates things for me since I would like to apply restraints to each loop separately (which means I need to split up a couple of the loops returned). For the second case, I feel like this may not be the intended behavior since the C terminus of one chain and the N terminus of the next can be far apart in space. Thanks, Shyam ## Reproducible for the first case (can be modified to show the second) ## wget https://files.rcsb.org/download/5KXI.pdb ## remove residues A 74 and B 1 # contents of alignment file: 5xki_fill.aln >P1;2abx structureX:2abx: 1 :A:+148 :B:MOL_ID 1; MOLECULE ALPHA-BUNGAROTOXIN; CHAIN A, B; ENGINEERED YES:MOL_ID 1; ORGANISM_SCIENTIFIC BUNGARUS MULTICINCTUS; ORGANISM_COMMON MANY-BANDED KRAIT; ORGANISM_TAXID 8616; TISSUE VENOM: 2.50: 0.24 IVCHTTATIPSSAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNHPPKRQP-/ -VCHTTATIPSSAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNHPPKRQPG* >P1;2abx_fill sequence::::::::: IVCHTTATIPSSAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNHPPKRQPG/ IVCHTTATIPSSAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNHPPKRQPG* # modeller code from modeller import environ, selection from modeller.automodel import automodel class MyModel(automodel): # only refine loop regions def select_atoms(self): aln = self.read_alignment() loops = self.loops(aln, minlength=1, maxlength=100, insertion_ext=0, deletion_ext=0) for i in loops[0]: print(i) raise ValueError("stop here") return selection(loops).only_std_residues() env = environ() env.io.atom_files_directory = ['.'] a = MyModel(env, alnfile = '2abx_fill.aln', # alignment filename knowns = '2abx', # codes of the templates sequence = '2abx_fill') # code of the target a.starting_model = 5 # index of the first model a.ending_model = 5 # index of the last model # (determines how many models to calculate) a.make() # do the actual comparative modeling	ESSENTIALAI-STEM
Local File Inclusions, explained When building a web application, developers must focus on both user functionality and user security. A single security issue can have a dramatic impact on the credibility of your organization and the security of your users. Server-side scripting languages, like PHP and JavaScript, use inclusions to open files. An “inclusion” refers to dynamically loading a file that your application needs. However, when not properly implemented and validated, file inclusions can be exploited by unscrupulous actors to open up other local files on your server. This article discusses the ins and outs of local file inclusions: how they work, what the impacts of local file inclusion vulnerabilities may be, and how to prevent them. Let’s get started! What is a local file inclusion? A local file inclusion happens with certain programming languages when a server dynamically loads a file into the application. A malicious person can abuse a local file inclusion to open files you don’t want them to open. This exploit happens when user input is not sanitized, which means user-entered information that might be unsafe is left exposed. For example, it’s unsafe to allow user input to directly construct a file path because this opens up an opportunity to add a malicious input path. Let’s take a look at local file inclusion attacks for both PHP and JavaScript. Use case: PHP local file inclusion A very simple example of a local file inclusion attack using PHP can be seen below. Here, we request user input to determine which file to open through the file parameter. Next, we directly use the $file variable in the include statement. As you can see, when you pass blog.php as input, you get the following path: directory/blog.php. However, when we pass ../../../etc/passwd, we get a malicious path that opens up the possibility for the user to access a sensitive system file: directory/../../../etc/passwd. The passwd file contains sensitive system data, namely, passwords. Tip: Check out the PHP security checklist by Sqreen. Use case: JavaScript local file inclusion Local file inclusion attacks are also possible with JavaScript. For example, your application may read data from a file. The I/O function expects a file path from which to read data. To construct this path, we use a function that joins a base path with a path input by the user. Again, if you don’t validate the user input, a malicious path can be constructed. Here’s an example of such an attack with JavaScript. As you can see, if you do not validate the inputPath parameter, a user can directly add malicious input to the path.join function for JavaScript. For example, as seen above, a path such as ../.env, tries to access the environments file for your application that contains lots of secrets. Tip: Download the Node.js Security handbook to improve the security of your Node.js apps. What’s the impact of a local file inclusion vulnerability? Local file inclusion vulnerabilities can impact your web application in various ways. For example, here are three possible abusive outcomes of local file inclusions: • Information disclosure • Directory traversal • Remote code execution Let’s take a closer look at each of these outcomes. 1. Information disclosure First of all, a local file inclusion vulnerability can lead to information disclosure. For example, you might expose a certain text file that contains information about the application. An attacker could gain access to a README file that describes important configurations of your web application. Often, information disclosure isn’t the worst outcome. However, when attackers gain important information about your application and its configuration, it helps them find other vulnerabilities and they gain a deeper understanding of your web application. 2. Directory traversal Second, a local file inclusion vulnerability opens up the possibility of a directory traversal attack. Here, attackers try to access files on the server, other than the files of the web application, that provide them with important information. For example, accessing a log file can furnish attackers with valuable information about problems the web server experiences: think of error log files that often expose paths to sensitive files or reveal an application’s structure. Another example is that an incorrectly configured server might give attackers access to user config files, such as /.bash_profile, which contains user configurations and exposes shell variables. Once they have this, attackers can access any other system file on your server. Furthermore, the attackers can gain administrator access to your server! 3. Remote code execution Lastly, a local file inclusion vulnerability combined with a file upload vulnerability can even lead to a remote code execution attack. If attackers manage to upload an unwanted file to your server, they can abuse the local file inclusion vulnerability to execute that file. Worst case scenario, the local file inclusion vulnerability lets the attacker upload a file to the server that gives them the ability to execute arbitrary commands remotely. This gives the attacker the opportunity to control the server remotely. How to prevent local file inclusion? Next, we describe different strategies to prevent local file inclusion attacks. The first and foremost lines of defense are sanitizing and validating user input. Never use unvalidated input for a dynamic file inclusion function. Here are a couple of strategies to prevent local file inclusion attacks. 1. Whitelist accessible pages The simplest method to avoid a local file inclusion attack is to whitelist the pages users can visit. In other words, you define an array that holds all accessible pages. Whenever a user requests a page that’s not whitelisted, you display an error message. A shortcoming of this method is that it is not a scalable approach. Every time you want to add a new page, you’ll have to update the array. Besides that, when you have multiple dynamic inclusion functions in your web application, you’ll have to maintain a whitelisted pages array for each inclusion function. In other words, the whitelisting approach is prone to human error. 2. Limit directory access PHP offers an open_basedir function that allows you to limit the files that PHP can access in your filesystem. For example, you want to prevent users from accessing files outside of the root folder of your web server, such as the system passwords file /etc/passwd. The open_basedir function is an easy way to tell PHP which files it can access and which files it can’t. However, attackers can still open files within the boundaries you’ve set and gain a deeper understanding of your web app. For example, you can’t block access to an upload folder because your application requires access to upload files. 3. Assign IDs to file paths Assign a random ID to every file path that users will have access to. Next, store both the random ID and associated file path in your database so you can easily retrieve them. The first benefit here is that attackers would need to gain access to your database to understand the connection between IDs and file paths. The second benefit is that whenever users visit a certain page, they get to see only the ID for that file path and not to the file path itself. This way, malicious users can’t gain any information about the file structure of your application because an ID can refer to any file path in the same folder or in any underlying folder. Wrapping up and learning more I hope you learned a bit about local file inclusion attacks and how you can prevent them. We hope that having a better understanding of how such attacks can happen will help you prevent them. The best defense is to avoid loading files dynamically. If you face a situation where you do have to load files dynamically, make sure to implement the right security measures, like limiting directory access, whitelisting pages, and using random IDs to represent file paths. In short, develop a web application with security in mind. Take a look at the OWASP top 10 security vulnerabilities to learn about other types of web application attacks. If you want to learn more about preventing local file inclusion attacks in your application, sign up for a free trial of Sqreen. Tools like Sqreen can monitor and protect your web apps in production so you can get alerted or block attacks like local file inclusion attacks in real time. —- This post was written by Michiel Mulders. Michiel is a passionate blockchain developer who loves writing technical content. Besides that, he loves learning about marketing, UX psychology, and entrepreneurship. When he’s not writing, he’s probably enjoying a Belgian beer! Subscribe Notify of guest 1 Comment Oldest Newest Most Voted Inline Feedbacks View all comments You May Also Like	ESSENTIALAI-STEM
Draft:Brandon Schrader Brandon Schrader (born June 17, 1994) is an American National Hockey League (NHL) referee. He officiated his first career NHL game on March 1, 2019. As a player, Schrader was a defensemen. He played with the Wenatchee Wild of the North American Hockey League and the Buffalo Jr. Sabres. He wears uniform number 34.	WIKI
, Volume 28, Issue 4, pp 739-750 Aerobic fermentation in tobacco pollen Rent the article at a discount Rent now * Final gross prices may vary according to local VAT. Get Access Abstract We characterized the genes coding for the two dedicated enzymes of ethanolic fermentation, alcohol dehydrogenase (ADH) and pyruvate decarboxylase (PDC), and show that they are functional in pollen. Two PDC-encoding genes were isolated, which displayed reciprocal regulation: PDC1 was anaerobically induced in leaves, whereas PDC2 mRNA was absent in leaves, but constitutively present in pollen. A flux through the ethanolic fermentation pathway could be measured in pollen under all tested environmental and developmental conditions. Surprisingly, the major factor influencing the rate of ethanol production was not oxygen availability, but the composition of the incubation medium. Under optimal conditions for pollen tube growth, approximately two-thirds of the carbon consumed was fermented, and ethanol accumulated into the surrounding medium to a concentration exceeding 100 mM.	ESSENTIALAI-STEM
What is diabetic ketoacidosis? Diabetic ketoacidosis (DKA) is a life-threatening condition caused by a build-up of waste products called ketones in the blood. It occurs in people with diabetes mellitus when they have no, or very low levels of, insulin. DKA mostly occurs in people with type 1 diabetes, but it can also occur in some people with type 2 diabetes and pregnant women with gestational diabetes. Insulin A hormone secreted by the pancreas in order to regulate glucose levels in the body's cells, which is used for energy. Causes Glucose is an essential energy source for the body's cells. When food containing carbohydrates is eaten, it is broken down into glucose that travels around the body in the blood, to be absorbed by cells that use it for energy. Insulin works to help glucose pass into cells. Without insulin, the cells cannot absorb glucose to use for energy. This leads to a series of changes in metabolism that can affect the whole body. The liver attempts to compensate for the lack of energy in the cells by producing more glucose, leading to increased levels of glucose in the blood, also known as hyperglycaemia. The body switches to burning its stores of fat instead of glucose to produce energy. This leads to a build-up of acidic waste products called ketones in the blood and urine. This is known as ketoacidosis, and it can cause heart rhythm abnormalities, breathing changes and abdominal pain. The kidneys try to remove some of the excess glucose and ketones. However, this requires taking large amounts of fluid from the body, which leads to dehydration. This can cause: • Increased concentration of ketones in the blood, worsening the ketoacidosis; • Loss of electrolytes such as potassium and salt that are vital for the normal function of the body's cells, and; • Very low blood pressure that can lead to shock and failure of vital organs. Blood pressure The pressure the blood places on the walls of the arteries, largely mirroring the contraction of the heart, and consisting of two readings. The higher reading is systolic blood pressure, when the heart contracts, and the lower is diastolic blood pressure, when the heart is relaxed. Glucose A simple sugar found in many foods (such as fruit) that functions as a major energy source for the body. Insulin A hormone secreted by the pancreas in order to regulate glucose levels in the body's cells, which is used for energy. Kidneys A pair of organs responsible primarily for regulating the water balance in the body and filtering the blood. Liver A large, internal organ of the body, located on the upper right-hand side of the abdomen. The liver has hundreds of distinct functions, including producing bile, regulating the body's metabolism and detoxifying the blood. Metabolism The sum of all chemical changes that take place within an organism to maintain growth and development and convert food into energy and building blocks. Shock A life-threatening condition in which the organs and other tissues do not receive adequate blood flow. Abdominal Relating to the abdomen, the middle portion of the trunk which contains organs such as the intestines, stomach and liver. Potassium A water-soluble compound and major mineral that is essential for maintaining contractions of muscles, including the heart. Risk factors For people with type 1 diabetes, factors that can increase the risk of DKA include: • Missing insulin injections, or insulin pump doses; • Bacterial infections, such as urinary tract infections, or other illnesses; • Alcohol use; • Surgery or injury, and; • Emotional stress. The risks are highest in the period just before diabetes is diagnosed. The symptoms of DKA may be the first sign of type 1 diabetes. Younger people - particularly in their teens - with type 1 diabetes tend to be at greater risk of developing DKA. DKA is much less common in people with type 2 diabetes, but factors that can increase the risk include: Pregnant women who have pre-existing diabetes or develop gestational diabetes during pregnancy can also be at risk of developing ketoacidosis. Insulin A hormone secreted by the pancreas in order to regulate glucose levels in the body's cells, which is used for energy. Pancreatitis Inflammation of the pancreas. Sepsis An illness caused by inflammation throughout the body in response to an infection. It can be life-threatening if it leads to septic shock, a dramatic loss of blood pressure. Stress The word ‘stress’ can have a variety of meanings, but generally describes the physical and mental responses of the body to a demand placed upon it. Often used to describe conditions where the demand is high or unable to be resolved and creates anxiety and tension. Bacterial Relating to bacteria, which are microscopic organisms with DNA, but no definite nucleus. They are capable of causing many diseases in humans. Bacterial Relating to bacteria, which are microscopic organisms with DNA, but no definite nucleus. Signs and symptoms Symptoms of DKA can develop over the course of hours. They can include: • Increased thirst; • Increased frequency of urination; • Abdominal pains, which can be severe; • Nausea and vomiting; • Shortness of breath and rapid breathing; • A fruity smell to the breath, similar to the smell of nail polish; • Drowsiness and confusion; • Flushed cheeks; • Headache, and; • General weakness and fatigue. DKA can rapidly cause severe dehydration. People who self-test their own blood and urine may notice: • Higher blood glucose levels, and; • Higher ketone levels in the urine. If you notice signs or symptoms of DKA, it is important to contact your doctor immediately or seek emergency treatment. This is the case even if there has not been a previous diagnosis of diabetes. Fatigue A state of exhaustion and weakness. Glucose A simple sugar found in many foods (such as fruit) that functions as a major energy source for the body. Nausea A sensation of sickness and unease, typically felt in the stomach, often accompanied by the urge to vomit. Nausea is a common symptom with many possible causes. Abdominal Relating to the abdomen, the middle portion of the trunk which contains organs such as the intestines, stomach and liver. Ketone An acid that is produced by the body during the breakdown of fats for energy. It can be seen in patients with type 1 diabetes mellitus when the body cannot use sugar for energy and breaks down fat instead. Methods for diagnosis Your doctor may ask you about your symptoms, results of any self-testing of blood glucose and ketone levels and any factors that might have triggered DKA. A physical examination can help to evaluate the severity of symptoms. In particular, your doctor may focus on checking for signs of dehydration. Blood tests and urine tests are used to detect DKA by measuring the levels of glucose and ketones. Monitoring blood glucose level using a glucose hand monitor.A hand-held portable glucose measuring device. Other tests may be recommended to detect any underlying conditions that may have triggered the DKA and determine if you have any complications. These can include: • Blood tests for electrolyte levels, such as sodium and potassium; • Amylase test, which detects an enzyme released by the pancreas when it is inflamed; • Arterial blood gas test, which measures levels of oxygen and carbon dioxide in the blood and can measure acidity in the blood; • Glycated haemoglobin test, which can help to determine whether diabetes control is an ongoing problem, or whether it was due to a one-off problem with insulin levels; • Chest X-ray, and; • Electrocardiography (ECG) to check for any heart rhythm abnormalities. Electrolyte Substances that form ions when dissolved in water. These include potassium and sodium minerals that are necessary for normal functioning of the body and all its cells. Glucose A simple sugar found in many foods (such as fruit) that functions as a major energy source for the body. Insulin A hormone secreted by the pancreas in order to regulate glucose levels in the body's cells, which is used for energy. Pancreas An organ located behind the stomach that secretes insulin and glucagon into the bloodstream and digestive enzymes into the intestines. Potassium A water-soluble compound and major mineral that is essential for maintaining contractions of muscles, including the heart. Glycated haemoglobin test A test used to measure long-term levels of glucose in the blood, usually in patients with diabetes. Amylase test A test that measures a specific pancreatic enzyme, called amylase, usually in the blood or urine. It is commonly used as a marker for pancreatic disorders, such as pancreatitis (an inflamed pancreas). Ketone An acid that is produced by the body during the breakdown of fats for energy. It can be seen in patients with type 1 diabetes mellitus when the body cannot use sugar for energy and breaks down fat instead. Electrocardiography A test that uses electrodes placed on the chest and limbs to record the electrical impulses causing the contractions of the heart. Types of treatment DKA usually requires treatment in a hospital. Treatment aims to: • Treat dehydration by replacing lost fluids, either intravenously (IV) or by mouth; • Replacing lost electrolytes to help your cells and organs function correctly, and; • Reduce the high level of glucose in the blood by administering insulin, usually IV. It is important that this treatment be monitored carefully to make sure that glucose and electrolyte levels are maintained at safe levels, or complications may develop. Any underlying conditions that may have triggered DKA may also need treatment. If the DKA is a sign of undiagnosed diabetes, your doctor will develop a plan to help you manage your diabetes. Electrolyte Substances that form ions when dissolved in water. These include potassium and sodium minerals that are necessary for normal functioning of the body and all its cells. Glucose A simple sugar found in many foods (such as fruit) that functions as a major energy source for the body. Insulin A hormone secreted by the pancreas in order to regulate glucose levels in the body's cells, which is used for energy. Potential complications Complications that can occur with treatment of DKA include: Hypoglycaemia If insulin causes blood glucose levels to drop too low, this can cause hypoglycaemia, a serious condition that can cause people to lose consciousness. Hypokalaemia Replacement of fluids to treat dehydration can lead to potassium levels falling too low, known as hypokalaemia. As potassium is vital for the function of muscles, nerves and the heart, this can be dangerous. Cerebral oedema If blood sugar levels change too quickly, it can lead to swelling in the brain (cerebral oedema), particularly in children. In turn, this swelling restricts the flow of oxygen-rich blood to the brain, which can result in the damage or death of brain cells. Careful monitoring of blood glucose and electrolyte levels during treatment can help to prevent these complications. Electrolyte Substances that form ions when dissolved in water. These include potassium and sodium minerals that are necessary for normal functioning of the body and all its cells. Glucose A simple sugar found in many foods (such as fruit) that functions as a major energy source for the body. Insulin A hormone secreted by the pancreas in order to regulate glucose levels in the body's cells, which is used for energy. Nerves One or more fibres that transmit signals of sensation and motion between the brain or spinal cord and other parts of the body. Potassium A water-soluble compound and major mineral that is essential for maintaining contractions of muscles, including the heart. Prognosis With prompt treatment, the prognosis of DKA is generally good. However, every year people still continue to die from diabetic ketoacidosis, often as a result of not seeking treatment early. Prevention While DKA cannot always be prevented, by managing diabetes well, you can significantly reduce the risk of it occurring. Steps you can take include: • Regularly monitoring your blood glucose to make sure it stays within healthy levels. Your doctor can advise on how often you may need to check it; • Checking your ketone levels if advised to do so by your doctor, and; • Taking insulin and/or other diabetes medications as directed by your doctor. Glucose A simple sugar found in many foods (such as fruit) that functions as a major energy source for the body. Insulin A hormone secreted by the pancreas in order to regulate glucose levels in the body's cells, which is used for energy. Ketone An acid that is produced by the body during the breakdown of fats for energy. It can be seen in patients with type 1 diabetes mellitus when the body cannot use sugar for energy and breaks down fat instead. FAQ Frequently asked questions	ESSENTIALAI-STEM
Pre-money valuation "Pre-money valuation" is a term widely used in the private equity and venture capital industries. It refers to the valuation of a company or asset prior to an investment or financing. If an investment adds cash to a company, the company will have a valuation after the investment that is equal to the pre-money valuation plus the cash amount. That is, the pre-money valuation refers to the company's valuation before the investment. It is used by equity investors in the primary market, such as venture capitalists, private equity investors, corporate investors and angel investors. They may use it to determine how much equity they should be issued in return for their investment in the company. This is calculated on a fully diluted basis. For example, all warrants and options issued are taken into account. Startups and venture capital-backed companies usually receive multiple rounds of financing rather than a big lump sum. This is in order to decrease the risk for investors and to motivate entrepreneurs. These rounds are conventionally named Round A, Round B, Round C, etc. Pre-money and post-money valuation concepts apply to each round. Basic formula There are many different methods for valuing a business, but basic formulae include: * $$\text{Post-money valuation} = \text{New investment} \,\cdot\, \frac {\text{Total post investment shares outstanding}}{\text{Shares issued for new investment}}$$ * $$\text{Pre-money valuation} = \text{Post-money valuation} - \text{Investment amount}$$ Round A Shareholders of Widgets, Inc. own 100 shares, which is 100% of equity. If an investor makes a $10 million investment (Round A) into Widgets, Inc. in return for 20 newly issued shares, the post-money valuation of the company will be $60 million. ($10 million * (120 shares / 20 shares) = $60 million). The pre-money valuation in this case will be $50 million ($60 million - $10 million). To calculate the value of the shares, we can divide the Post-Money Valuation by the total number of shares after the financing round. $60 million / 120 shares = $500,000 per share. The initial shareholders dilute their ownership from 100% to 83.33%, where equity stake is calculated by dividing the number of shares owned by the total number of shares (100 shares/120 total shares). '''Series A Cap table Round B Let's assume that the same Widgets, Inc. gets the second round of financing, Round B. A new investor agrees to make a $20 million investment for 30 newly issued shares. If you follow the example above, it has 120 shares outstanding, with 30 newly issued shares. The total of shares after Round B financing will be 150. The Post-money valuation is $20 million * (150 / 30) = $100 million. The Pre-money valuation is equal to the Post-money valuation minus the investment amount – in this case, $80 million ($100 million - $20 million). Using this, we can calculate how much each share is worth by dividing the Post-money valuation by the total number of shares. $100 million / 150 shares = $666,666.66 / share The initial shareholders further dilute their ownership to 100/150 = 66.67%. Series B Cap table Note that for every financing round, this dilutes the ownership of the entrepreneur and any previous investors. Up round and down round Financing rounds can be categorized into three types: up round, down round, and flat round. This categorization may be used to quickly, but imprecisely, determine whether a round has been successful for company stakeholders. The precise definition of these terms has been debated by industry participants. Debate focuses on whether price per share or company valuation (specifically, comparing the current pre-money valuation to the post-money valuation of the previous round) should be used as the metric to categorize the round. The Wall Street Journal considers an up round (down round) to be when capital is raised at a share price above (below) the previous round. Similarly, the WSJ considers a flat round to be when capital is raised at the same share price as the previous round. Furthermore, in a survey of ten attorneys at different Silicon Valley law firms by the WSJ, eight said that share price should be used to categorize the round. However, the other two lawyers surveyed by the WSJ argued that both share price and valuation should be used to categorize the round because it depends on perspective. For example, depending on how the deal is structured (such as how many new shares are issued during the round), it is possible for the share price to drop while the company valuation increases. That may be considered a down round to prior investors and founders but an up round to new investors. Moreover, according to the WSJ, some companies and investors argue that only valuation should be used to categorize the round, not share price. That is, they consider an up round (down round) to be when pre-money valuation of the current round is greater (less) than the post-money valuation of the previous round. Similarly, they consider a flat round to be when the pre-money valuation of the current round is the same as the post-money valuation of the previous round. According to the WSJ's definition, in the examples above, the Series B funding was an up- round investment because its share price ($666,666.66) was higher than the share price of the Series A ($500,000). In other words, if the ratio of current investment and shares to be issued (for ex:- series B investment : shares issued) is greater than the ratio of Previous investment and shares previously issued (for ex:- series A investment : shares previously issued), then it will be up- round investment. If this current ratio is less than previous ratio, then it is down-round investment. If the ratios tie up, then it is flat round investment. Successful, growing companies usually raise equity in a series of up rounds from institutional investors. For example, institutional investors such as venture capital firms, corporate investors, private equity firms, growth equity firms, and hedge funds may participate in up rounds. Eventually, such companies may achieve a successful exit for their investors and stakeholders. For example, the company may go public via an IPO, direct listing, or merger with a SPAC. Alternatively, it may become an M&A target. For example, it may be acquired by larger company or merged with a competitor. In general, down rounds are adverse events for initial shareholders and founders, as they may cause ownership dilution, may damage the company's reputation, and may raise the company's cost of capital going forward. As a result, companies and investors may use financial engineering to structure a deal as an up round, even if the share price only increases by a penny. Down rounds were common during the dot-com crash of 2000–2001 and the global financial crisis of 2008–2009. As a result, a down round may not necessarily reflect poorly on the company. Rather, it may be the result of poor market conditions.	WIKI
Lerd, Ardabil Lerd is a tourist village in Palanga Rural District of Shahrud District, Khalkhal County, Ardabil province, Iran. Language The native people of Lerd speak Tati. Population At the time of the 2006 National Census, the city's population was 2,827 residents in 640 households. The census in 2011 counted 3,523 people in 926 households. The 2016 census measured the population of the city as 3,226 people in 983 households. It was the most populous village in its rural district. Climate Lord is in the mountainous region of the high Agh Dagh Mountain. Tourist attractions This village is considered the tourism pole of Khalkhal County. Among the souvenirs of this village are local women's clothes, dairy products, honey, walnuts, pears, and apples. The tomb of Imamzadeh Mohammad, the famous Sibieh Khani waterfall, and Kokholan-Bar stone cave are located at the entrance of the village. Souvenirs The most famous handicrafts of this village, we can mention the local dress for women (in Tati language: sheh shelwar), which expresses the historical identity of the people of Lerd village.	WIKI
Talk:VF-3 Are we missing more history? Our article states that VF-3 was disestablished in 1924. But the squadron designation was used again, because VF-3 was the fighter squadron the Saratoga's airgroup in the late Thirties, and at the outset of the Pacific War. Best regardsTheBaron0530 (talk) 14:30, 7 March 2018 (UTC)theBaron0530	WIKI
Page:Haaland v. Brackeen.pdf/86 4 member. See 25 U. S. C. §1903(4). If the child resides on Indian tribal lands, then the Indian tribal court has jurisdiction. §1911(a). But, if the child resides within a State, ICWA requires state courts to transfer any proceedings to a tribal court, absent “good cause to the contrary,” upon petition by the child’s parent, custodian, or tribe. §1911(b). Even when the state court retains the proceedings, ICWA replaces state law with a strict set of federal rules. For example, if the State fears that a child is suffering physical or sexual abuse, it must clear a set of hurdles before placing the child in foster care or terminating the parent’s rights. §§§ [sic]1912(a)–(e). If the parent wishes to voluntarily relinquish his or her rights and facilitate an adoption, the child’s tribe has a right to intervene “at any point” and to collaterally attack the court’s decree. §§1911(c), 1914. Moreover, it appears that tribes can enroll children unilaterally, without the parent’s consent. Accordingly, even if the biological parents, the child, the adoptive parents, and the court all agree on what is best for the child, the tribe can intervene at the eleventh hour, without any consent from the parents or child, and block the proceedings. In fact, that is exactly what happened here—the children were unilaterally designated as tribal members by tribes, which then sought to block adoptions that everyone else thought were best for the children involved. And, even though some of those adoptions have now been finalized, it appears that the tribes can collaterally attack them for an indefinite period of time. §1914. Besides these procedural hurdles, ICWA dictates the preferences a court must adhere to when deciding where to place the child. In the typical case, the primary consideration would be the best interests of that child. E.g., Tex. Fam. Code Ann. §153.002 (West 2014); American Law Institute, Principles of the Law of Family Dissolution §2.02 (2002); Friederwitzer v. Friederwitzer, 55 N. Y. 2d 89, 92, 432 N. E. 2d 765, 767 (1982); Karner v. McMahon, 433 Pa.	WIKI
Skip to main content Streaming Data caution Experimental feature Explanation Imagine that you have a slow API call that returns a large amount of data, which is important to display to the user fast as possible, e.g. flight tickets or hotels search results. Waiting for this data at server-side is not optimal, because user will see a blank page for a seconds. Usually, you will run this API call on the client-side, and results will be displayed very later, after this steps: • page response finished • static assets are loaded (JS, CSS) • hydration is completed This problem and possible solution is perfectly illustrated in the remix.run documentation: Diagram info By the way, this feature is heavily inspired by the Remix framework defer + Await API and new React 18 streaming capabilities! So, what is the Deferred Data Fetching and how it can solve the problem? Thanks to the renderToPipeableStream and Suspense API's, and Selective Hydration, we have the ability to run API call on the server-side without waiting for it before send application shell + loading indicator to the client. At client-side, loading indicator will be replaced when API call is finished, and results will be displayed and hydrated significantly faster. Deferred Data Fetching For deferred data fetching, you need to use usual tramvai Actions with deferred: true property, we call it Deferred Actions. Main difference between regular Actions is that Deferred Actions are executed on the server-side without timeout, and not blocking first page response (application shell). For every Deferred Actions will be created a promise, which status will be "teleported" to the client-side after it is resolved (or rejected) at server-side. With new Await component, this unresolved promise will be thrown to nearest Suspense boundary, and fallback will be rendered and sended to the client with application shell. After promise resolve or reject, React will send code to render suspended Await component into the response stream, and tramvai will send promise payload and status to the client. At client side, application shell hydration will be started as soon as possible. For suspended Await component, hydration will be delayed until the promise will be resolved or rejected. Usage Prerequisites For this feature to work, you need to install react>=18 version and enable streaming rendering: import { REACT_SERVER_RENDER_MODE } from '@tramvai/tokens-render'; const provider = provide({ provide: REACT_SERVER_RENDER_MODE, useValue: 'streaming', }); Deferred Actions ⌛ First, create a page actions with new deferred property: import { declareAction } from '@tramvai/core'; const deferredAction = declareAction({ name: 'deferred', deferred: true, fn() { return this.deps.httpClient.get('/slow-endpoint'); }, deps: { httpClient: HTTP_CLIENT, }, }); ⌛ Then, provide this action to page component actions, and Await component. Data will be available in Await children function: import { PageComponent } from '@tramvai/react'; import { Await } from '@tramvai/module-common'; const Page: PageComponent = () => { return ( <> <Header /> <Suspense fallback={<div>Loading...</div>}> <Await action={deferredAction}> {(data) => <div>Result: {JSON.stringify(data)}</div>} </Await> </Suspense> <Footer /> </> ) }; Page.actions = [deferredAction]; export default Page; After that, at page initia load (or with disabled JS) you will see header, footer and Loading... fallback. After API response, data will be teleported to client, and you will see the Result: ... instead of fallback. You can change deferred: true to conditions: { onlyBrowser: true } and compare how slower results render will be. Actions timeout Deferred actions execution time are limited by response stream timeout. How-to Use deferred actions with route dynamic parameters Page with dynamic parameters it is a common case, and have full Deferred Actions support with important nuance - you need to manually subscribe to the route changes in your component where Await is used. Let's update our previous example: import { declareAction } from '@tramvai/core'; import { PageComponent } from '@tramvai/react'; import { Await } from '@tramvai/module-common'; import { useRoute } from '@tinkoff/router'; const deferredAction = declareAction({ name: 'deferred', deferred: true, fn() { const id = this.deps.pageService.getCurrentRoute().params.id; return this.deps.httpClient.get('/slow-endpoint', { query: { id } }); }, deps: { httpClient: HTTP_CLIENT, pageService: PAGE_SERVICE_TOKEN, }, }); const Page: PageComponent = () => { const { params } = useRoute(); return ( <> <Header /> <Suspense fallback={<div>Loading...</div>} key={params.id}> <Await action={deferredAction}> {(data) => <div>Result: {JSON.stringify(data)}</div>} </Await> </Suspense> <Footer /> </> ) }; Page.actions = [deferredAction]; export default Page; Because of the useRoute hook, Await will use correct Deferred Action for current route at first load and after SPA-transitions. Use tramvai lazy inside Await component Deferred Actions have full support with tramvai lazy, sync JS and CSS tags for dynamic import will be injected into the response stream after deferred promise resolve, and will be loaded and parsed before suspended component hydration - no content shifting or hydration errors! Simple example: import { lazy } from '@tramvai/react'; const LazyDataCmp = lazy(() => import('~components/DataCmp')); const RootCmp = () => { return ( <> <Suspense fallback={<div>Loading...</div>}> <Await action={deferredAction}> {(data) => <LazyDataCmp data={data} />} </Await> </Suspense> </> ) }; Use deferred actions data outside React components Deferred Actions + Suspense and Await has one important limitation - deferred data is used only inside React components, and you can't dispatch deferred data to the reducer at server-side in this actions, because only initial state will be passed to client with app shell. Meaning this will not work: const deferredAction = declareAction({ name: 'deferred', deferred: true, async fn() { const { payload } = await this.deps.httpClient.get('/slow-endpoint'); // it is too late, store initial state already sent to client this.dispatch(slowEndpointReducerSuccessEvent(payload)); }, deps: { httpClient: HTTP_CLIENT, }, }); As a workaround, you can wait Deferred Actions manually at client-side in usual action. All deferred actions available in DEFERRED_ACTIONS_MAP_TOKEN. Let's update our first example: // deferredAction without any changes // create a reducer to store deferred data const DeferredState = createReducer({ name: 'deferredState', initialState: { status: 'pending' }, events: { success: (state, payload) => ({ status: 'success', payload }), }, }); // create a browser-only action for data syncronization const deferredStateSyncAction = declareAction({ name: 'deferredStateSync', async fn() { // use deferred action name as a key const deferred = this.deps.deferredActionsMap.get( deferredAction.name ); // wait for deferred promise (in real-world case don't forget to handle error case) await deferred!.promise; // sync deferred data with our new store this.dispatch( deferredState.events.success(deferred!.resolveData) ); }, deps: { deferredActionsMap: DEFERRED_ACTIONS_MAP_TOKEN, }, }); // component will be rendered after Deferred Action resolve const DeferredStateCmp = () => { const syncAction = useActions(deferredStateSyncAction); const state = useStore(deferredState); // run sync action immediately useEffect(() => { syncAction(); }, []); return ( <> {state.status === 'pending' ? ( <div>Loading...</div> ) : ( <div>{`Response: ${state.payload.data}`}</div> )} </> ) } const Page: PageComponent = () => { return ( <> <h1>Deferred State Page</h1> <Suspense fallback={<div>Loading...</div>}> <Await action={deferredAction}> {() => <DeferredStateCmp />} </Await> </Suspense> </> ); }; Page.reducers = [deferredState]; Page.actions = [deferredAction]; export default Page; Without Suspense and Await, tramvai will stream only deferred data to the client, for React all this component will be rendered as app shell, at first HTML chunk.	ESSENTIALAI-STEM
Flying Satellites hydrazine monopropellant system In spacecraft applications, hydrazine monoprops are the most common fuel system. The hydrazine molecule spontaneously decomposes into hydrogen and nitrogen, producing a high-pressure, superheated steam. This hot gas is then sucked into a spin turbine and used to power a spacecraft. Hydrazine also powers many attitude control engines on flying satellites. A conventional hydrazine monoprop is composed of a large propellant tank, a propellant valve, and an injector. Each tank contains about 450 kg of hydrazine. Each tank has one gas valve and a pressure regulator that maintains 200 psia feed pressure to the propellant tanks. These devices are designed for long service life. However, the performance of these systems is somewhat limited. Monopropellant systems, also called single-molecule propulsion systems (SMPS), can be simple and compact. They can work with a small range of substances and are capable of starting and restarting. Since they have low energy requirements, they are ideal for orbit maintenance. However, they have relatively low performance and require an additional substance. Hydrogen peroxide is an alternative bipropellant. Bi-propellant thrusters have a much higher impulse than monoprops. However, they do not lend themselves to downscaling, and performance is significantly reduced due to combustion chamber mixing. Because of the difficulty of thoroughly mixing the propellants, smaller-scale bi-propellant thrusters are usually used for applications that require high impulse primary thrust. For example, a jet engine RL10 expander power cycle has a thrust of 16,500 lbf. Hydrogen peroxide has excellent thermal stability, so it is a good choice as a bipropellant. It has a wide variety of applications, including gas-generator and biowaste gas systems. As with hydrazine, hydrogen peroxide can be reactivated by adding oxygen. If the reactivation is too long, the heat generated is insufficient to produce a propellant flow. On the other hand, if the reactivation is too short, the thrust will be reduced. One way to overcome this problem is to use a composite solid propellant. The chemical product can be tailored to suit specific enthalpy or molecular weight needs. Also, the catalyst bed can be made with sub-millimeter characteristic dimensions, which increases the proportional wall area. With a larger wall, viscous losses are greater. The PRECISE Team has had considerable experience with hydrazine multiphase decomposition. A new model of reaction kinetics is needed to describe the catalysis. Additionally, a new fluid model is required to capture the characteristics of a variable ratio of specific heats. And, full 3D fluid model computations are necessary to capture the boundary layer dominance of the combustion process. While the PRECISE team has a lot of practical experience with hydrazine decomposition, this problem is still not solved. However, the project has developed a two-step mechanism for hydrazine decomposition that is integrated with the WP4.2. The PRECISE team has also improved nozzle design. This includes developing micro coriolis mass flow sensors and a Prandtl-tube sensor with integrated pressure sensors. Another development was the implementation of a 4.5 x 2.5 mm sensor chip, which incorporates 400 mbar full-scale capacitive pressure sensors.	ESSENTIALAI-STEM
A comparison of three gastric lavage methods using the radionuclide gastric emptying study Mahesh Shrestha, Jacob George, Michael J. Chiu, William A. Erdman, James E. Hayes Research output: Contribution to journalArticle 9 Scopus citations Abstract To determine the percentage of liquid gastric contents experimentally removable by available orogastric lavage systems, five healthy young volunteers were asked to ingest 1 mCi of liquid technicium-99m diethylenetriaminepentaacetic acid (Tc 99m-DTPA) mixed with 50 ml tap water. Five minutes afterwards, the radionuclide was lavaged using one of three different techniques-a single syringe method, a closed gravity drainage system, and a closed double syringe method-while continuous radioisotope camera images were taken. Control images, with no lavage performed, were also taken. All of the orogastric lavage methods removed a mean of between 80% and 85% of the stomach contents. The double syringe method was the quickest, while the single syringe method was least tolerated. When compared with control, none of the lavage techniques pushed gastric contents into the duodenum. Thus, in terms of amount of liquid gastric contents removed, there was no one method that removed more than the others. Caution should be exercised in assuming that 80-85% of a liquid gastric ingestion can be removed by lavage in the uncontrolled clinical setting. The use of any orogastric lavage for ingestion evacuation should be undertaken knowing that it is a morbid procedure and usually not necessary. Original languageEnglish (US) Pages (from-to)413-418 Number of pages6 JournalJournal of Emergency Medicine Volume14 Issue number4 DOIs StatePublished - Jan 1 1996 Keywords • Orogastric lavage • gastric decontamination • gastric lavage • radionuclide gastric emptying study • toxic ingestion ASJC Scopus subject areas • Emergency Medicine Fingerprint Dive into the research topics of 'A comparison of three gastric lavage methods using the radionuclide gastric emptying study'. Together they form a unique fingerprint. • Cite this	ESSENTIALAI-STEM
Manuel Herrera Carbuccia Manuel Ramón Herrera Carbuccia (born September 28, 1957) is a judge, lawyer, and teacher from the Dominican Republic. Since 22 December 2011 he has been a justice of the Supreme Court of the Dominican Republic. Biography Herrera Carbuccia comes from a family of lawyers, medics, musicians and poets. He is son of Mercedes Luisa Carbuccia Montalvo, one of the first women to graduate as Doctor of Medicine in San Pedro de Macorís, and Abelardo Herrera Peña, justice of the Supreme Court of the Dominican Republic. He has three sisters: Dora Rosanna Herrera Carbuccia, especialized en Pediatrics; Olga Venecia Herrera Carbuccia, judge of the International Criminal Court in The Hague; and Vanesa Margarita Herrera Carbuccia, a lawyer specialized in municipal issues. Herrera has three children: Jessica, Mercedes Paola, and Manuel de Jesús Herrera.	WIKI

Subsets and Splits

No community queries yet

The top public SQL queries from the community will appear here once available.