contestId
int64 0
1.01k
| index
stringclasses 40
values | name
stringlengths 2
54
| type
stringclasses 2
values | rating
int64 0
3.4k
| tags
listlengths 0
7
| title
stringclasses 393
values | time-limit
stringclasses 7
values | memory-limit
stringclasses 6
values | problem-description
stringlengths 0
2.97k
| input-specification
stringlengths 4
1.87k
| output-specification
stringlengths 4
1.12k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
3.5k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 1
value | testset
stringclasses 9
values | passedTestCount
int64 1
402
| timeConsumedMillis
int64 15
8.06k
| memoryConsumedBytes
int64 0
514M
| code
stringlengths 11
61.4k
| prompt
stringlengths 297
7.35k
| response
stringlengths 25
61.4k
| score
float64 2.82
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
270
|
A
|
Fancy Fence
|
PROGRAMMING
| 1,100
|
[
"geometry",
"implementation",
"math"
] | null | null |
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
|
The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees.
|
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
|
[
"3\n30\n60\n90\n"
] |
[
"NO\nYES\nYES\n"
] |
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square.
| 500
|
[
{
"input": "3\n30\n60\n90",
"output": "NO\nYES\nYES"
},
{
"input": "6\n1\n2\n3\n170\n179\n25",
"output": "NO\nNO\nNO\nYES\nYES\nNO"
}
] | 1,656,705,353
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 3
| 92
| 0
|
t = int(input())
for _ in range(t):
angle = int(input())
i = 3
while True:
total = (i - 2)*180
in_angle = total/i
if in_angle > angle:
print('NO')
break
elif angle == in_angle:
print('YES')
break
i += 1
|
Title: Fancy Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
Input Specification:
The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees.
Output Specification:
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
Demo Input:
['3\n30\n60\n90\n']
Demo Output:
['NO\nYES\nYES\n']
Note:
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square.
|
```python
t = int(input())
for _ in range(t):
angle = int(input())
i = 3
while True:
total = (i - 2)*180
in_angle = total/i
if in_angle > angle:
print('NO')
break
elif angle == in_angle:
print('YES')
break
i += 1
```
| 3
|
|
1,007
|
A
|
Reorder the Array
|
PROGRAMMING
| 1,300
|
[
"combinatorics",
"data structures",
"math",
"sortings",
"two pointers"
] | null | null |
You are given an array of integers. Vasya can permute (change order) its integers. He wants to do it so that as many as possible integers will become on a place where a smaller integer used to stand. Help Vasya find the maximal number of such integers.
For instance, if we are given an array $[10, 20, 30, 40]$, we can permute it so that it becomes $[20, 40, 10, 30]$. Then on the first and the second positions the integers became larger ($20>10$, $40>20$) and did not on the third and the fourth, so for this permutation, the number that Vasya wants to maximize equals $2$. Read the note for the first example, there is one more demonstrative test case.
Help Vasya to permute integers in such way that the number of positions in a new array, where integers are greater than in the original one, is maximal.
|
The first line contains a single integer $n$ ($1 \leq n \leq 10^5$) — the length of the array.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \leq a_i \leq 10^9$) — the elements of the array.
|
Print a single integer — the maximal number of the array's elements which after a permutation will stand on the position where a smaller element stood in the initial array.
|
[
"7\n10 1 1 1 5 5 3\n",
"5\n1 1 1 1 1\n"
] |
[
"4\n",
"0\n"
] |
In the first sample, one of the best permutations is $[1, 5, 5, 3, 10, 1, 1]$. On the positions from second to fifth the elements became larger, so the answer for this permutation is 4.
In the second sample, there is no way to increase any element with a permutation, so the answer is 0.
| 500
|
[
{
"input": "7\n10 1 1 1 5 5 3",
"output": "4"
},
{
"input": "5\n1 1 1 1 1",
"output": "0"
},
{
"input": "6\n300000000 200000000 300000000 200000000 1000000000 300000000",
"output": "3"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "9"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "7\n3 5 2 2 5 2 4",
"output": "4"
},
{
"input": "5\n1 5 4 2 3",
"output": "4"
}
] | 1,685,153,920
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 33
| 93
| 15,564,800
|
from collections import Counter
n=int(input())
p=list(map(int, input().split(' ')))
s=Counter(p)
y=[s[i] for i in s]
y.sort()
y=[0]+y
m=len(y)
ans=0
tem=0
for i in range (0,m):
if y[i]>tem:
ans=ans+(m-i-1)*(y[i]-tem)
tem=y[i]
print(ans)
|
Title: Reorder the Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an array of integers. Vasya can permute (change order) its integers. He wants to do it so that as many as possible integers will become on a place where a smaller integer used to stand. Help Vasya find the maximal number of such integers.
For instance, if we are given an array $[10, 20, 30, 40]$, we can permute it so that it becomes $[20, 40, 10, 30]$. Then on the first and the second positions the integers became larger ($20>10$, $40>20$) and did not on the third and the fourth, so for this permutation, the number that Vasya wants to maximize equals $2$. Read the note for the first example, there is one more demonstrative test case.
Help Vasya to permute integers in such way that the number of positions in a new array, where integers are greater than in the original one, is maximal.
Input Specification:
The first line contains a single integer $n$ ($1 \leq n \leq 10^5$) — the length of the array.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \leq a_i \leq 10^9$) — the elements of the array.
Output Specification:
Print a single integer — the maximal number of the array's elements which after a permutation will stand on the position where a smaller element stood in the initial array.
Demo Input:
['7\n10 1 1 1 5 5 3\n', '5\n1 1 1 1 1\n']
Demo Output:
['4\n', '0\n']
Note:
In the first sample, one of the best permutations is $[1, 5, 5, 3, 10, 1, 1]$. On the positions from second to fifth the elements became larger, so the answer for this permutation is 4.
In the second sample, there is no way to increase any element with a permutation, so the answer is 0.
|
```python
from collections import Counter
n=int(input())
p=list(map(int, input().split(' ')))
s=Counter(p)
y=[s[i] for i in s]
y.sort()
y=[0]+y
m=len(y)
ans=0
tem=0
for i in range (0,m):
if y[i]>tem:
ans=ans+(m-i-1)*(y[i]-tem)
tem=y[i]
print(ans)
```
| 3
|
|
520
|
A
|
Pangram
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
A word or a sentence in some language is called a pangram if all the characters of the alphabet of this language appear in it at least once. Pangrams are often used to demonstrate fonts in printing or test the output devices.
You are given a string consisting of lowercase and uppercase Latin letters. Check whether this string is a pangram. We say that the string contains a letter of the Latin alphabet if this letter occurs in the string in uppercase or lowercase.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of characters in the string.
The second line contains the string. The string consists only of uppercase and lowercase Latin letters.
|
Output "YES", if the string is a pangram and "NO" otherwise.
|
[
"12\ntoosmallword\n",
"35\nTheQuickBrownFoxJumpsOverTheLazyDog\n"
] |
[
"NO\n",
"YES\n"
] |
none
| 500
|
[
{
"input": "12\ntoosmallword",
"output": "NO"
},
{
"input": "35\nTheQuickBrownFoxJumpsOverTheLazyDog",
"output": "YES"
},
{
"input": "1\na",
"output": "NO"
},
{
"input": "26\nqwertyuiopasdfghjklzxcvbnm",
"output": "YES"
},
{
"input": "26\nABCDEFGHIJKLMNOPQRSTUVWXYZ",
"output": "YES"
},
{
"input": "48\nthereisasyetinsufficientdataforameaningfulanswer",
"output": "NO"
},
{
"input": "30\nToBeOrNotToBeThatIsTheQuestion",
"output": "NO"
},
{
"input": "30\njackdawslovemybigsphinxofquarz",
"output": "NO"
},
{
"input": "31\nTHEFIVEBOXINGWIZARDSJUMPQUICKLY",
"output": "YES"
},
{
"input": "26\naaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "NO"
},
{
"input": "26\nMGJYIZDKsbhpVeNFlquRTcWoAx",
"output": "YES"
},
{
"input": "26\nfWMOhAPsbIVtyUEZrGNQXDklCJ",
"output": "YES"
},
{
"input": "26\nngPMVFSThiRCwLEuyOAbKxQzDJ",
"output": "YES"
},
{
"input": "25\nnxYTzLFwzNolAumjgcAboyxAj",
"output": "NO"
},
{
"input": "26\npRWdodGdxUESvcScPGbUoooZsC",
"output": "NO"
},
{
"input": "66\nBovdMlDzTaqKllZILFVfxbLGsRnzmtVVTmqiIDTYrossLEPlmsPrkUYtWEsGHVOnFj",
"output": "NO"
},
{
"input": "100\nmKtsiDRJypUieHIkvJaMFkwaKxcCIbBszZQLIyPpCDCjhNpAnYFngLjRpnKWpKWtGnwoSteeZXuFHWQxxxOpFlNeYTwKocsXuCoa",
"output": "YES"
},
{
"input": "26\nEoqxUbsLjPytUHMiFnvcGWZdRK",
"output": "NO"
},
{
"input": "26\nvCUFRKElZOnjmXGylWQaHDiPst",
"output": "NO"
},
{
"input": "26\nWtrPuaHdXLKJMsnvQfgOiJZBEY",
"output": "NO"
},
{
"input": "26\npGiFluRteQwkaVoPszJyNBChxM",
"output": "NO"
},
{
"input": "26\ncTUpqjPmANrdbzSFhlWIoKxgVY",
"output": "NO"
},
{
"input": "26\nLndjgvAEuICHKxPwqYztosrmBN",
"output": "NO"
},
{
"input": "26\nMdaXJrCipnOZLykfqHWEStevbU",
"output": "NO"
},
{
"input": "26\nEjDWsVxfKTqGXRnUMOLYcIzPba",
"output": "NO"
},
{
"input": "26\nxKwzRMpunYaqsdfaBgJcVElTHo",
"output": "NO"
},
{
"input": "26\nnRYUQsTwCPLZkgshfEXvBdoiMa",
"output": "NO"
},
{
"input": "26\nHNCQPfJutyAlDGsvRxZWMEbIdO",
"output": "NO"
},
{
"input": "26\nDaHJIpvKznQcmUyWsTGObXRFDe",
"output": "NO"
},
{
"input": "26\nkqvAnFAiRhzlJbtyuWedXSPcOG",
"output": "NO"
},
{
"input": "26\nhlrvgdwsIOyjcmUZXtAKEqoBpF",
"output": "NO"
},
{
"input": "26\njLfXXiMhBTcAwQVReGnpKzdsYu",
"output": "NO"
},
{
"input": "26\nlNMcVuwItjxRBGAekjhyDsQOzf",
"output": "NO"
},
{
"input": "26\nRkSwbNoYldUGtAZvpFMcxhIJFE",
"output": "NO"
},
{
"input": "26\nDqspXZJTuONYieKgaHLMBwfVSC",
"output": "NO"
},
{
"input": "26\necOyUkqNljFHRVXtIpWabGMLDz",
"output": "NO"
},
{
"input": "26\nEKAvqZhBnPmVCDRlgWJfOusxYI",
"output": "NO"
},
{
"input": "26\naLbgqeYchKdMrsZxIPFvTOWNjA",
"output": "NO"
},
{
"input": "26\nxfpBLsndiqtacOCHGmeWUjRkYz",
"output": "NO"
},
{
"input": "26\nXsbRKtqleZPNIVCdfUhyagAomJ",
"output": "NO"
},
{
"input": "26\nAmVtbrwquEthZcjKPLiyDgSoNF",
"output": "NO"
},
{
"input": "26\nOhvXDcwqAUmSEPRZGnjFLiKtNB",
"output": "NO"
},
{
"input": "26\nEKWJqCFLRmstxVBdYuinpbhaOg",
"output": "NO"
},
{
"input": "26\nmnbvcxxlkjhgfdsapoiuytrewq",
"output": "NO"
},
{
"input": "26\naAbcdefghijklmnopqrstuvwxy",
"output": "NO"
},
{
"input": "30\nABCDEFGHTYRIOPLabcdefghtyriopl",
"output": "NO"
},
{
"input": "25\nabcdefghijklmnopqrstuvwxy",
"output": "NO"
},
{
"input": "26\nabcdefhijklmnopqrstVxyzABC",
"output": "NO"
},
{
"input": "25\nqwertyuiopasdfghjklxcvbnm",
"output": "NO"
},
{
"input": "34\nTheQuickBrownFoxJumpsOverTheLayDog",
"output": "NO"
},
{
"input": "26\nabcdefghigklmnopqrstuvwxyz",
"output": "NO"
},
{
"input": "26\nabcdefghijklmnopqrstuvwxyA",
"output": "NO"
},
{
"input": "50\nqazwsxedcrfvtgbyhnujmikolQWERTYUIOASDFGHJKLZXCVBNM",
"output": "NO"
},
{
"input": "35\nTheQuickBrownFoxJumpsOverTheLasyDog",
"output": "NO"
},
{
"input": "25\nbcdefghijklmnopqrstuvwxyz",
"output": "NO"
},
{
"input": "38\nAbCdEfGhIjKlMnOpQrStVwXyZzzzzzzaaaaaaa",
"output": "NO"
},
{
"input": "26\nabcdefghiklmnopqrstvxyzABC",
"output": "NO"
},
{
"input": "26\nabcdefghijklmnopqrstuvwxzZ",
"output": "NO"
},
{
"input": "50\nabcdefghijklmnopqrstuvwxyABCDEFGHIJKLMNOPQRSTUVWXY",
"output": "NO"
}
] | 1,699,184,512
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 59
| 93
| 0
|
str = "abcdefghijklmnopqrstuvwxyz"
list = list(str)
dicList = []
freq = {}
# input goes here ->str input
n = int(input())
s = input().lower()
for char in s:
if char in freq:
freq[char] += 1
#print(freq)
else:
freq[char] = 1
#print(freq)
for key in freq.keys():
dicList.append(key)
if sorted(list) == sorted(dicList):
print("YES")
else:
print("NO")
|
Title: Pangram
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A word or a sentence in some language is called a pangram if all the characters of the alphabet of this language appear in it at least once. Pangrams are often used to demonstrate fonts in printing or test the output devices.
You are given a string consisting of lowercase and uppercase Latin letters. Check whether this string is a pangram. We say that the string contains a letter of the Latin alphabet if this letter occurs in the string in uppercase or lowercase.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of characters in the string.
The second line contains the string. The string consists only of uppercase and lowercase Latin letters.
Output Specification:
Output "YES", if the string is a pangram and "NO" otherwise.
Demo Input:
['12\ntoosmallword\n', '35\nTheQuickBrownFoxJumpsOverTheLazyDog\n']
Demo Output:
['NO\n', 'YES\n']
Note:
none
|
```python
str = "abcdefghijklmnopqrstuvwxyz"
list = list(str)
dicList = []
freq = {}
# input goes here ->str input
n = int(input())
s = input().lower()
for char in s:
if char in freq:
freq[char] += 1
#print(freq)
else:
freq[char] = 1
#print(freq)
for key in freq.keys():
dicList.append(key)
if sorted(list) == sorted(dicList):
print("YES")
else:
print("NO")
```
| 3
|
|
918
|
B
|
Radio Station
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] | null | null |
As the guys fried the radio station facilities, the school principal gave them tasks as a punishment. Dustin's task was to add comments to nginx configuration for school's website. The school has *n* servers. Each server has a name and an ip (names aren't necessarily unique, but ips are). Dustin knows the ip and name of each server. For simplicity, we'll assume that an nginx command is of form "command ip;" where command is a string consisting of English lowercase letter only, and ip is the ip of one of school servers.
Each ip is of form "a.b.c.d" where *a*, *b*, *c* and *d* are non-negative integers less than or equal to 255 (with no leading zeros). The nginx configuration file Dustin has to add comments to has *m* commands. Nobody ever memorizes the ips of servers, so to understand the configuration better, Dustin has to comment the name of server that the ip belongs to at the end of each line (after each command). More formally, if a line is "command ip;" Dustin has to replace it with "command ip; #name" where name is the name of the server with ip equal to ip.
Dustin doesn't know anything about nginx, so he panicked again and his friends asked you to do his task for him.
|
The first line of input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000).
The next *n* lines contain the names and ips of the servers. Each line contains a string name, name of the server and a string ip, ip of the server, separated by space (1<=≤<=|*name*|<=≤<=10, *name* only consists of English lowercase letters). It is guaranteed that all ip are distinct.
The next *m* lines contain the commands in the configuration file. Each line is of form "command ip;" (1<=≤<=|*command*|<=≤<=10, command only consists of English lowercase letters). It is guaranteed that ip belongs to one of the *n* school servers.
|
Print *m* lines, the commands in the configuration file after Dustin did his task.
|
[
"2 2\nmain 192.168.0.2\nreplica 192.168.0.1\nblock 192.168.0.1;\nproxy 192.168.0.2;\n",
"3 5\ngoogle 8.8.8.8\ncodeforces 212.193.33.27\nserver 138.197.64.57\nredirect 138.197.64.57;\nblock 8.8.8.8;\ncf 212.193.33.27;\nunblock 8.8.8.8;\ncheck 138.197.64.57;\n"
] |
[
"block 192.168.0.1; #replica\nproxy 192.168.0.2; #main\n",
"redirect 138.197.64.57; #server\nblock 8.8.8.8; #google\ncf 212.193.33.27; #codeforces\nunblock 8.8.8.8; #google\ncheck 138.197.64.57; #server\n"
] |
none
| 1,000
|
[
{
"input": "2 2\nmain 192.168.0.2\nreplica 192.168.0.1\nblock 192.168.0.1;\nproxy 192.168.0.2;",
"output": "block 192.168.0.1; #replica\nproxy 192.168.0.2; #main"
},
{
"input": "3 5\ngoogle 8.8.8.8\ncodeforces 212.193.33.27\nserver 138.197.64.57\nredirect 138.197.64.57;\nblock 8.8.8.8;\ncf 212.193.33.27;\nunblock 8.8.8.8;\ncheck 138.197.64.57;",
"output": "redirect 138.197.64.57; #server\nblock 8.8.8.8; #google\ncf 212.193.33.27; #codeforces\nunblock 8.8.8.8; #google\ncheck 138.197.64.57; #server"
},
{
"input": "10 10\nittmcs 112.147.123.173\njkt 228.40.73.178\nfwckqtz 88.28.31.198\nkal 224.226.34.213\nnacuyokm 49.57.13.44\nfouynv 243.18.250.17\ns 45.248.83.247\ne 75.69.23.169\nauwoqlch 100.44.219.187\nlkldjq 46.123.169.140\ngjcylatwzi 46.123.169.140;\ndxfi 88.28.31.198;\ngv 46.123.169.140;\nety 88.28.31.198;\notbmgcrn 46.123.169.140;\nw 112.147.123.173;\np 75.69.23.169;\nvdsnigk 46.123.169.140;\nmmc 46.123.169.140;\ngtc 49.57.13.44;",
"output": "gjcylatwzi 46.123.169.140; #lkldjq\ndxfi 88.28.31.198; #fwckqtz\ngv 46.123.169.140; #lkldjq\nety 88.28.31.198; #fwckqtz\notbmgcrn 46.123.169.140; #lkldjq\nw 112.147.123.173; #ittmcs\np 75.69.23.169; #e\nvdsnigk 46.123.169.140; #lkldjq\nmmc 46.123.169.140; #lkldjq\ngtc 49.57.13.44; #nacuyokm"
},
{
"input": "1 1\nervbfot 185.32.99.2\nzygoumbmx 185.32.99.2;",
"output": "zygoumbmx 185.32.99.2; #ervbfot"
},
{
"input": "1 2\ny 245.182.246.189\nlllq 245.182.246.189;\nxds 245.182.246.189;",
"output": "lllq 245.182.246.189; #y\nxds 245.182.246.189; #y"
},
{
"input": "2 1\ntdwmshz 203.115.124.110\neksckjya 201.80.191.212\nzbtjzzue 203.115.124.110;",
"output": "zbtjzzue 203.115.124.110; #tdwmshz"
},
{
"input": "8 5\nfhgkq 5.19.189.178\nphftablcr 75.18.177.178\nxnpcg 158.231.167.176\ncfahrkq 26.165.124.191\nfkgtnqtfoh 230.13.13.129\nt 101.24.94.85\nvjoirslx 59.6.179.72\ntwktmskb 38.194.117.184\nrvzzlygosc 26.165.124.191;\ndcsgxrkgv 101.24.94.85;\nyvmyppn 59.6.179.72;\ngpdjjuq 75.18.177.178;\nvdviz 101.24.94.85;",
"output": "rvzzlygosc 26.165.124.191; #cfahrkq\ndcsgxrkgv 101.24.94.85; #t\nyvmyppn 59.6.179.72; #vjoirslx\ngpdjjuq 75.18.177.178; #phftablcr\nvdviz 101.24.94.85; #t"
},
{
"input": "2 1\nmain 1.1.1.1\nget 11.1.1.1\ncommand 11.1.1.1;",
"output": "command 11.1.1.1; #get"
},
{
"input": "2 2\nmain 0.0.0.255\nmainn 0.0.2.55\nblock 0.0.0.255;\nblock 0.0.2.55;",
"output": "block 0.0.0.255; #main\nblock 0.0.2.55; #mainn"
},
{
"input": "2 2\nmain 0.0.63.0\nreplica 0.38.0.56\nblock 0.0.63.0;\nproxy 0.38.0.56;",
"output": "block 0.0.63.0; #main\nproxy 0.38.0.56; #replica"
},
{
"input": "2 2\nmain 192.168.10.12\nreplica 192.167.10.12\nblock 192.168.10.12;\nproxy 192.167.10.12;",
"output": "block 192.168.10.12; #main\nproxy 192.167.10.12; #replica"
},
{
"input": "2 1\nneserver 185.218.47.91\nserver 255.255.255.255\nblock 255.255.255.255;",
"output": "block 255.255.255.255; #server"
},
{
"input": "2 1\nalp 22.222.30.10\nbet 222.22.30.10\nblock 22.222.30.10;",
"output": "block 22.222.30.10; #alp"
}
] | 1,642,635,701
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 28
| 140
| 3,788,800
|
n,m=map(int,input().split())
d={}
for i in range(n):
name,ip=input().split()
d[ip]=name
for i in range(m):
cmd,ip=input().split()
print(cmd+" "+ip+" "+"#"+d[ip[:len(ip)-1]])
|
Title: Radio Station
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As the guys fried the radio station facilities, the school principal gave them tasks as a punishment. Dustin's task was to add comments to nginx configuration for school's website. The school has *n* servers. Each server has a name and an ip (names aren't necessarily unique, but ips are). Dustin knows the ip and name of each server. For simplicity, we'll assume that an nginx command is of form "command ip;" where command is a string consisting of English lowercase letter only, and ip is the ip of one of school servers.
Each ip is of form "a.b.c.d" where *a*, *b*, *c* and *d* are non-negative integers less than or equal to 255 (with no leading zeros). The nginx configuration file Dustin has to add comments to has *m* commands. Nobody ever memorizes the ips of servers, so to understand the configuration better, Dustin has to comment the name of server that the ip belongs to at the end of each line (after each command). More formally, if a line is "command ip;" Dustin has to replace it with "command ip; #name" where name is the name of the server with ip equal to ip.
Dustin doesn't know anything about nginx, so he panicked again and his friends asked you to do his task for him.
Input Specification:
The first line of input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000).
The next *n* lines contain the names and ips of the servers. Each line contains a string name, name of the server and a string ip, ip of the server, separated by space (1<=≤<=|*name*|<=≤<=10, *name* only consists of English lowercase letters). It is guaranteed that all ip are distinct.
The next *m* lines contain the commands in the configuration file. Each line is of form "command ip;" (1<=≤<=|*command*|<=≤<=10, command only consists of English lowercase letters). It is guaranteed that ip belongs to one of the *n* school servers.
Output Specification:
Print *m* lines, the commands in the configuration file after Dustin did his task.
Demo Input:
['2 2\nmain 192.168.0.2\nreplica 192.168.0.1\nblock 192.168.0.1;\nproxy 192.168.0.2;\n', '3 5\ngoogle 8.8.8.8\ncodeforces 212.193.33.27\nserver 138.197.64.57\nredirect 138.197.64.57;\nblock 8.8.8.8;\ncf 212.193.33.27;\nunblock 8.8.8.8;\ncheck 138.197.64.57;\n']
Demo Output:
['block 192.168.0.1; #replica\nproxy 192.168.0.2; #main\n', 'redirect 138.197.64.57; #server\nblock 8.8.8.8; #google\ncf 212.193.33.27; #codeforces\nunblock 8.8.8.8; #google\ncheck 138.197.64.57; #server\n']
Note:
none
|
```python
n,m=map(int,input().split())
d={}
for i in range(n):
name,ip=input().split()
d[ip]=name
for i in range(m):
cmd,ip=input().split()
print(cmd+" "+ip+" "+"#"+d[ip[:len(ip)-1]])
```
| 3
|
|
116
|
A
|
Tram
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty.
Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram.
|
The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops.
Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement.
- The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0.
|
Print a single integer denoting the minimum possible capacity of the tram (0 is allowed).
|
[
"4\n0 3\n2 5\n4 2\n4 0\n"
] |
[
"6\n"
] |
For the first example, a capacity of 6 is sufficient:
- At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints.
Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
| 500
|
[
{
"input": "4\n0 3\n2 5\n4 2\n4 0",
"output": "6"
},
{
"input": "5\n0 4\n4 6\n6 5\n5 4\n4 0",
"output": "6"
},
{
"input": "10\n0 5\n1 7\n10 8\n5 3\n0 5\n3 3\n8 8\n0 6\n10 1\n9 0",
"output": "18"
},
{
"input": "3\n0 1\n1 1\n1 0",
"output": "1"
},
{
"input": "4\n0 1\n0 1\n1 0\n1 0",
"output": "2"
},
{
"input": "3\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "3\n0 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "5\n0 73\n73 189\n189 766\n766 0\n0 0",
"output": "766"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 1\n1 0",
"output": "1"
},
{
"input": "5\n0 917\n917 923\n904 992\n1000 0\n11 0",
"output": "1011"
},
{
"input": "5\n0 1\n1 2\n2 1\n1 2\n2 0",
"output": "2"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "20\n0 7\n2 1\n2 2\n5 7\n2 6\n6 10\n2 4\n0 4\n7 4\n8 0\n10 6\n2 1\n6 1\n1 7\n0 3\n8 7\n6 3\n6 3\n1 1\n3 0",
"output": "22"
},
{
"input": "5\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "10\n0 592\n258 598\n389 203\n249 836\n196 635\n478 482\n994 987\n1000 0\n769 0\n0 0",
"output": "1776"
},
{
"input": "10\n0 1\n1 0\n0 0\n0 0\n0 0\n0 1\n1 1\n0 1\n1 0\n1 0",
"output": "2"
},
{
"input": "10\n0 926\n926 938\n938 931\n931 964\n937 989\n983 936\n908 949\n997 932\n945 988\n988 0",
"output": "1016"
},
{
"input": "10\n0 1\n1 2\n1 2\n2 2\n2 2\n2 2\n1 1\n1 1\n2 1\n2 0",
"output": "3"
},
{
"input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "10\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "50\n0 332\n332 268\n268 56\n56 711\n420 180\n160 834\n149 341\n373 777\n763 93\n994 407\n86 803\n700 132\n471 608\n429 467\n75 5\n638 305\n405 853\n316 478\n643 163\n18 131\n648 241\n241 766\n316 847\n640 380\n923 759\n789 41\n125 421\n421 9\n9 388\n388 829\n408 108\n462 856\n816 411\n518 688\n290 7\n405 912\n397 772\n396 652\n394 146\n27 648\n462 617\n514 433\n780 35\n710 705\n460 390\n194 508\n643 56\n172 469\n1000 0\n194 0",
"output": "2071"
},
{
"input": "50\n0 0\n0 1\n1 1\n0 1\n0 0\n1 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 1\n1 0\n0 1\n0 0\n1 1\n1 0\n0 1\n0 0\n1 1\n0 1\n1 0\n1 1\n1 0\n0 0\n1 1\n1 0\n0 1\n0 0\n0 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 0\n0 1\n1 0\n0 0\n0 1\n1 1\n1 1\n0 1\n0 0\n1 0\n1 0",
"output": "3"
},
{
"input": "50\n0 926\n926 971\n915 980\n920 965\n954 944\n928 952\n955 980\n916 980\n906 935\n944 913\n905 923\n912 922\n965 934\n912 900\n946 930\n931 983\n979 905\n925 969\n924 926\n910 914\n921 977\n934 979\n962 986\n942 909\n976 903\n982 982\n991 941\n954 929\n902 980\n947 983\n919 924\n917 943\n916 905\n907 913\n964 977\n984 904\n905 999\n950 970\n986 906\n993 970\n960 994\n963 983\n918 986\n980 900\n931 986\n993 997\n941 909\n907 909\n1000 0\n278 0",
"output": "1329"
},
{
"input": "2\n0 863\n863 0",
"output": "863"
},
{
"input": "50\n0 1\n1 2\n2 2\n1 1\n1 1\n1 2\n1 2\n1 1\n1 2\n1 1\n1 1\n1 2\n1 2\n1 1\n2 1\n2 2\n1 2\n2 2\n1 2\n2 1\n2 1\n2 2\n2 1\n1 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n2 2\n2 1\n1 2\n2 2\n1 2\n1 1\n1 1\n2 1\n2 1\n2 2\n2 1\n2 1\n1 2\n1 2\n1 2\n1 2\n2 0\n2 0\n2 0\n0 0",
"output": "8"
},
{
"input": "50\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "100\n0 1\n0 0\n0 0\n1 0\n0 0\n0 1\n0 1\n1 1\n0 0\n0 0\n1 1\n0 0\n1 1\n0 1\n1 1\n0 1\n1 1\n1 0\n1 0\n0 0\n1 0\n0 1\n1 0\n0 0\n0 0\n1 1\n1 1\n0 1\n0 0\n1 0\n1 1\n0 1\n1 0\n1 1\n0 1\n1 1\n1 0\n0 0\n0 0\n0 1\n0 0\n0 1\n1 1\n0 0\n1 1\n1 1\n0 0\n0 1\n1 0\n0 1\n0 0\n0 1\n0 1\n1 1\n1 1\n1 1\n0 0\n0 0\n1 1\n0 1\n0 1\n1 0\n0 0\n0 0\n1 1\n0 1\n0 1\n1 1\n1 1\n0 1\n1 1\n1 1\n0 0\n1 0\n0 1\n0 0\n0 0\n1 1\n1 1\n1 1\n1 1\n0 1\n1 0\n1 0\n1 0\n1 0\n1 0\n0 0\n1 0\n1 0\n0 0\n1 0\n0 0\n0 1\n1 0\n0 1\n1 0\n1 0\n1 0\n1 0",
"output": "11"
},
{
"input": "100\n0 2\n1 2\n2 1\n1 2\n1 2\n2 1\n2 2\n1 1\n1 1\n2 1\n1 2\n2 1\n1 2\n2 2\n2 2\n2 2\n1 2\n2 2\n2 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 2\n1 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n1 1\n2 2\n2 1\n1 2\n1 1\n1 2\n2 1\n2 2\n1 1\n2 1\n1 1\n2 1\n1 1\n1 2\n2 2\n2 2\n1 1\n2 2\n1 2\n2 1\n2 1\n1 1\n1 1\n1 2\n1 2\n1 1\n1 1\n2 1\n1 2\n1 2\n2 1\n2 2\n2 2\n2 2\n2 1\n2 2\n1 1\n1 2\n1 2\n1 1\n2 2\n2 2\n1 1\n2 1\n1 1\n1 2\n1 2\n1 2\n1 1\n1 1\n2 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 1\n2 2\n1 2\n2 0\n2 0\n2 0\n1 0",
"output": "7"
},
{
"input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "2\n0 1\n1 0",
"output": "1"
},
{
"input": "2\n0 900\n900 0",
"output": "900"
},
{
"input": "2\n0 1\n1 0",
"output": "1"
},
{
"input": "2\n0 0\n0 0",
"output": "0"
},
{
"input": "2\n0 1000\n1000 0",
"output": "1000"
},
{
"input": "3\n0 802\n175 188\n815 0",
"output": "815"
},
{
"input": "3\n0 910\n910 976\n976 0",
"output": "976"
},
{
"input": "3\n0 2\n2 1\n1 0",
"output": "2"
}
] | 1,691,988,872
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 71
| 92
| 0
|
n=int(input())
temp=0
max=0
for i in range(n):
a,b=map(int,input().split())
temp=temp-a
temp=temp+b
if temp>max:
max=temp
print(max)
|
Title: Tram
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty.
Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram.
Input Specification:
The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops.
Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement.
- The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0.
Output Specification:
Print a single integer denoting the minimum possible capacity of the tram (0 is allowed).
Demo Input:
['4\n0 3\n2 5\n4 2\n4 0\n']
Demo Output:
['6\n']
Note:
For the first example, a capacity of 6 is sufficient:
- At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints.
Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
|
```python
n=int(input())
temp=0
max=0
for i in range(n):
a,b=map(int,input().split())
temp=temp-a
temp=temp+b
if temp>max:
max=temp
print(max)
```
| 3
|
|
765
|
B
|
Code obfuscation
|
PROGRAMMING
| 1,100
|
[
"greedy",
"implementation",
"strings"
] | null | null |
Kostya likes Codeforces contests very much. However, he is very disappointed that his solutions are frequently hacked. That's why he decided to obfuscate (intentionally make less readable) his code before upcoming contest.
To obfuscate the code, Kostya first looks at the first variable name used in his program and replaces all its occurrences with a single symbol *a*, then he looks at the second variable name that has not been replaced yet, and replaces all its occurrences with *b*, and so on. Kostya is well-mannered, so he doesn't use any one-letter names before obfuscation. Moreover, there are at most 26 unique identifiers in his programs.
You are given a list of identifiers of some program with removed spaces and line breaks. Check if this program can be a result of Kostya's obfuscation.
|
In the only line of input there is a string *S* of lowercase English letters (1<=≤<=|*S*|<=≤<=500) — the identifiers of a program with removed whitespace characters.
|
If this program can be a result of Kostya's obfuscation, print "YES" (without quotes), otherwise print "NO".
|
[
"abacaba\n",
"jinotega\n"
] |
[
"YES\n",
"NO\n"
] |
In the first sample case, one possible list of identifiers would be "number string number character number string number". Here how Kostya would obfuscate the program:
- replace all occurences of number with a, the result would be "a string a character a string a",- replace all occurences of string with b, the result would be "a b a character a b a",- replace all occurences of character with c, the result would be "a b a c a b a",- all identifiers have been replaced, thus the obfuscation is finished.
| 1,000
|
[
{
"input": "abacaba",
"output": "YES"
},
{
"input": "jinotega",
"output": "NO"
},
{
"input": "aaaaaaaaaaa",
"output": "YES"
},
{
"input": "aba",
"output": "YES"
},
{
"input": "bab",
"output": "NO"
},
{
"input": "a",
"output": "YES"
},
{
"input": "abcdefghijklmnopqrstuvwxyz",
"output": "YES"
},
{
"input": "fihyxmbnzq",
"output": "NO"
},
{
"input": "aamlaswqzotaanasdhcvjoaiwdhctezzawagkdgfffeqkyrvbcrfqgkdsvximsnvmkmjyofswmtjdoxgwamsaatngenqvsvrvwlbzuoeaolfcnmdacrmdleafbsmerwmxzyylfhemnkoayuhtpbikm",
"output": "NO"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "YES"
},
{
"input": "darbbbcwynbbbbaacbkvbakavabbbabzajlbajryaabbbccxraakgniagbtsswcfbkubdmcasccepybkaefcfsbzdddxgcjadybcfjtmqbspflqrdghgfwnccfveogdmifkociqscahdejctacwzbkhihajfilrgcjiofwfklifobozikcmvcfeqlidrgsgdfxffaaebzjxngsjxiclyolhjokqpdbfffooticxsezpgqkhhzmbmqgskkqvefzyijrwhpftcmbedmaflapmeljaudllojfpgfkpvgylaglrhrslxlprbhgknrctilngqccbddvpamhifsbmyowohczizjcbleehfrecjbqtxertnpfmalejmbxkhkkbyopuwlhkxuqellsybgcndvniyyxfoufalstdsdfjoxlnmigkqwmgojsppaannfstxytelluvvkdcezlqfsperwyjsdsmkvgjdbksswamhmoukcawiigkggztr",
"output": "NO"
},
{
"input": "bbbbbb",
"output": "NO"
},
{
"input": "aabbbd",
"output": "NO"
},
{
"input": "abdefghijklmnopqrstuvwxyz",
"output": "NO"
},
{
"input": "abcdeghijklmnopqrstuvwxyz",
"output": "NO"
},
{
"input": "abcdefghijklmnopqrsuvwxyz",
"output": "NO"
},
{
"input": "abcdefghijklmnopqrstuvwxy",
"output": "YES"
},
{
"input": "abcdefghijklmnopqrsutvwxyz",
"output": "NO"
},
{
"input": "acdef",
"output": "NO"
},
{
"input": "z",
"output": "NO"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaababaaababaabababccbabdbcbadccacdbdedabbeecbcabbdcaecdabbedddafeffaccgeacefbcahabfiiegecdbebabhhbdgfeghhbfahgagefbgghdbhadeicbdfgdchhefhigfcgdhcihecacfhadfgfejccibcjkfhbigbealjjkfldiecfdcafbamgfkbjlbifldghmiifkkglaflmjfmkfdjlbliijkgfdelklfnadbifgbmklfbqkhirhcadoadhmjrghlmelmjfpakqkdfcgqdkaeqpbcdoeqglqrarkipncckpfmajrqsfffldegbmahsfcqdfdqtrgrouqajgsojmmukptgerpanpcbejmergqtavwsvtveufdseuemwrhfmjqinxjodddnpcgqullrhmogflsxgsbapoghortiwcovejtinncozk",
"output": "NO"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "YES"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbabbbabbaaabbaaaaabaabbaa",
"output": "YES"
},
{
"input": "aababbabbaabbbbbaabababaabbbaaaaabbabbabbaabbbbabaabbaaababbaaacbbabbbbbbcbcababbccaaacbaccaccaababbccaacccaabaaccaaabacacbaabacbaacbaaabcbbbcbbaacaabcbcbccbacabbcbabcaccaaaaaabcbacabcbabbbbbabccbbcacbaaabbccbbaaaaaaaaaaaadbbbabdacabdaddddbaabbddbdabbdacbacbacaaaabbacadbcddddadaddabbdccaddbaaacbceebbceadbeaadecddbbbcaaecbdeaebaddbbdebbcbaabcacbdcdc",
"output": "YES"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbaabaabaababbbabbacacbbbacbbaaaabbccacbaabaaccbbbbbcbbbacabbccaaabbaaacabcbacbcabbbbecbecadcbacbaadeeadabeacdebccdbbcaecdbeeebbebcaaaeacdcbdeccdbbdcdebdcbdacebcecbacddeeaebcedffedfggbeedceacaecagdfedfabcfchffceachgcbicbcffeeebgcgiefcafhibhceiedgbfebbccegbehhibhhfedbaeedbghggffehggaeaidifhdhaggdjcfjhiaieaichjacedchejg",
"output": "NO"
},
{
"input": "b",
"output": "NO"
},
{
"input": "ac",
"output": "NO"
},
{
"input": "cde",
"output": "NO"
},
{
"input": "abd",
"output": "NO"
},
{
"input": "zx",
"output": "NO"
},
{
"input": "bcd",
"output": "NO"
},
{
"input": "aaac",
"output": "NO"
},
{
"input": "aacb",
"output": "NO"
},
{
"input": "acd",
"output": "NO"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaz",
"output": "NO"
},
{
"input": "abcdefghijklmnopqrstuvwxyzz",
"output": "YES"
},
{
"input": "bc",
"output": "NO"
},
{
"input": "aaaaaaaaad",
"output": "NO"
},
{
"input": "abb",
"output": "YES"
},
{
"input": "abcb",
"output": "YES"
},
{
"input": "aac",
"output": "NO"
},
{
"input": "abcbcb",
"output": "YES"
},
{
"input": "bb",
"output": "NO"
},
{
"input": "abbb",
"output": "YES"
},
{
"input": "bbb",
"output": "NO"
},
{
"input": "x",
"output": "NO"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaazz",
"output": "NO"
},
{
"input": "acbccccccccccc",
"output": "NO"
},
{
"input": "za",
"output": "NO"
},
{
"input": "ade",
"output": "NO"
},
{
"input": "bbbbbbbbbb",
"output": "NO"
},
{
"input": "bac",
"output": "NO"
},
{
"input": "bcddcb",
"output": "NO"
},
{
"input": "aaacb",
"output": "NO"
},
{
"input": "aaaaac",
"output": "NO"
},
{
"input": "aaaaaaaaaaad",
"output": "NO"
},
{
"input": "c",
"output": "NO"
},
{
"input": "abcccccccc",
"output": "YES"
},
{
"input": "aaaaaaac",
"output": "NO"
}
] | 1,611,752,338
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 59
| 156
| 2,355,200
|
import string
obf = [x for x in input()]
obf = [x for i, x in enumerate(obf) if x not in obf[:i]]
n = len(obf)
letters = list(string.ascii_lowercase)
letters = letters[:n]
if obf == letters:
print('Yes')
else:
print('No')
|
Title: Code obfuscation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kostya likes Codeforces contests very much. However, he is very disappointed that his solutions are frequently hacked. That's why he decided to obfuscate (intentionally make less readable) his code before upcoming contest.
To obfuscate the code, Kostya first looks at the first variable name used in his program and replaces all its occurrences with a single symbol *a*, then he looks at the second variable name that has not been replaced yet, and replaces all its occurrences with *b*, and so on. Kostya is well-mannered, so he doesn't use any one-letter names before obfuscation. Moreover, there are at most 26 unique identifiers in his programs.
You are given a list of identifiers of some program with removed spaces and line breaks. Check if this program can be a result of Kostya's obfuscation.
Input Specification:
In the only line of input there is a string *S* of lowercase English letters (1<=≤<=|*S*|<=≤<=500) — the identifiers of a program with removed whitespace characters.
Output Specification:
If this program can be a result of Kostya's obfuscation, print "YES" (without quotes), otherwise print "NO".
Demo Input:
['abacaba\n', 'jinotega\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample case, one possible list of identifiers would be "number string number character number string number". Here how Kostya would obfuscate the program:
- replace all occurences of number with a, the result would be "a string a character a string a",- replace all occurences of string with b, the result would be "a b a character a b a",- replace all occurences of character with c, the result would be "a b a c a b a",- all identifiers have been replaced, thus the obfuscation is finished.
|
```python
import string
obf = [x for x in input()]
obf = [x for i, x in enumerate(obf) if x not in obf[:i]]
n = len(obf)
letters = list(string.ascii_lowercase)
letters = letters[:n]
if obf == letters:
print('Yes')
else:
print('No')
```
| 3
|
|
71
|
A
|
Way Too Long Words
|
PROGRAMMING
| 800
|
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500
|
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,690,500,517
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 46
| 0
|
n=int(input())
x=1
l=[]
while x!=n+1:
w=input("")
l.append(w)
x+=1
y=0
m=[]
for y in range (n):
v=l[y]
p=len(v)-2
if len(v)>10:
a=v[0]+str(p)+v[len(v)-1]
m.append(a)
else:
m.append(v)
p=0
while p!=len(m):
print(m[p])
p+=1
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
n=int(input())
x=1
l=[]
while x!=n+1:
w=input("")
l.append(w)
x+=1
y=0
m=[]
for y in range (n):
v=l[y]
p=len(v)-2
if len(v)>10:
a=v[0]+str(p)+v[len(v)-1]
m.append(a)
else:
m.append(v)
p=0
while p!=len(m):
print(m[p])
p+=1
```
| 3.977
|
678
|
C
|
Joty and Chocolate
|
PROGRAMMING
| 1,600
|
[
"implementation",
"math",
"number theory"
] | null | null |
Little Joty has got a task to do. She has a line of *n* tiles indexed from 1 to *n*. She has to paint them in a strange pattern.
An unpainted tile should be painted Red if it's index is divisible by *a* and an unpainted tile should be painted Blue if it's index is divisible by *b*. So the tile with the number divisible by *a* and *b* can be either painted Red or Blue.
After her painting is done, she will get *p* chocolates for each tile that is painted Red and *q* chocolates for each tile that is painted Blue.
Note that she can paint tiles in any order she wants.
Given the required information, find the maximum number of chocolates Joty can get.
|
The only line contains five integers *n*, *a*, *b*, *p* and *q* (1<=≤<=*n*,<=*a*,<=*b*,<=*p*,<=*q*<=≤<=109).
|
Print the only integer *s* — the maximum number of chocolates Joty can get.
Note that the answer can be too large, so you should use 64-bit integer type to store it. In C++ you can use the long long integer type and in Java you can use long integer type.
|
[
"5 2 3 12 15\n",
"20 2 3 3 5\n"
] |
[
"39\n",
"51\n"
] |
none
| 0
|
[
{
"input": "5 2 3 12 15",
"output": "39"
},
{
"input": "20 2 3 3 5",
"output": "51"
},
{
"input": "1 1 1 1 1",
"output": "1"
},
{
"input": "1 2 2 2 2",
"output": "0"
},
{
"input": "2 1 3 3 3",
"output": "6"
},
{
"input": "3 1 1 3 3",
"output": "9"
},
{
"input": "4 1 5 4 3",
"output": "16"
},
{
"input": "8 8 1 1 1",
"output": "8"
},
{
"input": "15 14 32 65 28",
"output": "65"
},
{
"input": "894 197 325 232 902",
"output": "2732"
},
{
"input": "8581 6058 3019 2151 4140",
"output": "10431"
},
{
"input": "41764 97259 54586 18013 75415",
"output": "0"
},
{
"input": "333625 453145 800800 907251 446081",
"output": "0"
},
{
"input": "4394826 2233224 609367 3364334 898489",
"output": "9653757"
},
{
"input": "13350712 76770926 61331309 8735000 9057368",
"output": "0"
},
{
"input": "142098087 687355301 987788392 75187408 868856364",
"output": "0"
},
{
"input": "1000000000 1 3 1000000000 999999999",
"output": "1000000000000000000"
},
{
"input": "6 6 2 8 2",
"output": "12"
},
{
"input": "500 8 4 4 5",
"output": "625"
},
{
"input": "20 4 6 2 3",
"output": "17"
},
{
"input": "10 3 9 1 2",
"output": "4"
},
{
"input": "120 18 6 3 5",
"output": "100"
},
{
"input": "30 4 6 2 2",
"output": "20"
},
{
"input": "1000000000 7171 2727 191 272",
"output": "125391842"
},
{
"input": "5 2 2 4 1",
"output": "8"
},
{
"input": "1000000000 2 2 3 3",
"output": "1500000000"
},
{
"input": "24 4 6 5 7",
"output": "48"
},
{
"input": "216 6 36 10 100",
"output": "900"
},
{
"input": "100 12 6 1 10",
"output": "160"
},
{
"input": "1000 4 8 3 5",
"output": "1000"
},
{
"input": "10 2 4 3 6",
"output": "21"
},
{
"input": "1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "10 5 10 2 3",
"output": "5"
},
{
"input": "100000 3 9 1 2",
"output": "44444"
},
{
"input": "10 2 4 1 100",
"output": "203"
},
{
"input": "20 6 4 2 3",
"output": "19"
},
{
"input": "1200 4 16 2 3",
"output": "675"
},
{
"input": "7 2 4 7 9",
"output": "23"
},
{
"input": "24 6 4 15 10",
"output": "100"
},
{
"input": "50 2 8 15 13",
"output": "375"
},
{
"input": "100 4 6 12 15",
"output": "444"
},
{
"input": "56756 9 18 56 78",
"output": "422502"
},
{
"input": "10000 4 6 10 12",
"output": "36662"
},
{
"input": "20 2 4 3 5",
"output": "40"
},
{
"input": "24 4 6 10 100",
"output": "440"
},
{
"input": "12 2 4 5 6",
"output": "33"
},
{
"input": "100 2 4 1 100",
"output": "2525"
},
{
"input": "1000 4 6 50 50",
"output": "16650"
},
{
"input": "60 12 6 12 15",
"output": "150"
},
{
"input": "1000 2 4 5 6",
"output": "2750"
},
{
"input": "1000000000 1 1 9999 5555",
"output": "9999000000000"
},
{
"input": "50 2 2 4 5",
"output": "125"
},
{
"input": "14 4 2 2 3",
"output": "21"
},
{
"input": "100 3 9 1 2",
"output": "44"
},
{
"input": "1000000000 4 6 1 1000000000",
"output": "166666666166666667"
},
{
"input": "12 3 3 45 4",
"output": "180"
},
{
"input": "12 2 4 5 9",
"output": "42"
},
{
"input": "1000000000 2 2 1000000000 1000000000",
"output": "500000000000000000"
},
{
"input": "50 4 8 5 6",
"output": "66"
},
{
"input": "32 4 16 6 3",
"output": "48"
},
{
"input": "10000 2 4 1 1",
"output": "5000"
},
{
"input": "8 2 4 100 1",
"output": "400"
},
{
"input": "20 4 2 10 1",
"output": "55"
},
{
"input": "5 2 2 12 15",
"output": "30"
},
{
"input": "20 2 12 5 6",
"output": "51"
},
{
"input": "10 2 4 1 2",
"output": "7"
},
{
"input": "32 4 16 3 6",
"output": "30"
},
{
"input": "50 2 8 13 15",
"output": "337"
},
{
"input": "12 6 4 10 9",
"output": "38"
},
{
"input": "1000000000 999999998 999999999 999999998 999999999",
"output": "1999999997"
},
{
"input": "20 2 4 10 20",
"output": "150"
},
{
"input": "13 4 6 12 15",
"output": "54"
},
{
"input": "30 3 6 5 7",
"output": "60"
},
{
"input": "7 2 4 2 1",
"output": "6"
},
{
"input": "100000 32 16 2 3",
"output": "18750"
},
{
"input": "6 2 6 1 1",
"output": "3"
},
{
"input": "999999999 180 192 46642017 28801397",
"output": "399129078526502"
},
{
"input": "12 4 6 1 1",
"output": "4"
},
{
"input": "10 2 4 10 5",
"output": "50"
},
{
"input": "1000000 4 6 12 14",
"output": "4333328"
},
{
"input": "2000 20 30 3 5",
"output": "531"
},
{
"input": "1000000000 1 2 1 1",
"output": "1000000000"
},
{
"input": "30 3 15 10 3",
"output": "100"
},
{
"input": "1000 2 4 1 100",
"output": "25250"
},
{
"input": "6 3 3 12 15",
"output": "30"
},
{
"input": "24 4 6 1 1",
"output": "8"
},
{
"input": "20 2 12 4 5",
"output": "41"
},
{
"input": "1000000000 9 15 10 10",
"output": "1555555550"
},
{
"input": "16 2 4 1 2",
"output": "12"
},
{
"input": "100000 4 6 12 14",
"output": "433328"
},
{
"input": "24 6 4 1 1",
"output": "8"
},
{
"input": "1000000 4 6 12 15",
"output": "4499994"
},
{
"input": "100 2 4 5 6",
"output": "275"
},
{
"input": "10 3 9 12 15",
"output": "39"
},
{
"input": "1000000000 1 1 999999999 999999999",
"output": "999999999000000000"
},
{
"input": "6 2 4 2 3",
"output": "7"
},
{
"input": "2 2 2 2 2",
"output": "2"
},
{
"input": "6 6 2 1 1",
"output": "3"
},
{
"input": "100 2 4 3 7",
"output": "250"
},
{
"input": "1000000 32 16 2 5",
"output": "312500"
},
{
"input": "100 20 15 50 25",
"output": "375"
},
{
"input": "1000000000 100000007 100000013 10 3",
"output": "117"
},
{
"input": "1000000000 9999999 99999998 3 3",
"output": "330"
},
{
"input": "10077696 24 36 10 100",
"output": "30792960"
},
{
"input": "392852503 148746166 420198270 517065752 906699795",
"output": "1034131504"
},
{
"input": "536870912 60000 72000 271828 314159",
"output": "4369119072"
},
{
"input": "730114139 21550542 204644733 680083361 11353255",
"output": "22476810678"
},
{
"input": "538228881 766493289 791886544 468896052 600136703",
"output": "0"
},
{
"input": "190 20 50 84 172",
"output": "1188"
},
{
"input": "1000 5 10 80 90",
"output": "17000"
},
{
"input": "99999999 999999998 1 271828 314159",
"output": "31415899685841"
},
{
"input": "22 3 6 1243 1",
"output": "8701"
},
{
"input": "15 10 5 2 2",
"output": "6"
},
{
"input": "1000000000 1000000000 1 1000000000 1000000000",
"output": "1000000000000000000"
},
{
"input": "62 62 42 78 124",
"output": "202"
},
{
"input": "2 2 2 2 1",
"output": "2"
},
{
"input": "864351351 351 313 531 11",
"output": "1337898227"
},
{
"input": "26 3 6 1244 1",
"output": "9952"
},
{
"input": "1000 4 6 7 3",
"output": "1999"
},
{
"input": "134312 3 6 33333 1",
"output": "1492318410"
},
{
"input": "100 4 6 17 18",
"output": "577"
},
{
"input": "6 2 4 5 6",
"output": "16"
},
{
"input": "8 2 4 10 1",
"output": "40"
},
{
"input": "10 2 4 3 3",
"output": "15"
},
{
"input": "1000 1000 1000 1000 1000",
"output": "1000"
},
{
"input": "123123 3 6 34312 2",
"output": "1408198792"
},
{
"input": "1000000000 25 5 999 999",
"output": "199800000000"
},
{
"input": "100 4 2 5 12",
"output": "600"
},
{
"input": "50 2 4 4 5",
"output": "112"
},
{
"input": "24 4 6 100 333",
"output": "1732"
},
{
"input": "216 24 36 10 100",
"output": "660"
},
{
"input": "50 6 4 3 8",
"output": "108"
},
{
"input": "146 76 2 178 192",
"output": "14016"
},
{
"input": "55 8 6 11 20",
"output": "224"
},
{
"input": "5 2 4 6 16",
"output": "22"
},
{
"input": "54 2 52 50 188",
"output": "1488"
},
{
"input": "536870912 60000000 72000000 271828 314159",
"output": "4101909"
},
{
"input": "1000000000 1000000000 1 1 100",
"output": "100000000000"
},
{
"input": "50 4 2 4 5",
"output": "125"
},
{
"input": "198 56 56 122 118",
"output": "366"
},
{
"input": "5 1000000000 1 12 15",
"output": "75"
},
{
"input": "1000 6 12 5 6",
"output": "913"
},
{
"input": "50 3 6 12 15",
"output": "216"
},
{
"input": "333 300 300 300 300",
"output": "300"
},
{
"input": "1 1000000000 1 1 2",
"output": "2"
},
{
"input": "188 110 110 200 78",
"output": "200"
},
{
"input": "100000 20 10 3 2",
"output": "25000"
},
{
"input": "100 2 4 1 10",
"output": "275"
},
{
"input": "1000000000 2 1000000000 1 1000000",
"output": "500999999"
},
{
"input": "20 3 6 5 7",
"output": "36"
},
{
"input": "50 4 6 4 5",
"output": "72"
},
{
"input": "96 46 4 174 156",
"output": "3936"
},
{
"input": "5 2 4 12 15",
"output": "27"
},
{
"input": "12 3 6 100 1",
"output": "400"
},
{
"input": "100 4 2 10 32",
"output": "1600"
},
{
"input": "1232 3 6 30000 3",
"output": "12300000"
},
{
"input": "20 3 6 5 4",
"output": "30"
},
{
"input": "100 6 15 11 29",
"output": "317"
},
{
"input": "10000000 4 8 100 200",
"output": "375000000"
},
{
"input": "1000000000 12 24 2 4",
"output": "249999998"
},
{
"input": "123 3 6 3000 1",
"output": "123000"
},
{
"input": "401523968 1536 2664 271828 314159",
"output": "117768531682"
},
{
"input": "9 2 4 3 5",
"output": "16"
},
{
"input": "999999999 724362018 772432019 46201854 20017479",
"output": "66219333"
},
{
"input": "100 2 4 1 1000",
"output": "25025"
},
{
"input": "50 2 4 1 1000",
"output": "12013"
},
{
"input": "1000000000 2 1 2 1",
"output": "1500000000"
},
{
"input": "1000000000 2005034 2005046 15 12",
"output": "13446"
},
{
"input": "1000000000 999999999 1000000000 1 1",
"output": "2"
},
{
"input": "999999999 500000000 1 100 1000",
"output": "999999999000"
},
{
"input": "50 8 6 3 4",
"output": "44"
},
{
"input": "1000000000 1 1 1000000000 1000000000",
"output": "1000000000000000000"
},
{
"input": "1000000000 999999862 999999818 15 12",
"output": "27"
},
{
"input": "1000000000 10000019 10000019 21 17",
"output": "2079"
},
{
"input": "20 6 4 8 2",
"output": "32"
},
{
"input": "1000000000 1000000000 1 1 1",
"output": "1000000000"
},
{
"input": "1000000000 12345678 123456789 1000000000 999999999",
"output": "88999999992"
},
{
"input": "1000000000 2 999999937 100000000 100000000",
"output": "50000000100000000"
},
{
"input": "1000000000 1 1 1000000000 999999999",
"output": "1000000000000000000"
},
{
"input": "1000000000 50001 100003 10 10",
"output": "299980"
},
{
"input": "1000000000 1000000000 3 1 1",
"output": "333333334"
},
{
"input": "10000 44 49 114 514",
"output": "130278"
},
{
"input": "30 5 15 2 1",
"output": "12"
},
{
"input": "20 2 4 1 1",
"output": "10"
},
{
"input": "100 8 12 5 6",
"output": "88"
}
] | 1,630,367,829
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 185
| 109
| 20,172,800
|
from sys import stdin, stdout
def read():
return stdin.readline().rstrip()
def read_int():
return int(read())
def read_ints():
return list(map(int, read().split()))
def gcd(x,y):
while y>0:
x,y=y,x%y
return x
def solve():
n,a,b,p,q=read_ints()
print((n//a)*p + (n//b)*q - (n//(a*b//gcd(a,b)))*min(p,q))
solve()
|
Title: Joty and Chocolate
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Joty has got a task to do. She has a line of *n* tiles indexed from 1 to *n*. She has to paint them in a strange pattern.
An unpainted tile should be painted Red if it's index is divisible by *a* and an unpainted tile should be painted Blue if it's index is divisible by *b*. So the tile with the number divisible by *a* and *b* can be either painted Red or Blue.
After her painting is done, she will get *p* chocolates for each tile that is painted Red and *q* chocolates for each tile that is painted Blue.
Note that she can paint tiles in any order she wants.
Given the required information, find the maximum number of chocolates Joty can get.
Input Specification:
The only line contains five integers *n*, *a*, *b*, *p* and *q* (1<=≤<=*n*,<=*a*,<=*b*,<=*p*,<=*q*<=≤<=109).
Output Specification:
Print the only integer *s* — the maximum number of chocolates Joty can get.
Note that the answer can be too large, so you should use 64-bit integer type to store it. In C++ you can use the long long integer type and in Java you can use long integer type.
Demo Input:
['5 2 3 12 15\n', '20 2 3 3 5\n']
Demo Output:
['39\n', '51\n']
Note:
none
|
```python
from sys import stdin, stdout
def read():
return stdin.readline().rstrip()
def read_int():
return int(read())
def read_ints():
return list(map(int, read().split()))
def gcd(x,y):
while y>0:
x,y=y,x%y
return x
def solve():
n,a,b,p,q=read_ints()
print((n//a)*p + (n//b)*q - (n//(a*b//gcd(a,b)))*min(p,q))
solve()
```
| 3
|
|
272
|
A
|
Dima and Friends
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] | null | null |
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
|
In a single line print the answer to the problem.
|
[
"1\n1\n",
"1\n2\n",
"2\n3 5\n"
] |
[
"3\n",
"2\n",
"3\n"
] |
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
| 500
|
[
{
"input": "1\n1",
"output": "3"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "1\n5",
"output": "3"
},
{
"input": "5\n4 4 3 5 1",
"output": "4"
},
{
"input": "6\n2 3 2 2 1 3",
"output": "4"
},
{
"input": "8\n2 2 5 3 4 3 3 2",
"output": "4"
},
{
"input": "7\n4 1 3 2 2 4 5",
"output": "4"
},
{
"input": "3\n3 5 1",
"output": "4"
},
{
"input": "95\n4 2 3 4 4 5 2 2 4 4 3 5 3 3 3 5 4 2 5 4 2 1 1 3 4 2 1 3 5 4 2 1 1 5 1 1 2 2 4 4 5 4 5 5 2 1 2 2 2 4 5 5 2 4 3 4 4 3 5 2 4 1 5 4 5 1 3 2 4 2 2 1 5 3 1 5 3 4 3 3 2 1 2 2 1 3 1 5 2 3 1 1 2 5 2",
"output": "5"
},
{
"input": "31\n3 2 3 3 3 3 4 4 1 5 5 4 2 4 3 2 2 1 4 4 1 2 3 1 1 5 5 3 4 4 1",
"output": "4"
},
{
"input": "42\n3 1 2 2 5 1 2 2 4 5 4 5 2 5 4 5 4 4 1 4 3 3 4 4 4 4 3 2 1 3 4 5 5 2 1 2 1 5 5 2 4 4",
"output": "5"
},
{
"input": "25\n4 5 5 5 3 1 1 4 4 4 3 5 4 4 1 4 4 1 2 4 2 5 4 5 3",
"output": "5"
},
{
"input": "73\n3 4 3 4 5 1 3 4 2 1 4 2 2 3 5 3 1 4 2 3 2 1 4 5 3 5 2 2 4 3 2 2 5 3 2 3 5 1 3 1 1 4 5 2 4 2 5 1 4 3 1 3 1 4 2 3 3 3 3 5 5 2 5 2 5 4 3 1 1 5 5 2 3",
"output": "4"
},
{
"input": "46\n1 4 4 5 4 5 2 3 5 5 3 2 5 4 1 3 2 2 1 4 3 1 5 5 2 2 2 2 4 4 1 1 4 3 4 3 1 4 2 2 4 2 3 2 5 2",
"output": "4"
},
{
"input": "23\n5 2 1 1 4 2 5 5 3 5 4 5 5 1 1 5 2 4 5 3 4 4 3",
"output": "5"
},
{
"input": "6\n4 2 3 1 3 5",
"output": "4"
},
{
"input": "15\n5 5 5 3 5 4 1 3 3 4 3 4 1 4 4",
"output": "5"
},
{
"input": "93\n1 3 1 4 3 3 5 3 1 4 5 4 3 2 2 4 3 1 4 1 2 3 3 3 2 5 1 3 1 4 5 1 1 1 4 2 1 2 3 1 1 1 5 1 5 5 1 2 5 4 3 2 2 4 4 2 5 4 5 5 3 1 3 1 2 1 3 1 1 2 3 4 4 5 5 3 2 1 3 3 5 1 3 5 4 4 1 3 3 4 2 3 2",
"output": "5"
},
{
"input": "96\n1 5 1 3 2 1 2 2 2 2 3 4 1 1 5 4 4 1 2 3 5 1 4 4 4 1 3 3 1 4 5 4 1 3 5 3 4 4 3 2 1 1 4 4 5 1 1 2 5 1 2 3 1 4 1 2 2 2 3 2 3 3 2 5 2 2 3 3 3 3 2 1 2 4 5 5 1 5 3 2 1 4 3 5 5 5 3 3 5 3 4 3 4 2 1 3",
"output": "5"
},
{
"input": "49\n1 4 4 3 5 2 2 1 5 1 2 1 2 5 1 4 1 4 5 2 4 5 3 5 2 4 2 1 3 4 2 1 4 2 1 1 3 3 2 3 5 4 3 4 2 4 1 4 1",
"output": "5"
},
{
"input": "73\n4 1 3 3 3 1 5 2 1 4 1 1 3 5 1 1 4 5 2 1 5 4 1 5 3 1 5 2 4 5 1 4 3 3 5 2 2 3 3 2 5 1 4 5 2 3 1 4 4 3 5 2 3 5 1 4 3 5 1 2 4 1 3 3 5 4 2 4 2 4 1 2 5",
"output": "5"
},
{
"input": "41\n5 3 5 4 2 5 4 3 1 1 1 5 4 3 4 3 5 4 2 5 4 1 1 3 2 4 5 3 5 1 5 5 1 1 1 4 4 1 2 4 3",
"output": "5"
},
{
"input": "100\n3 3 1 4 2 4 4 3 1 5 1 1 4 4 3 4 4 3 5 4 5 2 4 3 4 1 2 4 5 4 2 1 5 4 1 1 4 3 2 4 1 2 1 4 4 5 5 4 4 5 3 2 5 1 4 2 2 1 1 2 5 2 5 1 5 3 1 4 3 2 4 3 2 2 4 5 5 1 2 3 1 4 1 2 2 2 5 5 2 3 2 4 3 1 1 2 1 2 1 2",
"output": "5"
},
{
"input": "100\n2 1 1 3 5 4 4 2 3 4 3 4 5 4 5 4 2 4 5 3 4 5 4 1 1 4 4 1 1 2 5 4 2 4 5 3 2 5 4 3 4 5 1 3 4 2 5 4 5 4 5 2 4 1 2 5 3 1 4 4 5 3 4 3 1 2 5 4 2 5 4 1 5 3 5 4 1 2 5 3 1 1 1 1 5 3 4 3 5 1 1 5 5 1 1 2 2 1 5 1",
"output": "5"
},
{
"input": "100\n4 4 3 3 2 5 4 4 2 1 4 4 4 5 4 1 2 1 5 2 4 3 4 1 4 1 2 5 1 4 5 4 2 1 2 5 3 4 5 5 2 1 2 2 2 2 2 3 2 5 1 2 2 3 2 5 5 1 3 4 5 2 1 3 4 2 2 4 4 3 3 3 2 3 2 1 5 5 5 2 1 4 2 3 5 1 4 4 2 3 2 5 5 4 3 5 1 3 5 5",
"output": "5"
},
{
"input": "100\n4 4 2 5 4 2 2 3 4 4 3 2 3 3 1 3 4 3 3 4 1 3 1 4 5 3 4 3 1 1 1 3 3 2 3 4 3 4 2 2 1 5 1 4 5 1 1 1 3 3 1 1 3 2 5 4 2 5 2 4 5 4 4 1 1 2 1 1 4 5 1 1 5 3 3 2 5 5 5 1 4 1 4 1 1 3 2 3 4 4 2 5 5 2 5 1 1 3 5 3",
"output": "5"
},
{
"input": "100\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "4"
},
{
"input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5",
"output": "5"
}
] | 1,499,926,848
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 124
| 5,529,600
|
n = int(input())
string = input()
a = sum(list(map(int, string.split())))
b = 0
for x in range(1, 6):
if (a + x) % (n + 1) != 1:
b += 1
print(b)
|
Title: Dima and Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
Output Specification:
In a single line print the answer to the problem.
Demo Input:
['1\n1\n', '1\n2\n', '2\n3 5\n']
Demo Output:
['3\n', '2\n', '3\n']
Note:
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
|
```python
n = int(input())
string = input()
a = sum(list(map(int, string.split())))
b = 0
for x in range(1, 6):
if (a + x) % (n + 1) != 1:
b += 1
print(b)
```
| 3
|
|
363
|
B
|
Fence
|
PROGRAMMING
| 1,100
|
[
"brute force",
"dp"
] | null | null |
There is a fence in front of Polycarpus's home. The fence consists of *n* planks of the same width which go one after another from left to right. The height of the *i*-th plank is *h**i* meters, distinct planks can have distinct heights.
Polycarpus has bought a posh piano and is thinking about how to get it into the house. In order to carry out his plan, he needs to take exactly *k* consecutive planks from the fence. Higher planks are harder to tear off the fence, so Polycarpus wants to find such *k* consecutive planks that the sum of their heights is minimal possible.
Write the program that finds the indexes of *k* consecutive planks with minimal total height. Pay attention, the fence is not around Polycarpus's home, it is in front of home (in other words, the fence isn't cyclic).
|
The first line of the input contains integers *n* and *k* (1<=≤<=*n*<=≤<=1.5·105,<=1<=≤<=*k*<=≤<=*n*) — the number of planks in the fence and the width of the hole for the piano. The second line contains the sequence of integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=100), where *h**i* is the height of the *i*-th plank of the fence.
|
Print such integer *j* that the sum of the heights of planks *j*, *j*<=+<=1, ..., *j*<=+<=*k*<=-<=1 is the minimum possible. If there are multiple such *j*'s, print any of them.
|
[
"7 3\n1 2 6 1 1 7 1\n"
] |
[
"3\n"
] |
In the sample, your task is to find three consecutive planks with the minimum sum of heights. In the given case three planks with indexes 3, 4 and 5 have the required attribute, their total height is 8.
| 1,000
|
[
{
"input": "7 3\n1 2 6 1 1 7 1",
"output": "3"
},
{
"input": "1 1\n100",
"output": "1"
},
{
"input": "2 1\n10 20",
"output": "1"
},
{
"input": "10 5\n1 2 3 1 2 2 3 1 4 5",
"output": "1"
},
{
"input": "10 2\n3 1 4 1 4 6 2 1 4 6",
"output": "7"
},
{
"input": "2 2\n20 10",
"output": "1"
},
{
"input": "2 1\n20 1",
"output": "2"
},
{
"input": "3 1\n1 2 3",
"output": "1"
},
{
"input": "3 1\n2 1 3",
"output": "2"
},
{
"input": "3 1\n3 2 1",
"output": "3"
},
{
"input": "3 2\n1 2 3",
"output": "1"
},
{
"input": "3 2\n3 2 1",
"output": "2"
},
{
"input": "3 3\n1 2 3",
"output": "1"
},
{
"input": "4 2\n9 8 11 7",
"output": "1"
},
{
"input": "4 2\n10 1 2 3",
"output": "2"
},
{
"input": "6 3\n56 56 56 2 1 2",
"output": "4"
},
{
"input": "8 3\n1 1 1 1 2 60 90 1",
"output": "1"
},
{
"input": "4 1\n1 5 2 2",
"output": "1"
},
{
"input": "4 2\n4 6 7 4",
"output": "1"
},
{
"input": "10 4\n1 1 1 4 4 4 4 4 4 3",
"output": "1"
},
{
"input": "6 3\n1 2 1 3 1 1",
"output": "1"
},
{
"input": "5 2\n100 100 100 1 1",
"output": "4"
}
] | 1,688,494,412
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 51
| 93
| 17,612,800
|
from sys import stdin, stdout
def input():
return stdin.readline().strip()
def print(string):
return stdout.write(str(string) + "\n")
def main():
n, k = map(int, input().split())
h = [int(x) for x in input().split()]
dp = [None] * n
dp[0] = sum(h[:k])
smallest_i = 0
for i in range(n-k):
dp[i+1] = dp[i] - h[i] + h[i+k]
if dp[i+1] < dp[smallest_i]:
smallest_i = i+1
print(smallest_i+1)
if __name__ == "__main__":
main()
|
Title: Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a fence in front of Polycarpus's home. The fence consists of *n* planks of the same width which go one after another from left to right. The height of the *i*-th plank is *h**i* meters, distinct planks can have distinct heights.
Polycarpus has bought a posh piano and is thinking about how to get it into the house. In order to carry out his plan, he needs to take exactly *k* consecutive planks from the fence. Higher planks are harder to tear off the fence, so Polycarpus wants to find such *k* consecutive planks that the sum of their heights is minimal possible.
Write the program that finds the indexes of *k* consecutive planks with minimal total height. Pay attention, the fence is not around Polycarpus's home, it is in front of home (in other words, the fence isn't cyclic).
Input Specification:
The first line of the input contains integers *n* and *k* (1<=≤<=*n*<=≤<=1.5·105,<=1<=≤<=*k*<=≤<=*n*) — the number of planks in the fence and the width of the hole for the piano. The second line contains the sequence of integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=100), where *h**i* is the height of the *i*-th plank of the fence.
Output Specification:
Print such integer *j* that the sum of the heights of planks *j*, *j*<=+<=1, ..., *j*<=+<=*k*<=-<=1 is the minimum possible. If there are multiple such *j*'s, print any of them.
Demo Input:
['7 3\n1 2 6 1 1 7 1\n']
Demo Output:
['3\n']
Note:
In the sample, your task is to find three consecutive planks with the minimum sum of heights. In the given case three planks with indexes 3, 4 and 5 have the required attribute, their total height is 8.
|
```python
from sys import stdin, stdout
def input():
return stdin.readline().strip()
def print(string):
return stdout.write(str(string) + "\n")
def main():
n, k = map(int, input().split())
h = [int(x) for x in input().split()]
dp = [None] * n
dp[0] = sum(h[:k])
smallest_i = 0
for i in range(n-k):
dp[i+1] = dp[i] - h[i] + h[i+k]
if dp[i+1] < dp[smallest_i]:
smallest_i = i+1
print(smallest_i+1)
if __name__ == "__main__":
main()
```
| 3
|
|
716
|
A
|
Crazy Computer
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear!
More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=><=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen.
For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen.
You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything.
|
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively.
The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=...<=<<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word.
|
Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*.
|
[
"6 5\n1 3 8 14 19 20\n",
"6 1\n1 3 5 7 9 10\n"
] |
[
"3",
"2"
] |
The first sample is already explained in the problem statement.
For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 > 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1.
| 500
|
[
{
"input": "6 5\n1 3 8 14 19 20",
"output": "3"
},
{
"input": "6 1\n1 3 5 7 9 10",
"output": "2"
},
{
"input": "1 1\n1000000000",
"output": "1"
},
{
"input": "5 5\n1 7 12 13 14",
"output": "4"
},
{
"input": "2 1000000000\n1 1000000000",
"output": "2"
},
{
"input": "3 5\n1 10 20",
"output": "1"
},
{
"input": "3 10\n1 2 3",
"output": "3"
},
{
"input": "2 1\n1 100",
"output": "1"
},
{
"input": "3 1\n1 2 10",
"output": "1"
},
{
"input": "2 1\n1 2",
"output": "2"
}
] | 1,568,221,442
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 81
| 249
| 11,366,400
|
n,c=map(int,input().split())
s=1
l=list(map(int,input().split()))
a=l[0]
b=0
for i in range(1,len(l)):
b=l[i]
if(b-a<=c):
s+=1
else:
s=1
a=l[i]
print(str(s),end="")
|
Title: Crazy Computer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear!
More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=><=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen.
For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen.
You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything.
Input Specification:
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively.
The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=...<=<<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word.
Output Specification:
Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*.
Demo Input:
['6 5\n1 3 8 14 19 20\n', '6 1\n1 3 5 7 9 10\n']
Demo Output:
['3', '2']
Note:
The first sample is already explained in the problem statement.
For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 > 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1.
|
```python
n,c=map(int,input().split())
s=1
l=list(map(int,input().split()))
a=l[0]
b=0
for i in range(1,len(l)):
b=l[i]
if(b-a<=c):
s+=1
else:
s=1
a=l[i]
print(str(s),end="")
```
| 3
|
|
471
|
A
|
MUH and Sticks
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
Two polar bears Menshykov and Uslada from the St.Petersburg zoo and elephant Horace from the Kiev zoo got six sticks to play with and assess the animals' creativity. Menshykov, Uslada and Horace decided to make either an elephant or a bear from those sticks. They can make an animal from sticks in the following way:
- Four sticks represent the animal's legs, these sticks should have the same length. - Two remaining sticks represent the animal's head and body. The bear's head stick must be shorter than the body stick. The elephant, however, has a long trunk, so his head stick must be as long as the body stick. Note that there are no limits on the relations between the leg sticks and the head and body sticks.
Your task is to find out which animal can be made from the given stick set. The zoo keeper wants the sticks back after the game, so they must never be broken, even bears understand it.
|
The single line contains six space-separated integers *l**i* (1<=≤<=*l**i*<=≤<=9) — the lengths of the six sticks. It is guaranteed that the input is such that you cannot make both animals from the sticks.
|
If you can make a bear from the given set, print string "Bear" (without the quotes). If you can make an elephant, print string "Elephant" (wıthout the quotes). If you can make neither a bear nor an elephant, print string "Alien" (without the quotes).
|
[
"4 2 5 4 4 4\n",
"4 4 5 4 4 5\n",
"1 2 3 4 5 6\n"
] |
[
"Bear",
"Elephant",
"Alien"
] |
If you're out of creative ideas, see instructions below which show how to make a bear and an elephant in the first two samples. The stick of length 2 is in red, the sticks of length 4 are in green, the sticks of length 5 are in blue.
| 500
|
[
{
"input": "4 2 5 4 4 4",
"output": "Bear"
},
{
"input": "4 4 5 4 4 5",
"output": "Elephant"
},
{
"input": "1 2 3 4 5 6",
"output": "Alien"
},
{
"input": "5 5 5 5 5 5",
"output": "Elephant"
},
{
"input": "1 1 1 2 3 5",
"output": "Alien"
},
{
"input": "1 1 1 1 1 1",
"output": "Elephant"
},
{
"input": "9 9 9 9 9 9",
"output": "Elephant"
},
{
"input": "1 8 9 1 1 1",
"output": "Bear"
},
{
"input": "9 9 9 1 9 9",
"output": "Bear"
},
{
"input": "1 2 3 8 9 7",
"output": "Alien"
},
{
"input": "5 5 5 6 6 6",
"output": "Alien"
},
{
"input": "1 1 2 2 3 4",
"output": "Alien"
},
{
"input": "4 4 4 4 4 2",
"output": "Bear"
},
{
"input": "2 2 3 3 4 4",
"output": "Alien"
},
{
"input": "4 4 4 4 4 5",
"output": "Bear"
},
{
"input": "1 1 2 2 2 2",
"output": "Elephant"
},
{
"input": "1 2 5 5 5 5",
"output": "Bear"
},
{
"input": "4 4 2 2 2 2",
"output": "Elephant"
},
{
"input": "1 1 1 1 1 2",
"output": "Bear"
},
{
"input": "2 2 4 4 4 4",
"output": "Elephant"
},
{
"input": "4 4 4 4 4 3",
"output": "Bear"
},
{
"input": "4 4 5 6 7 8",
"output": "Alien"
},
{
"input": "4 4 4 4 2 2",
"output": "Elephant"
},
{
"input": "1 1 1 1 2 2",
"output": "Elephant"
},
{
"input": "1 1 3 3 3 5",
"output": "Alien"
},
{
"input": "1 2 2 3 3 3",
"output": "Alien"
},
{
"input": "1 2 2 2 2 2",
"output": "Bear"
},
{
"input": "1 3 3 3 4 5",
"output": "Alien"
},
{
"input": "5 1 1 1 1 1",
"output": "Bear"
}
] | 1,653,783,028
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 46
| 0
|
sticks = list(map(int, input().split()))
#print(sticks)
sticks.sort()
hb = [(0, 5), (4, 5), (0, 1)]
for head, body in hb:
cur = sticks[3]
flag = True
for i in range(6):
if i != head and i != body:
if sticks[i] != cur:
flag = False
break
if not flag:
continue
if sticks[head] < sticks[body]:
print("Bear")
else:
print("Elephant")
exit()
print("Alien")
|
Title: MUH and Sticks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two polar bears Menshykov and Uslada from the St.Petersburg zoo and elephant Horace from the Kiev zoo got six sticks to play with and assess the animals' creativity. Menshykov, Uslada and Horace decided to make either an elephant or a bear from those sticks. They can make an animal from sticks in the following way:
- Four sticks represent the animal's legs, these sticks should have the same length. - Two remaining sticks represent the animal's head and body. The bear's head stick must be shorter than the body stick. The elephant, however, has a long trunk, so his head stick must be as long as the body stick. Note that there are no limits on the relations between the leg sticks and the head and body sticks.
Your task is to find out which animal can be made from the given stick set. The zoo keeper wants the sticks back after the game, so they must never be broken, even bears understand it.
Input Specification:
The single line contains six space-separated integers *l**i* (1<=≤<=*l**i*<=≤<=9) — the lengths of the six sticks. It is guaranteed that the input is such that you cannot make both animals from the sticks.
Output Specification:
If you can make a bear from the given set, print string "Bear" (without the quotes). If you can make an elephant, print string "Elephant" (wıthout the quotes). If you can make neither a bear nor an elephant, print string "Alien" (without the quotes).
Demo Input:
['4 2 5 4 4 4\n', '4 4 5 4 4 5\n', '1 2 3 4 5 6\n']
Demo Output:
['Bear', 'Elephant', 'Alien']
Note:
If you're out of creative ideas, see instructions below which show how to make a bear and an elephant in the first two samples. The stick of length 2 is in red, the sticks of length 4 are in green, the sticks of length 5 are in blue.
|
```python
sticks = list(map(int, input().split()))
#print(sticks)
sticks.sort()
hb = [(0, 5), (4, 5), (0, 1)]
for head, body in hb:
cur = sticks[3]
flag = True
for i in range(6):
if i != head and i != body:
if sticks[i] != cur:
flag = False
break
if not flag:
continue
if sticks[head] < sticks[body]:
print("Bear")
else:
print("Elephant")
exit()
print("Alien")
```
| 3
|
|
331
|
C1
|
The Great Julya Calendar
|
PROGRAMMING
| 1,100
|
[
"dp"
] | null | null |
Yet another Armageddon is coming! This time the culprit is the Julya tribe calendar.
The beavers in this tribe knew math very well. Smart Beaver, an archaeologist, got a sacred plate with a magic integer on it. The translation from Old Beaverish is as follows:
"May the Great Beaver bless you! May your chacres open and may your third eye never turn blind from beholding the Truth! Take the magic number, subtract a digit from it (the digit must occur in the number) and get a new magic number. Repeat this operation until a magic number equals zero. The Earth will stand on Three Beavers for the time, equal to the number of subtractions you perform!"
Distinct subtraction sequences can obviously get you different number of operations. But the Smart Beaver is ready to face the worst and is asking you to count the minimum number of operations he needs to reduce the magic number to zero.
|
The single line contains the magic integer *n*, 0<=≤<=*n*.
- to get 20 points, you need to solve the problem with constraints: *n*<=≤<=106 (subproblem C1); - to get 40 points, you need to solve the problem with constraints: *n*<=≤<=1012 (subproblems C1+C2); - to get 100 points, you need to solve the problem with constraints: *n*<=≤<=1018 (subproblems C1+C2+C3).
|
Print a single integer — the minimum number of subtractions that turns the magic number to a zero.
|
[
"24\n"
] |
[
"5"
] |
In the first test sample the minimum number of operations can be reached by the following sequence of subtractions:
| 20
|
[
{
"input": "24",
"output": "5"
},
{
"input": "0",
"output": "0"
},
{
"input": "3",
"output": "1"
},
{
"input": "8",
"output": "1"
},
{
"input": "9",
"output": "1"
},
{
"input": "10",
"output": "2"
},
{
"input": "31",
"output": "6"
},
{
"input": "701",
"output": "116"
},
{
"input": "222",
"output": "39"
},
{
"input": "156",
"output": "28"
},
{
"input": "12343",
"output": "1778"
},
{
"input": "7984",
"output": "1178"
},
{
"input": "1000000",
"output": "128207"
},
{
"input": "1",
"output": "1"
},
{
"input": "3",
"output": "1"
},
{
"input": "5",
"output": "1"
},
{
"input": "11",
"output": "3"
},
{
"input": "77",
"output": "14"
},
{
"input": "216",
"output": "37"
},
{
"input": "1468",
"output": "233"
},
{
"input": "1995",
"output": "305"
},
{
"input": "11010",
"output": "1568"
},
{
"input": "47320",
"output": "6746"
},
{
"input": "258634",
"output": "35024"
}
] | 1,608,833,155
| 2,147,483,647
|
Python 3
|
OK
|
TESTS1
| 24
| 404
| 0
|
n,c=int(input()),0
while n:n-=int(max(str(n)));c+=1
print(c)
|
Title: The Great Julya Calendar
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Yet another Armageddon is coming! This time the culprit is the Julya tribe calendar.
The beavers in this tribe knew math very well. Smart Beaver, an archaeologist, got a sacred plate with a magic integer on it. The translation from Old Beaverish is as follows:
"May the Great Beaver bless you! May your chacres open and may your third eye never turn blind from beholding the Truth! Take the magic number, subtract a digit from it (the digit must occur in the number) and get a new magic number. Repeat this operation until a magic number equals zero. The Earth will stand on Three Beavers for the time, equal to the number of subtractions you perform!"
Distinct subtraction sequences can obviously get you different number of operations. But the Smart Beaver is ready to face the worst and is asking you to count the minimum number of operations he needs to reduce the magic number to zero.
Input Specification:
The single line contains the magic integer *n*, 0<=≤<=*n*.
- to get 20 points, you need to solve the problem with constraints: *n*<=≤<=106 (subproblem C1); - to get 40 points, you need to solve the problem with constraints: *n*<=≤<=1012 (subproblems C1+C2); - to get 100 points, you need to solve the problem with constraints: *n*<=≤<=1018 (subproblems C1+C2+C3).
Output Specification:
Print a single integer — the minimum number of subtractions that turns the magic number to a zero.
Demo Input:
['24\n']
Demo Output:
['5']
Note:
In the first test sample the minimum number of operations can be reached by the following sequence of subtractions:
|
```python
n,c=int(input()),0
while n:n-=int(max(str(n)));c+=1
print(c)
```
| 3
|
|
858
|
A
|
k-rounding
|
PROGRAMMING
| 1,100
|
[
"brute force",
"math",
"number theory"
] | null | null |
For a given positive integer *n* denote its *k*-rounding as the minimum positive integer *x*, such that *x* ends with *k* or more zeros in base 10 and is divisible by *n*.
For example, 4-rounding of 375 is 375·80<==<=30000. 30000 is the minimum integer such that it ends with 4 or more zeros and is divisible by 375.
Write a program that will perform the *k*-rounding of *n*.
|
The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=109, 0<=≤<=*k*<=≤<=8).
|
Print the *k*-rounding of *n*.
|
[
"375 4\n",
"10000 1\n",
"38101 0\n",
"123456789 8\n"
] |
[
"30000\n",
"10000\n",
"38101\n",
"12345678900000000\n"
] |
none
| 750
|
[
{
"input": "375 4",
"output": "30000"
},
{
"input": "10000 1",
"output": "10000"
},
{
"input": "38101 0",
"output": "38101"
},
{
"input": "123456789 8",
"output": "12345678900000000"
},
{
"input": "1 0",
"output": "1"
},
{
"input": "2 0",
"output": "2"
},
{
"input": "100 0",
"output": "100"
},
{
"input": "1000000000 0",
"output": "1000000000"
},
{
"input": "160 2",
"output": "800"
},
{
"input": "3 0",
"output": "3"
},
{
"input": "10 0",
"output": "10"
},
{
"input": "1 1",
"output": "10"
},
{
"input": "2 1",
"output": "10"
},
{
"input": "3 1",
"output": "30"
},
{
"input": "4 1",
"output": "20"
},
{
"input": "5 1",
"output": "10"
},
{
"input": "6 1",
"output": "30"
},
{
"input": "7 1",
"output": "70"
},
{
"input": "8 1",
"output": "40"
},
{
"input": "9 1",
"output": "90"
},
{
"input": "10 1",
"output": "10"
},
{
"input": "11 1",
"output": "110"
},
{
"input": "12 1",
"output": "60"
},
{
"input": "16 2",
"output": "400"
},
{
"input": "2 2",
"output": "100"
},
{
"input": "1 2",
"output": "100"
},
{
"input": "5 2",
"output": "100"
},
{
"input": "15 2",
"output": "300"
},
{
"input": "36 2",
"output": "900"
},
{
"input": "1 8",
"output": "100000000"
},
{
"input": "8 8",
"output": "100000000"
},
{
"input": "96 8",
"output": "300000000"
},
{
"input": "175 8",
"output": "700000000"
},
{
"input": "9999995 8",
"output": "199999900000000"
},
{
"input": "999999999 8",
"output": "99999999900000000"
},
{
"input": "12345678 8",
"output": "617283900000000"
},
{
"input": "78125 8",
"output": "100000000"
},
{
"input": "390625 8",
"output": "100000000"
},
{
"input": "1953125 8",
"output": "500000000"
},
{
"input": "9765625 8",
"output": "2500000000"
},
{
"input": "68359375 8",
"output": "17500000000"
},
{
"input": "268435456 8",
"output": "104857600000000"
},
{
"input": "125829120 8",
"output": "9830400000000"
},
{
"input": "128000 8",
"output": "400000000"
},
{
"input": "300000 8",
"output": "300000000"
},
{
"input": "3711871 8",
"output": "371187100000000"
},
{
"input": "55555 8",
"output": "1111100000000"
},
{
"input": "222222222 8",
"output": "11111111100000000"
},
{
"input": "479001600 8",
"output": "7484400000000"
},
{
"input": "655360001 7",
"output": "6553600010000000"
},
{
"input": "655360001 8",
"output": "65536000100000000"
},
{
"input": "1000000000 1",
"output": "1000000000"
},
{
"input": "1000000000 7",
"output": "1000000000"
},
{
"input": "1000000000 8",
"output": "1000000000"
},
{
"input": "100000000 8",
"output": "100000000"
},
{
"input": "10000000 8",
"output": "100000000"
},
{
"input": "1000000 8",
"output": "100000000"
},
{
"input": "10000009 8",
"output": "1000000900000000"
},
{
"input": "10000005 8",
"output": "200000100000000"
},
{
"input": "10000002 8",
"output": "500000100000000"
},
{
"input": "999999997 8",
"output": "99999999700000000"
},
{
"input": "999999997 7",
"output": "9999999970000000"
},
{
"input": "999999995 8",
"output": "19999999900000000"
},
{
"input": "123 8",
"output": "12300000000"
},
{
"input": "24 2",
"output": "600"
},
{
"input": "16 4",
"output": "10000"
},
{
"input": "123456787 8",
"output": "12345678700000000"
},
{
"input": "100000000 8",
"output": "100000000"
},
{
"input": "7 1",
"output": "70"
},
{
"input": "101 1",
"output": "1010"
},
{
"input": "50 2",
"output": "100"
},
{
"input": "999999818 1",
"output": "4999999090"
},
{
"input": "2 1",
"output": "10"
},
{
"input": "123 1",
"output": "1230"
},
{
"input": "16 1",
"output": "80"
},
{
"input": "1 1",
"output": "10"
},
{
"input": "1000000000 8",
"output": "1000000000"
},
{
"input": "15304 6",
"output": "1913000000"
},
{
"input": "3 8",
"output": "300000000"
},
{
"input": "4 2",
"output": "100"
},
{
"input": "100000 7",
"output": "10000000"
},
{
"input": "5 8",
"output": "100000000"
},
{
"input": "16724 6",
"output": "4181000000"
},
{
"input": "999999999 1",
"output": "9999999990"
},
{
"input": "999999990 8",
"output": "9999999900000000"
},
{
"input": "999999999 8",
"output": "99999999900000000"
},
{
"input": "100000 1",
"output": "100000"
},
{
"input": "8 3",
"output": "1000"
},
{
"input": "16768 6",
"output": "262000000"
},
{
"input": "123456789 1",
"output": "1234567890"
},
{
"input": "2 8",
"output": "100000000"
},
{
"input": "999999937 8",
"output": "99999993700000000"
},
{
"input": "5 1",
"output": "10"
},
{
"input": "2000000 7",
"output": "10000000"
},
{
"input": "1999998 2",
"output": "99999900"
},
{
"input": "125 3",
"output": "1000"
}
] | 1,635,928,116
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 96
| 46
| 4,300,800
|
def gcd(a, b):
if a == 0:
return b
return gcd(b % a, a)
def nok(a, b):
return a // gcd(a, b) * b
n, k = map(int, input().split())
print(nok(n, 10 ** k))
|
Title: k-rounding
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
For a given positive integer *n* denote its *k*-rounding as the minimum positive integer *x*, such that *x* ends with *k* or more zeros in base 10 and is divisible by *n*.
For example, 4-rounding of 375 is 375·80<==<=30000. 30000 is the minimum integer such that it ends with 4 or more zeros and is divisible by 375.
Write a program that will perform the *k*-rounding of *n*.
Input Specification:
The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=109, 0<=≤<=*k*<=≤<=8).
Output Specification:
Print the *k*-rounding of *n*.
Demo Input:
['375 4\n', '10000 1\n', '38101 0\n', '123456789 8\n']
Demo Output:
['30000\n', '10000\n', '38101\n', '12345678900000000\n']
Note:
none
|
```python
def gcd(a, b):
if a == 0:
return b
return gcd(b % a, a)
def nok(a, b):
return a // gcd(a, b) * b
n, k = map(int, input().split())
print(nok(n, 10 ** k))
```
| 3
|
|
61
|
A
|
Ultra-Fast Mathematician
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Ultra-Fast Mathematician
|
2
|
256
|
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
|
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
|
Write one line — the corresponding answer. Do not omit the leading 0s.
|
[
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] |
[
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] |
none
| 500
|
[
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,590,096,910
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 102
| 140
| 0
|
a = input()
n = len(a)
a = int(a, 2)
a ^= int(input(),2)
a = bin(a)[2:]
print('0'*(n-len(a))+a)
|
Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none
|
```python
a = input()
n = len(a)
a = int(a, 2)
a ^= int(input(),2)
a = bin(a)[2:]
print('0'*(n-len(a))+a)
```
| 3.965
|
127
|
A
|
Wasted Time
|
PROGRAMMING
| 900
|
[
"geometry"
] | null | null |
Mr. Scrooge, a very busy man, decided to count the time he wastes on all sorts of useless stuff to evaluate the lost profit. He has already counted the time he wastes sleeping and eating. And now Mr. Scrooge wants to count the time he has wasted signing papers.
Mr. Scrooge's signature can be represented as a polyline *A*1*A*2... *A**n*. Scrooge signs like that: first it places a pen at the point *A*1, then draws a segment from point *A*1 to point *A*2, then he draws a segment from point *A*2 to point *A*3 and so on to point *A**n*, where he stops signing and takes the pen off the paper. At that the resulting line can intersect with itself and partially repeat itself but Scrooge pays no attention to it and never changes his signing style. As Scrooge makes the signature, he never takes the pen off the paper and his writing speed is constant — 50 millimeters per second.
Scrooge signed exactly *k* papers throughout his life and all those signatures look the same.
Find the total time Scrooge wasted signing the papers.
|
The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000). Each of the following *n* lines contains the coordinates of the polyline's endpoints. The *i*-th one contains coordinates of the point *A**i* — integers *x**i* and *y**i*, separated by a space.
All points *A**i* are different. The absolute value of all coordinates does not exceed 20. The coordinates are measured in millimeters.
|
Print one real number — the total time Scrooges wastes on signing the papers in seconds. The absolute or relative error should not exceed 10<=-<=6.
|
[
"2 1\n0 0\n10 0\n",
"5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0\n",
"6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0\n"
] |
[
"0.200000000",
"6.032163204",
"3.000000000"
] |
none
| 500
|
[
{
"input": "2 1\n0 0\n10 0",
"output": "0.200000000"
},
{
"input": "5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0",
"output": "6.032163204"
},
{
"input": "6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0",
"output": "3.000000000"
},
{
"input": "10 95\n-20 -5\n2 -8\n14 13\n10 3\n17 11\n13 -12\n-6 11\n14 -15\n-13 14\n19 8",
"output": "429.309294877"
},
{
"input": "30 1000\n4 -13\n14 13\n-14 -16\n-9 18\n17 11\n2 -8\n2 15\n8 -1\n-9 13\n8 -12\n-2 20\n11 -12\n19 8\n9 -15\n-20 -5\n-18 20\n-13 14\n-12 -17\n-4 3\n13 -12\n11 -10\n18 7\n-6 11\n10 13\n10 3\n6 -14\n-1 10\n14 -15\n2 11\n-8 10",
"output": "13629.282573522"
},
{
"input": "2 1\n-20 -10\n-10 -6",
"output": "0.215406592"
},
{
"input": "2 13\n13 -10\n-3 -2",
"output": "4.651021393"
},
{
"input": "2 21\n13 8\n14 10",
"output": "0.939148551"
},
{
"input": "2 75\n-3 12\n1 12",
"output": "6.000000000"
},
{
"input": "2 466\n10 16\n-6 -3",
"output": "231.503997374"
},
{
"input": "2 999\n6 16\n-17 -14",
"output": "755.286284531"
},
{
"input": "2 1000\n-17 -14\n-14 -8",
"output": "134.164078650"
},
{
"input": "3 384\n-4 -19\n-17 -2\n3 4",
"output": "324.722285390"
},
{
"input": "5 566\n-11 8\n2 -7\n7 0\n-7 -9\n-7 5",
"output": "668.956254495"
},
{
"input": "7 495\n-10 -13\n-9 -5\n4 9\n8 13\n-4 2\n2 10\n-18 15",
"output": "789.212495576"
},
{
"input": "10 958\n7 13\n20 19\n12 -7\n10 -10\n-13 -15\n-10 -7\n20 -5\n-11 19\n-7 3\n-4 18",
"output": "3415.618464093"
},
{
"input": "13 445\n-15 16\n-8 -14\n8 7\n4 15\n8 -13\n15 -11\n-12 -4\n2 -13\n-5 0\n-20 -14\n-8 -7\n-10 -18\n18 -5",
"output": "2113.552527680"
},
{
"input": "18 388\n11 -8\n13 10\n18 -17\n-15 3\n-13 -15\n20 -7\n1 -10\n-13 -12\n-12 -15\n-17 -8\n1 -2\n3 -20\n-8 -9\n15 -13\n-19 -6\n17 3\n-17 2\n6 6",
"output": "2999.497312668"
},
{
"input": "25 258\n-5 -3\n-18 -14\n12 3\n6 11\n4 2\n-19 -3\n19 -7\n-15 19\n-19 -12\n-11 -10\n-5 17\n10 15\n-4 1\n-3 -20\n6 16\n18 -19\n11 -19\n-17 10\n-17 17\n-2 -17\n-3 -9\n18 13\n14 8\n-2 -5\n-11 4",
"output": "2797.756635934"
},
{
"input": "29 848\n11 -10\n-19 1\n18 18\n19 -19\n0 -5\n16 10\n-20 -14\n7 15\n6 8\n-15 -16\n9 3\n16 -20\n-12 12\n18 -1\n-11 14\n18 10\n11 -20\n-20 -16\n-1 11\n13 10\n-6 13\n-7 -10\n-11 -10\n-10 3\n15 -13\n-4 11\n-13 -11\n-11 -17\n11 -5",
"output": "12766.080247922"
},
{
"input": "36 3\n-11 20\n-11 13\n-17 9\n15 9\n-6 9\n-1 11\n12 -11\n16 -10\n-20 7\n-18 6\n-15 -2\n20 -20\n16 4\n-20 -8\n-12 -15\n-13 -6\n-9 -4\n0 -10\n8 -1\n1 4\n5 8\n8 -15\n16 -12\n19 1\n0 -4\n13 -4\n17 -13\n-7 11\n14 9\n-14 -9\n5 -8\n11 -8\n-17 -5\n1 -3\n-16 -17\n2 -3",
"output": "36.467924851"
},
{
"input": "48 447\n14 9\n9 -17\n-17 11\n-14 14\n19 -8\n-14 -17\n-7 10\n-6 -11\n-9 -19\n19 10\n-4 2\n-5 16\n20 9\n-10 20\n-7 -17\n14 -16\n-2 -10\n-18 -17\n14 12\n-6 -19\n5 -18\n-3 2\n-3 10\n-5 5\n13 -12\n10 -18\n10 -12\n-2 4\n7 -15\n-5 -5\n11 14\n11 10\n-6 -9\n13 -4\n13 9\n6 12\n-13 17\n-9 -12\n14 -19\n10 12\n-15 8\n-1 -11\n19 8\n11 20\n-9 -3\n16 1\n-14 19\n8 -4",
"output": "9495.010556306"
},
{
"input": "50 284\n-17 -13\n7 12\n-13 0\n13 1\n14 6\n14 -9\n-5 -1\n0 -10\n12 -3\n-14 6\n-8 10\n-16 17\n0 -1\n4 -9\n2 6\n1 8\n-8 -14\n3 9\n1 -15\n-4 -19\n-7 -20\n18 10\n3 -11\n10 16\n2 -6\n-9 19\n-3 -1\n20 9\n-12 -5\n-10 -2\n16 -7\n-16 -18\n-2 17\n2 8\n7 -15\n4 1\n6 -17\n19 9\n-10 -20\n5 2\n10 -2\n3 7\n20 0\n8 -14\n-16 -1\n-20 7\n20 -19\n17 18\n-11 -18\n-16 14",
"output": "6087.366930474"
},
{
"input": "57 373\n18 3\n-4 -1\n18 5\n-7 -15\n-6 -10\n-19 1\n20 15\n15 4\n-1 -2\n13 -14\n0 12\n10 3\n-16 -17\n-14 -9\n-11 -10\n17 19\n-2 6\n-12 -15\n10 20\n16 7\n9 -1\n4 13\n8 -2\n-1 -16\n-3 8\n14 11\n-12 3\n-5 -6\n3 4\n5 7\n-9 9\n11 4\n-19 10\n-7 4\n-20 -12\n10 16\n13 11\n13 -11\n7 -1\n17 18\n-19 7\n14 13\n5 -1\n-7 6\n-1 -6\n6 20\n-16 2\n4 17\n16 -11\n-4 -20\n19 -18\n17 16\n-14 -8\n3 2\n-6 -16\n10 -10\n-13 -11",
"output": "8929.162822862"
},
{
"input": "60 662\n15 17\n-2 -19\n-4 -17\n10 0\n15 10\n-8 -14\n14 9\n-15 20\n6 5\n-9 0\n-13 20\n13 -2\n10 9\n7 5\n4 18\n-10 1\n6 -15\n15 -16\n6 13\n4 -6\n2 5\n18 19\n8 3\n-7 14\n-12 -20\n14 19\n-15 0\n-2 -12\n9 18\n14 4\n2 -20\n3 0\n20 9\n-5 11\n-11 1\n2 -19\n-14 -4\n18 6\n16 16\n15 3\n-1 -5\n9 20\n12 -8\n-1 10\n-4 -9\n3 6\n3 -12\n14 -10\n-8 10\n-18 6\n14 -2\n-14 -12\n-10 -7\n10 -6\n14 1\n6 14\n15 19\n4 14\n3 -14\n-9 -13",
"output": "16314.207721932"
},
{
"input": "61 764\n-9 15\n11 -8\n-6 -7\n-13 -19\n16 -16\n-5 -1\n20 -19\n-14 -1\n-11 4\n7 -2\n-3 2\n-14 -17\n15 18\n20 15\n-13 -2\n15 8\n3 13\n19 -10\n2 -6\n15 -3\n-12 11\n4 -16\n-14 20\n0 2\n11 -7\n-6 -11\n16 7\n8 -3\n16 -10\n-3 9\n9 5\n4 -1\n-17 9\n14 -4\n8 6\n-19 12\n10 -17\n-5 7\n7 -3\n5 3\n6 -14\n9 9\n-16 -19\n11 -16\n-17 15\n8 5\n16 -19\n-7 10\n14 -15\n15 19\n-20 -16\n6 -2\n-4 6\n7 -15\n1 -8\n20 -17\n3 7\n10 12\n10 -11\n-19 10\n0 -11",
"output": "22153.369189802"
}
] | 1,550,839,223
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 42
| 342
| 512,000
|
from collections import deque, Counter, OrderedDict
from heapq import nsmallest, nlargest
from math import ceil,floor,log,log2,sqrt,gcd,factorial,pow
def binNumber(n,size=4):
return bin(n)[2:].zfill(size)
def iar():
return list(map(int,input().split()))
def ini():
return int(input())
def isp():
return map(int,input().split())
def sti():
return str(input())
def par(a):
print(' '.join(list(map(str,a))))
def tdl(outerListSize,innerListSize,defaultValue = 0):
return [[defaultValue]*innerListSize for i in range(outerListSize)]
class pair:
def __init__(self,f,s):
self.fi = f
self.se = s
def __lt__(self,other):
return (self.fi,self.se) < (other.fi,other.se)
# ========= /\ /| |====/|
# | / \ | | / |
# | /____\ | | / |
# | / \ | | / |
# ========= / \ ===== |/====|
# code
def dist(x1,y1,x2,y2):
return sqrt((x2-x1)**2 + (y2-y1)**2)
if __name__ == "__main__":
n,k = isp()
s = 0
p = []
for _ in range(n):
x,y = isp()
p.append(pair(x,y))
for i in range(1,n):
s += dist(p[i].fi,p[i].se,p[i-1].fi,p[i-1].se)
s *= k
print(s/50)
|
Title: Wasted Time
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mr. Scrooge, a very busy man, decided to count the time he wastes on all sorts of useless stuff to evaluate the lost profit. He has already counted the time he wastes sleeping and eating. And now Mr. Scrooge wants to count the time he has wasted signing papers.
Mr. Scrooge's signature can be represented as a polyline *A*1*A*2... *A**n*. Scrooge signs like that: first it places a pen at the point *A*1, then draws a segment from point *A*1 to point *A*2, then he draws a segment from point *A*2 to point *A*3 and so on to point *A**n*, where he stops signing and takes the pen off the paper. At that the resulting line can intersect with itself and partially repeat itself but Scrooge pays no attention to it and never changes his signing style. As Scrooge makes the signature, he never takes the pen off the paper and his writing speed is constant — 50 millimeters per second.
Scrooge signed exactly *k* papers throughout his life and all those signatures look the same.
Find the total time Scrooge wasted signing the papers.
Input Specification:
The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000). Each of the following *n* lines contains the coordinates of the polyline's endpoints. The *i*-th one contains coordinates of the point *A**i* — integers *x**i* and *y**i*, separated by a space.
All points *A**i* are different. The absolute value of all coordinates does not exceed 20. The coordinates are measured in millimeters.
Output Specification:
Print one real number — the total time Scrooges wastes on signing the papers in seconds. The absolute or relative error should not exceed 10<=-<=6.
Demo Input:
['2 1\n0 0\n10 0\n', '5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0\n', '6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0\n']
Demo Output:
['0.200000000', '6.032163204', '3.000000000']
Note:
none
|
```python
from collections import deque, Counter, OrderedDict
from heapq import nsmallest, nlargest
from math import ceil,floor,log,log2,sqrt,gcd,factorial,pow
def binNumber(n,size=4):
return bin(n)[2:].zfill(size)
def iar():
return list(map(int,input().split()))
def ini():
return int(input())
def isp():
return map(int,input().split())
def sti():
return str(input())
def par(a):
print(' '.join(list(map(str,a))))
def tdl(outerListSize,innerListSize,defaultValue = 0):
return [[defaultValue]*innerListSize for i in range(outerListSize)]
class pair:
def __init__(self,f,s):
self.fi = f
self.se = s
def __lt__(self,other):
return (self.fi,self.se) < (other.fi,other.se)
# ========= /\ /| |====/|
# | / \ | | / |
# | /____\ | | / |
# | / \ | | / |
# ========= / \ ===== |/====|
# code
def dist(x1,y1,x2,y2):
return sqrt((x2-x1)**2 + (y2-y1)**2)
if __name__ == "__main__":
n,k = isp()
s = 0
p = []
for _ in range(n):
x,y = isp()
p.append(pair(x,y))
for i in range(1,n):
s += dist(p[i].fi,p[i].se,p[i-1].fi,p[i-1].se)
s *= k
print(s/50)
```
| 3
|
|
653
|
B
|
Bear and Compressing
|
PROGRAMMING
| 1,300
|
[
"brute force",
"dfs and similar",
"dp",
"strings"
] | null | null |
Limak is a little polar bear. Polar bears hate long strings and thus they like to compress them. You should also know that Limak is so young that he knows only first six letters of the English alphabet: 'a', 'b', 'c', 'd', 'e' and 'f'.
You are given a set of *q* possible operations. Limak can perform them in any order, any operation may be applied any number of times. The *i*-th operation is described by a string *a**i* of length two and a string *b**i* of length one. No two of *q* possible operations have the same string *a**i*.
When Limak has a string *s* he can perform the *i*-th operation on *s* if the first two letters of *s* match a two-letter string *a**i*. Performing the *i*-th operation removes first two letters of *s* and inserts there a string *b**i*. See the notes section for further clarification.
You may note that performing an operation decreases the length of a string *s* exactly by 1. Also, for some sets of operations there may be a string that cannot be compressed any further, because the first two letters don't match any *a**i*.
Limak wants to start with a string of length *n* and perform *n*<=-<=1 operations to finally get a one-letter string "a". In how many ways can he choose the starting string to be able to get "a"? Remember that Limak can use only letters he knows.
|
The first line contains two integers *n* and *q* (2<=≤<=*n*<=≤<=6, 1<=≤<=*q*<=≤<=36) — the length of the initial string and the number of available operations.
The next *q* lines describe the possible operations. The *i*-th of them contains two strings *a**i* and *b**i* (|*a**i*|<==<=2,<=|*b**i*|<==<=1). It's guaranteed that *a**i*<=≠<=*a**j* for *i*<=≠<=*j* and that all *a**i* and *b**i* consist of only first six lowercase English letters.
|
Print the number of strings of length *n* that Limak will be able to transform to string "a" by applying only operations given in the input.
|
[
"3 5\nab a\ncc c\nca a\nee c\nff d\n",
"2 8\naf e\ndc d\ncc f\nbc b\nda b\neb a\nbb b\nff c\n",
"6 2\nbb a\nba a\n"
] |
[
"4\n",
"1\n",
"0\n"
] |
In the first sample, we count initial strings of length 3 from which Limak can get a required string "a". There are 4 such strings: "abb", "cab", "cca", "eea". The first one Limak can compress using operation 1 two times (changing "ab" to a single "a"). The first operation would change "abb" to "ab" and the second operation would change "ab" to "a".
Other three strings may be compressed as follows:
- "cab" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ab" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "a" - "cca" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ca" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "a" - "eea" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ca" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "a"
In the second sample, the only correct initial string is "eb" because it can be immediately compressed to "a".
| 1,000
|
[
{
"input": "3 5\nab a\ncc c\nca a\nee c\nff d",
"output": "4"
},
{
"input": "2 8\naf e\ndc d\ncc f\nbc b\nda b\neb a\nbb b\nff c",
"output": "1"
},
{
"input": "6 2\nbb a\nba a",
"output": "0"
},
{
"input": "2 5\nfe b\nbb a\naf b\nfd b\nbf c",
"output": "1"
},
{
"input": "3 4\neb b\nbd a\ncd d\nbb b",
"output": "2"
},
{
"input": "3 36\nab b\nbb a\naf c\nbd b\ncd a\nff c\nce a\nae a\ncb a\nba a\nad d\ndb a\nbf a\nbe a\ncc b\ndc a\nbc a\nca e\naa e\nec b\nac e\ned b\ndf d\nfa b\nea a\nef b\nee a\nda c\ncf a\nfe d\ndd f\nde a\neb f\nfd a\nfc a\nfb a",
"output": "86"
},
{
"input": "4 20\naf a\nad a\nac a\nbe a\nbc a\naa a\nab a\nbb a\neb a\nbd a\nbf a\ndc a\nea a\ncf a\ncd a\ncb a\nee a\nca a\nba a\nce a",
"output": "500"
},
{
"input": "6 4\nca a\nbe f\nad a\ncf a",
"output": "3"
},
{
"input": "2 15\nbc c\nbd a\nab b\nca a\ndf b\naa c\nae b\nac c\ncd a\nba e\nad d\nbb d\ned a\nfa a\nbf b",
"output": "5"
},
{
"input": "2 36\nad a\nae f\nac a\naa a\ncb b\nde e\nbe a\nea d\ncd b\nab a\nbf a\nba d\ncc c\ndc a\naf a\nca e\nda c\nbb c\nee b\nbd a\ned b\ndf b\nfd c\ndb d\nbc a\ncf d\nff d\ndd a\neb c\nce a\nfa c\nfe b\nec c\nef b\nfb a\nfc a",
"output": "14"
},
{
"input": "3 20\nca a\nbf d\nac a\nad b\neb a\naf a\nbe c\nbd a\ncb a\ncd c\nce b\nbc c\nbb a\ndd f\ndc e\ncf e\nfc e\naa d\nba c\nae d",
"output": "29"
},
{
"input": "4 35\nae f\nad d\naa a\neb d\nfb a\nce b\naf c\nfe c\nca a\nab a\nbd d\nbc a\nbe a\nbb f\nba c\ncb a\ncd a\nac c\ncc b\nbf b\ndb a\nfa a\ned b\nea a\nee d\nec a\ncf d\ndd a\nfc a\ndf a\nff a\ndc b\nef d\nde e\nda b",
"output": "529"
},
{
"input": "5 10\nba a\nbb c\nad a\nac c\nbc b\nfa b\nab b\nbe a\nbf a\naa b",
"output": "184"
},
{
"input": "5 20\nbd a\nac a\nad a\ncc a\naf a\nbe a\nbb a\ncb a\nca a\nab a\nbc a\nae a\ndb a\naa a\nbf a\nde a\nba a\ncf a\nda a\ned a",
"output": "4320"
},
{
"input": "5 20\naf f\nae f\naa f\nbd f\nfc f\ndd f\nba f\nac f\nbe f\neb f\nad f\ncb f\nce f\ncf f\nbc f\nca f\nde f\nab f\nbf f\ncc f",
"output": "0"
},
{
"input": "5 36\nac a\ncc c\nae f\nca a\nba a\nbe c\ndc e\nbc a\naa a\nad d\naf b\ncd c\ndf c\nbf b\nfb e\nef a\nbb b\nbd a\nce b\nab b\ndb c\nda b\ncf d\nfd c\nfa a\ncb c\nfe a\nea a\nfc e\ndd d\nde a\neb a\nec a\ned d\nee c\nff a",
"output": "2694"
},
{
"input": "6 1\nbf a",
"output": "0"
},
{
"input": "6 5\naa b\nad d\nba b\ndc d\nac a",
"output": "1"
},
{
"input": "6 15\nad b\ncb b\naf b\nae c\nbc e\nbd a\nac a\nda b\nab c\ncc d\nce f\ndc b\nca a\nba c\nbb a",
"output": "744"
},
{
"input": "6 15\naf a\nae a\nbc a\ncc a\nbe a\nff a\nab a\nbd a\nce a\nad a\ndb a\nee a\nba a\nda a\naa a",
"output": "9375"
},
{
"input": "6 15\nab b\nbd b\nae b\ncd b\nac b\nba b\ndc b\nbc b\nbb b\nbf b\nef b\naa b\ndd b\ncf b\nfc b",
"output": "0"
},
{
"input": "6 24\nab b\ncb b\naf a\nde c\ndb c\nad b\nca c\nbe c\nda e\nbb a\nbf a\nae a\nbc c\nba a\naa a\ncc f\ndc a\nac b\ncf c\ndd b\ndf a\ncd d\nbd d\neb b",
"output": "7993"
},
{
"input": "6 35\ndc c\nba b\nae e\nab a\naa b\nbb a\nbe b\ndb b\naf b\ncd b\nde b\ncf d\nac b\neb a\ndd a\nce b\nad c\ncc a\ncb c\nbc a\nbd b\ndf d\nea e\nfe c\nbf a\nfc a\nef d\nec b\nda c\ned b\nca a\nff a\nee b\nfb b\nfa e",
"output": "15434"
},
{
"input": "6 36\nbf f\nbb d\nff f\nac a\nad c\nbd e\ndd a\naa c\nab a\nba b\naf a\nda c\nce f\nea c\nde a\nca f\ndc f\nec b\ncc a\nae b\nbe b\nbc c\nee e\ncb b\nfb a\ncd d\ndb a\nef a\ncf d\neb c\ndf b\nfd a\ned a\nfe c\nfa b\nfc a",
"output": "15314"
},
{
"input": "6 1\naa a",
"output": "1"
},
{
"input": "6 1\nbb a",
"output": "0"
},
{
"input": "6 1\nba a",
"output": "0"
},
{
"input": "6 1\nab a",
"output": "1"
},
{
"input": "6 36\nac a\naf a\ndb a\nab a\ncb a\nef a\nad a\nbd a\nfe a\nde a\nbe a\nbb a\naa a\nae a\ndf a\nbc a\nbf a\nce a\nba a\nfd a\ndc a\neb a\ncd a\nca a\nee a\ncc a\ncf a\ndd a\nda a\nec a\nfc a\nfa a\nea a\ned a\nff a\nfb a",
"output": "46656"
},
{
"input": "6 36\naf f\nbd f\nba f\nbf f\nac f\nbe f\nbc f\nef f\naa f\neb f\nab f\nae f\nda f\ndc f\ncd f\nea f\ncb f\nad f\nbb f\ncc f\nce f\ndf f\nfa f\ncf f\ned f\nfe f\nfd f\nee f\ndb f\nde f\ndd f\nca f\nfb f\nec f\nff f\nfc f",
"output": "0"
},
{
"input": "6 36\naa a\nab f\nac a\nad b\nae c\naf d\nba f\nbb a\nbc b\nbd c\nbe d\nbf e\nca f\ncb a\ncc b\ncd c\nce d\ncf e\nda f\ndb a\ndc b\ndd c\nde d\ndf e\nea f\neb a\nec b\ned c\nee d\nef e\nfa f\nfb a\nfc b\nfd c\nfe d\nff e",
"output": "9331"
},
{
"input": "5 5\nab a\ncc c\nca a\nee c\nff d",
"output": "8"
}
] | 1,458,381,605
| 5,105
|
Python 3
|
OK
|
TESTS
| 32
| 108
| 5,324,800
|
import collections
n, q = map(int, input().split())
d = collections.defaultdict(list)
cnt, t = [0] * 6, [0] * 6
for i in range(q):
s1, s2 = input().split()
d[s2].append(s1)
cnt[ord(s2) - ord('a')] += 1
for s in d['a']:
t[ord(s[0]) - ord('a')] += 1
for i in range(n - 2):
p = [0] * 6
for j in range(6):
if t[j] == 0:
continue
for s in d[chr(j + 97)]:
p[ord(s[0]) - ord('a')] += t[j]
t = p
print(sum(t))
|
Title: Bear and Compressing
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Limak is a little polar bear. Polar bears hate long strings and thus they like to compress them. You should also know that Limak is so young that he knows only first six letters of the English alphabet: 'a', 'b', 'c', 'd', 'e' and 'f'.
You are given a set of *q* possible operations. Limak can perform them in any order, any operation may be applied any number of times. The *i*-th operation is described by a string *a**i* of length two and a string *b**i* of length one. No two of *q* possible operations have the same string *a**i*.
When Limak has a string *s* he can perform the *i*-th operation on *s* if the first two letters of *s* match a two-letter string *a**i*. Performing the *i*-th operation removes first two letters of *s* and inserts there a string *b**i*. See the notes section for further clarification.
You may note that performing an operation decreases the length of a string *s* exactly by 1. Also, for some sets of operations there may be a string that cannot be compressed any further, because the first two letters don't match any *a**i*.
Limak wants to start with a string of length *n* and perform *n*<=-<=1 operations to finally get a one-letter string "a". In how many ways can he choose the starting string to be able to get "a"? Remember that Limak can use only letters he knows.
Input Specification:
The first line contains two integers *n* and *q* (2<=≤<=*n*<=≤<=6, 1<=≤<=*q*<=≤<=36) — the length of the initial string and the number of available operations.
The next *q* lines describe the possible operations. The *i*-th of them contains two strings *a**i* and *b**i* (|*a**i*|<==<=2,<=|*b**i*|<==<=1). It's guaranteed that *a**i*<=≠<=*a**j* for *i*<=≠<=*j* and that all *a**i* and *b**i* consist of only first six lowercase English letters.
Output Specification:
Print the number of strings of length *n* that Limak will be able to transform to string "a" by applying only operations given in the input.
Demo Input:
['3 5\nab a\ncc c\nca a\nee c\nff d\n', '2 8\naf e\ndc d\ncc f\nbc b\nda b\neb a\nbb b\nff c\n', '6 2\nbb a\nba a\n']
Demo Output:
['4\n', '1\n', '0\n']
Note:
In the first sample, we count initial strings of length 3 from which Limak can get a required string "a". There are 4 such strings: "abb", "cab", "cca", "eea". The first one Limak can compress using operation 1 two times (changing "ab" to a single "a"). The first operation would change "abb" to "ab" and the second operation would change "ab" to "a".
Other three strings may be compressed as follows:
- "cab" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ab" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "a" - "cca" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ca" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "a" - "eea" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ca" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "a"
In the second sample, the only correct initial string is "eb" because it can be immediately compressed to "a".
|
```python
import collections
n, q = map(int, input().split())
d = collections.defaultdict(list)
cnt, t = [0] * 6, [0] * 6
for i in range(q):
s1, s2 = input().split()
d[s2].append(s1)
cnt[ord(s2) - ord('a')] += 1
for s in d['a']:
t[ord(s[0]) - ord('a')] += 1
for i in range(n - 2):
p = [0] * 6
for j in range(6):
if t[j] == 0:
continue
for s in d[chr(j + 97)]:
p[ord(s[0]) - ord('a')] += t[j]
t = p
print(sum(t))
```
| 3
|
|
118
|
A
|
String Task
|
PROGRAMMING
| 1,000
|
[
"implementation",
"strings"
] | null | null |
Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it:
- deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones.
Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string.
Help Petya cope with this easy task.
|
The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.
|
Print the resulting string. It is guaranteed that this string is not empty.
|
[
"tour\n",
"Codeforces\n",
"aBAcAba\n"
] |
[
".t.r\n",
".c.d.f.r.c.s\n",
".b.c.b\n"
] |
none
| 500
|
[
{
"input": "tour",
"output": ".t.r"
},
{
"input": "Codeforces",
"output": ".c.d.f.r.c.s"
},
{
"input": "aBAcAba",
"output": ".b.c.b"
},
{
"input": "obn",
"output": ".b.n"
},
{
"input": "wpwl",
"output": ".w.p.w.l"
},
{
"input": "ggdvq",
"output": ".g.g.d.v.q"
},
{
"input": "pumesz",
"output": ".p.m.s.z"
},
{
"input": "g",
"output": ".g"
},
{
"input": "zjuotps",
"output": ".z.j.t.p.s"
},
{
"input": "jzbwuehe",
"output": ".j.z.b.w.h"
},
{
"input": "tnkgwuugu",
"output": ".t.n.k.g.w.g"
},
{
"input": "kincenvizh",
"output": ".k.n.c.n.v.z.h"
},
{
"input": "xattxjenual",
"output": ".x.t.t.x.j.n.l"
},
{
"input": "ktajqhpqsvhw",
"output": ".k.t.j.q.h.p.q.s.v.h.w"
},
{
"input": "xnhcigytnqcmy",
"output": ".x.n.h.c.g.t.n.q.c.m"
},
{
"input": "jfmtbejyilxcec",
"output": ".j.f.m.t.b.j.l.x.c.c"
},
{
"input": "D",
"output": ".d"
},
{
"input": "ab",
"output": ".b"
},
{
"input": "Ab",
"output": ".b"
},
{
"input": "aB",
"output": ".b"
},
{
"input": "AB",
"output": ".b"
},
{
"input": "ba",
"output": ".b"
},
{
"input": "bA",
"output": ".b"
},
{
"input": "Ba",
"output": ".b"
},
{
"input": "BA",
"output": ".b"
},
{
"input": "aab",
"output": ".b"
},
{
"input": "baa",
"output": ".b"
},
{
"input": "femOZeCArKCpUiHYnbBPTIOFmsHmcpObtPYcLCdjFrUMIyqYzAokKUiiKZRouZiNMoiOuGVoQzaaCAOkquRjmmKKElLNqCnhGdQM",
"output": ".f.m.z.c.r.k.c.p.h.n.b.b.p.t.f.m.s.h.m.c.p.b.t.p.c.l.c.d.j.f.r.m.q.z.k.k.k.z.r.z.n.m.g.v.q.z.c.k.q.r.j.m.m.k.k.l.l.n.q.c.n.h.g.d.q.m"
},
{
"input": "VMBPMCmMDCLFELLIISUJDWQRXYRDGKMXJXJHXVZADRZWVWJRKFRRNSAWKKDPZZLFLNSGUNIVJFBEQsMDHSBJVDTOCSCgZWWKvZZN",
"output": ".v.m.b.p.m.c.m.m.d.c.l.f.l.l.s.j.d.w.q.r.x.r.d.g.k.m.x.j.x.j.h.x.v.z.d.r.z.w.v.w.j.r.k.f.r.r.n.s.w.k.k.d.p.z.z.l.f.l.n.s.g.n.v.j.f.b.q.s.m.d.h.s.b.j.v.d.t.c.s.c.g.z.w.w.k.v.z.z.n"
},
{
"input": "MCGFQQJNUKuAEXrLXibVjClSHjSxmlkQGTKZrRaDNDomIPOmtSgjJAjNVIVLeUGUAOHNkCBwNObVCHOWvNkLFQQbFnugYVMkJruJ",
"output": ".m.c.g.f.q.q.j.n.k.x.r.l.x.b.v.j.c.l.s.h.j.s.x.m.l.k.q.g.t.k.z.r.r.d.n.d.m.p.m.t.s.g.j.j.j.n.v.v.l.g.h.n.k.c.b.w.n.b.v.c.h.w.v.n.k.l.f.q.q.b.f.n.g.v.m.k.j.r.j"
},
{
"input": "iyaiuiwioOyzUaOtAeuEYcevvUyveuyioeeueoeiaoeiavizeeoeyYYaaAOuouueaUioueauayoiuuyiuovyOyiyoyioaoyuoyea",
"output": ".w.z.t.c.v.v.v.v.z.v"
},
{
"input": "yjnckpfyLtzwjsgpcrgCfpljnjwqzgVcufnOvhxplvflxJzqxnhrwgfJmPzifgubvspffmqrwbzivatlmdiBaddiaktdsfPwsevl",
"output": ".j.n.c.k.p.f.l.t.z.w.j.s.g.p.c.r.g.c.f.p.l.j.n.j.w.q.z.g.v.c.f.n.v.h.x.p.l.v.f.l.x.j.z.q.x.n.h.r.w.g.f.j.m.p.z.f.g.b.v.s.p.f.f.m.q.r.w.b.z.v.t.l.m.d.b.d.d.k.t.d.s.f.p.w.s.v.l"
},
{
"input": "RIIIUaAIYJOiuYIUWFPOOAIuaUEZeIooyUEUEAoIyIHYOEAlVAAIiLUAUAeiUIEiUMuuOiAgEUOIAoOUYYEYFEoOIIVeOOAOIIEg",
"output": ".r.j.w.f.p.z.h.l.v.l.m.g.f.v.g"
},
{
"input": "VBKQCFBMQHDMGNSGBQVJTGQCNHHRJMNKGKDPPSQRRVQTZNKBZGSXBPBRXPMVFTXCHZMSJVBRNFNTHBHGJLMDZJSVPZZBCCZNVLMQ",
"output": ".v.b.k.q.c.f.b.m.q.h.d.m.g.n.s.g.b.q.v.j.t.g.q.c.n.h.h.r.j.m.n.k.g.k.d.p.p.s.q.r.r.v.q.t.z.n.k.b.z.g.s.x.b.p.b.r.x.p.m.v.f.t.x.c.h.z.m.s.j.v.b.r.n.f.n.t.h.b.h.g.j.l.m.d.z.j.s.v.p.z.z.b.c.c.z.n.v.l.m.q"
},
{
"input": "iioyoaayeuyoolyiyoeuouiayiiuyTueyiaoiueyioiouyuauouayyiaeoeiiigmioiououeieeeyuyyaYyioiiooaiuouyoeoeg",
"output": ".l.t.g.m.g"
},
{
"input": "ueyiuiauuyyeueykeioouiiauzoyoeyeuyiaoaiiaaoaueyaeydaoauexuueafouiyioueeaaeyoeuaueiyiuiaeeayaioeouiuy",
"output": ".k.z.d.x.f"
},
{
"input": "FSNRBXLFQHZXGVMKLQDVHWLDSLKGKFMDRQWMWSSKPKKQBNDZRSCBLRSKCKKFFKRDMZFZGCNSMXNPMZVDLKXGNXGZQCLRTTDXLMXQ",
"output": ".f.s.n.r.b.x.l.f.q.h.z.x.g.v.m.k.l.q.d.v.h.w.l.d.s.l.k.g.k.f.m.d.r.q.w.m.w.s.s.k.p.k.k.q.b.n.d.z.r.s.c.b.l.r.s.k.c.k.k.f.f.k.r.d.m.z.f.z.g.c.n.s.m.x.n.p.m.z.v.d.l.k.x.g.n.x.g.z.q.c.l.r.t.t.d.x.l.m.x.q"
},
{
"input": "EYAYAYIOIOYOOAUOEUEUOUUYIYUUMOEOIIIAOIUOAAOIYOIOEUIERCEYYAOIOIGYUIAOYUEOEUAEAYPOYEYUUAUOAOEIYIEYUEEY",
"output": ".m.r.c.g.p"
},
{
"input": "jvvzcdcxjstbbksmqjsngxkgtttdxrljjxtwptgwwqzpvqchvgrkqlzxmptzblxhhsmrkmzzmgdfskhtmmnqzzflpmqdctvrfgtx",
"output": ".j.v.v.z.c.d.c.x.j.s.t.b.b.k.s.m.q.j.s.n.g.x.k.g.t.t.t.d.x.r.l.j.j.x.t.w.p.t.g.w.w.q.z.p.v.q.c.h.v.g.r.k.q.l.z.x.m.p.t.z.b.l.x.h.h.s.m.r.k.m.z.z.m.g.d.f.s.k.h.t.m.m.n.q.z.z.f.l.p.m.q.d.c.t.v.r.f.g.t.x"
},
{
"input": "YB",
"output": ".b"
},
{
"input": "fly",
"output": ".f.l"
},
{
"input": "YyyYYYyyYxdwdawdDAWDdaddYYYY",
"output": ".x.d.w.d.w.d.d.w.d.d.d.d"
}
] | 1,695,183,151
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 92
| 0
|
string = input()
string = string.lower()
str_ = ""
for i in string:
if i not in "aouiye":
str_ += "." + i
print(str_)
|
Title: String Task
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it:
- deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones.
Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string.
Help Petya cope with this easy task.
Input Specification:
The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.
Output Specification:
Print the resulting string. It is guaranteed that this string is not empty.
Demo Input:
['tour\n', 'Codeforces\n', 'aBAcAba\n']
Demo Output:
['.t.r\n', '.c.d.f.r.c.s\n', '.b.c.b\n']
Note:
none
|
```python
string = input()
string = string.lower()
str_ = ""
for i in string:
if i not in "aouiye":
str_ += "." + i
print(str_)
```
| 3
|
|
194
|
A
|
Exams
|
PROGRAMMING
| 900
|
[
"implementation",
"math"
] | null | null |
One day the Codeforces round author sat exams. He had *n* exams and he needed to get an integer from 2 to 5 for each exam. He will have to re-sit each failed exam, i.e. the exam that gets mark 2.
The author would need to spend too much time and effort to make the sum of his marks strictly more than *k*. That could have spoilt the Codeforces round. On the other hand, if the sum of his marks is strictly less than *k*, the author's mum won't be pleased at all.
The Codeforces authors are very smart and they always get the mark they choose themselves. Also, the Codeforces authors just hate re-sitting exams.
Help the author and find the minimum number of exams he will have to re-sit if he passes the exams in the way that makes the sum of marks for all *n* exams equal exactly *k*.
|
The single input line contains space-separated integers *n* and *k* (1<=≤<=*n*<=≤<=50, 1<=≤<=*k*<=≤<=250) — the number of exams and the required sum of marks.
It is guaranteed that there exists a way to pass *n* exams in the way that makes the sum of marks equal exactly *k*.
|
Print the single number — the minimum number of exams that the author will get a 2 for, considering that the sum of marks for all exams must equal *k*.
|
[
"4 8\n",
"4 10\n",
"1 3\n"
] |
[
"4\n",
"2\n",
"0\n"
] |
In the first sample the author has to get a 2 for all his exams.
In the second sample he should get a 3 for two exams and a 2 for two more.
In the third sample he should get a 3 for one exam.
| 500
|
[
{
"input": "4 8",
"output": "4"
},
{
"input": "4 10",
"output": "2"
},
{
"input": "1 3",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "4 9",
"output": "3"
},
{
"input": "50 234",
"output": "0"
},
{
"input": "50 100",
"output": "50"
},
{
"input": "50 250",
"output": "0"
},
{
"input": "29 116",
"output": "0"
},
{
"input": "20 69",
"output": "0"
},
{
"input": "46 127",
"output": "11"
},
{
"input": "3 7",
"output": "2"
},
{
"input": "36 99",
"output": "9"
},
{
"input": "45 104",
"output": "31"
},
{
"input": "13 57",
"output": "0"
},
{
"input": "25 106",
"output": "0"
},
{
"input": "8 19",
"output": "5"
},
{
"input": "20 69",
"output": "0"
},
{
"input": "13 32",
"output": "7"
},
{
"input": "47 128",
"output": "13"
},
{
"input": "17 73",
"output": "0"
},
{
"input": "3 7",
"output": "2"
},
{
"input": "16 70",
"output": "0"
},
{
"input": "1 5",
"output": "0"
},
{
"input": "38 137",
"output": "0"
},
{
"input": "7 20",
"output": "1"
},
{
"input": "1 5",
"output": "0"
},
{
"input": "36 155",
"output": "0"
},
{
"input": "5 15",
"output": "0"
},
{
"input": "27 75",
"output": "6"
},
{
"input": "21 73",
"output": "0"
},
{
"input": "2 5",
"output": "1"
},
{
"input": "49 177",
"output": "0"
},
{
"input": "7 20",
"output": "1"
},
{
"input": "44 173",
"output": "0"
},
{
"input": "49 219",
"output": "0"
},
{
"input": "16 70",
"output": "0"
},
{
"input": "10 28",
"output": "2"
}
] | 1,618,612,675
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 38
| 124
| 0
|
n, k = map(int, input().split())
two = k//n
rem = k % n
if two > 2:
print(0)
else:
print(n-rem)
|
Title: Exams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day the Codeforces round author sat exams. He had *n* exams and he needed to get an integer from 2 to 5 for each exam. He will have to re-sit each failed exam, i.e. the exam that gets mark 2.
The author would need to spend too much time and effort to make the sum of his marks strictly more than *k*. That could have spoilt the Codeforces round. On the other hand, if the sum of his marks is strictly less than *k*, the author's mum won't be pleased at all.
The Codeforces authors are very smart and they always get the mark they choose themselves. Also, the Codeforces authors just hate re-sitting exams.
Help the author and find the minimum number of exams he will have to re-sit if he passes the exams in the way that makes the sum of marks for all *n* exams equal exactly *k*.
Input Specification:
The single input line contains space-separated integers *n* and *k* (1<=≤<=*n*<=≤<=50, 1<=≤<=*k*<=≤<=250) — the number of exams and the required sum of marks.
It is guaranteed that there exists a way to pass *n* exams in the way that makes the sum of marks equal exactly *k*.
Output Specification:
Print the single number — the minimum number of exams that the author will get a 2 for, considering that the sum of marks for all exams must equal *k*.
Demo Input:
['4 8\n', '4 10\n', '1 3\n']
Demo Output:
['4\n', '2\n', '0\n']
Note:
In the first sample the author has to get a 2 for all his exams.
In the second sample he should get a 3 for two exams and a 2 for two more.
In the third sample he should get a 3 for one exam.
|
```python
n, k = map(int, input().split())
two = k//n
rem = k % n
if two > 2:
print(0)
else:
print(n-rem)
```
| 3
|
|
522
|
A
|
Reposts
|
PROGRAMMING
| 1,200
|
[
"*special",
"dfs and similar",
"dp",
"graphs",
"trees"
] | null | null |
One day Polycarp published a funny picture in a social network making a poll about the color of his handle. Many of his friends started reposting Polycarp's joke to their news feed. Some of them reposted the reposts and so on.
These events are given as a sequence of strings "name1 reposted name2", where name1 is the name of the person who reposted the joke, and name2 is the name of the person from whose news feed the joke was reposted. It is guaranteed that for each string "name1 reposted name2" user "name1" didn't have the joke in his feed yet, and "name2" already had it in his feed by the moment of repost. Polycarp was registered as "Polycarp" and initially the joke was only in his feed.
Polycarp measures the popularity of the joke as the length of the largest repost chain. Print the popularity of Polycarp's joke.
|
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=200) — the number of reposts. Next follow the reposts in the order they were made. Each of them is written on a single line and looks as "name1 reposted name2". All the names in the input consist of lowercase or uppercase English letters and/or digits and have lengths from 2 to 24 characters, inclusive.
We know that the user names are case-insensitive, that is, two names that only differ in the letter case correspond to the same social network user.
|
Print a single integer — the maximum length of a repost chain.
|
[
"5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya\n",
"6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp\n",
"1\nSoMeStRaNgEgUe reposted PoLyCaRp\n"
] |
[
"6\n",
"2\n",
"2\n"
] |
none
| 500
|
[
{
"input": "5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya",
"output": "6"
},
{
"input": "6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp",
"output": "2"
},
{
"input": "1\nSoMeStRaNgEgUe reposted PoLyCaRp",
"output": "2"
},
{
"input": "1\niuNtwVf reposted POlYcarP",
"output": "2"
},
{
"input": "10\ncs reposted poLYCaRp\nAFIkDrY7Of4V7Mq reposted CS\nsoBiwyN7KOvoFUfbhux reposted aFikDry7Of4v7MQ\nvb6LbwA reposted sObIWYN7KOvoFufBHUx\nDtWKIcVwIHgj4Rcv reposted vb6lbwa\nkt reposted DTwKicvwihgJ4rCV\n75K reposted kT\njKzyxx1 reposted 75K\nuoS reposted jkZyXX1\npZJskHTCIqE3YyZ5ME reposted uoS",
"output": "11"
},
{
"input": "10\nvxrUpCXvx8Isq reposted pOLYcaRP\nICb1 reposted vXRUpCxvX8ISq\nJFMt4b8jZE7iF2m8by7y2 reposted Icb1\nqkG6ZkMIf9QRrBFQU reposted ICb1\nnawsNfcR2palIMnmKZ reposted pOlYcaRP\nKksyH reposted jFMT4b8JzE7If2M8by7y2\nwJtWwQS5FvzN0h8CxrYyL reposted NawsNfcR2paLIMnmKz\nDpBcBPYAcTXEdhldI6tPl reposted NaWSnFCr2pALiMnmkZ\nlEnwTVnlwdQg2vaIRQry reposted kKSYh\nQUVFgwllaWO reposted Wjtwwqs5FVzN0H8cxRyyl",
"output": "6"
},
{
"input": "10\nkkuLGEiHv reposted POLYcArp\n3oX1AoUqyw1eR3nCADY9hLwd reposted kkuLGeIHV\nwf97dqq5bx1dPIchCoT reposted 3OX1AOuQYW1eR3ncAdY9hLwD\nWANr8h reposted Wf97dQQ5bx1dpIcHcoT\n3Fb736lkljZK2LtSbfL reposted wANR8h\n6nq9xLOn reposted 3fB736lKlJZk2LtSbFL\nWL reposted 3Fb736lKLjZk2LTSbfl\ndvxn4Xtc6SBcvKf1 reposted wF97DQq5bX1dPiChCOt\nMCcPLIMISqxDzrj reposted 6nQ9XLOn\nxsQL4Z2Iu reposted MCcpLiMiSqxdzrj",
"output": "9"
},
{
"input": "10\nsMA4 reposted pOLyCARP\nlq3 reposted pOlycARp\nEa16LSFTQxLJnE reposted polYcARp\nkvZVZhJwXcWsnC7NA1DV2WvS reposted polYCArp\nEYqqlrjRwddI reposted pOlyCArP\nsPqQCA67Y6PBBbcaV3EhooO reposted ea16LSFTqxLJne\njjPnneZdF6WLZ3v reposted Ea16LSFTqxLjNe\nWEoi6UpnfBUx79 reposted ea16LSFtqXljNe\nqi4yra reposted eYqqlRJrWDDI\ncw7E1UCSUD reposted eYqqLRJRwDdI",
"output": "3"
}
] | 1,460,392,537
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 36
| 124
| 102,400
|
__author__ = 'Utena'
n=int(input())
reposts=dict()
for i in range(n):
s=input().split()
reposts[s[0].lower()]=s[2].lower()
prev=['polycarp']
t=1
while True:
next=[]
for a in reposts.keys():
if reposts[a] in prev:
next.append(a)
if next==[]:
break
else:
t+=1
prev=next
print(t)
|
Title: Reposts
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Polycarp published a funny picture in a social network making a poll about the color of his handle. Many of his friends started reposting Polycarp's joke to their news feed. Some of them reposted the reposts and so on.
These events are given as a sequence of strings "name1 reposted name2", where name1 is the name of the person who reposted the joke, and name2 is the name of the person from whose news feed the joke was reposted. It is guaranteed that for each string "name1 reposted name2" user "name1" didn't have the joke in his feed yet, and "name2" already had it in his feed by the moment of repost. Polycarp was registered as "Polycarp" and initially the joke was only in his feed.
Polycarp measures the popularity of the joke as the length of the largest repost chain. Print the popularity of Polycarp's joke.
Input Specification:
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=200) — the number of reposts. Next follow the reposts in the order they were made. Each of them is written on a single line and looks as "name1 reposted name2". All the names in the input consist of lowercase or uppercase English letters and/or digits and have lengths from 2 to 24 characters, inclusive.
We know that the user names are case-insensitive, that is, two names that only differ in the letter case correspond to the same social network user.
Output Specification:
Print a single integer — the maximum length of a repost chain.
Demo Input:
['5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya\n', '6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp\n', '1\nSoMeStRaNgEgUe reposted PoLyCaRp\n']
Demo Output:
['6\n', '2\n', '2\n']
Note:
none
|
```python
__author__ = 'Utena'
n=int(input())
reposts=dict()
for i in range(n):
s=input().split()
reposts[s[0].lower()]=s[2].lower()
prev=['polycarp']
t=1
while True:
next=[]
for a in reposts.keys():
if reposts[a] in prev:
next.append(a)
if next==[]:
break
else:
t+=1
prev=next
print(t)
```
| 3
|
|
333
|
A
|
Secrets
|
PROGRAMMING
| 1,600
|
[
"greedy"
] | null | null |
Gerald has been selling state secrets at leisure. All the secrets cost the same: *n* marks. The state which secrets Gerald is selling, has no paper money, only coins. But there are coins of all positive integer denominations that are powers of three: 1 mark, 3 marks, 9 marks, 27 marks and so on. There are no coins of other denominations. Of course, Gerald likes it when he gets money without the change. And all buyers respect him and try to give the desired sum without change, if possible. But this does not always happen.
One day an unlucky buyer came. He did not have the desired sum without change. Then he took out all his coins and tried to give Gerald a larger than necessary sum with as few coins as possible. What is the maximum number of coins he could get?
The formal explanation of the previous paragraph: we consider all the possible combinations of coins for which the buyer can not give Gerald the sum of *n* marks without change. For each such combination calculate the minimum number of coins that can bring the buyer at least *n* marks. Among all combinations choose the maximum of the minimum number of coins. This is the number we want.
|
The single line contains a single integer *n* (1<=≤<=*n*<=≤<=1017).
Please, do not use the %lld specifier to read or write 64 bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
In a single line print an integer: the maximum number of coins the unlucky buyer could have paid with.
|
[
"1\n",
"4\n"
] |
[
"1\n",
"2\n"
] |
In the first test case, if a buyer has exactly one coin of at least 3 marks, then, to give Gerald one mark, he will have to give this coin. In this sample, the customer can not have a coin of one mark, as in this case, he will be able to give the money to Gerald without any change.
In the second test case, if the buyer had exactly three coins of 3 marks, then, to give Gerald 4 marks, he will have to give two of these coins. The buyer cannot give three coins as he wants to minimize the number of coins that he gives.
| 500
|
[
{
"input": "1",
"output": "1"
},
{
"input": "4",
"output": "2"
},
{
"input": "3",
"output": "1"
},
{
"input": "8",
"output": "3"
},
{
"input": "10",
"output": "4"
},
{
"input": "100000000000000000",
"output": "33333333333333334"
},
{
"input": "99999999999999999",
"output": "3703703703703704"
},
{
"input": "50031545098999707",
"output": "1"
},
{
"input": "16677181699666569",
"output": "1"
},
{
"input": "72900000000000",
"output": "33333333334"
},
{
"input": "99999999999999997",
"output": "33333333333333333"
},
{
"input": "58061299250691018",
"output": "32"
},
{
"input": "49664023559436051",
"output": "128191526"
},
{
"input": "66708726798666276",
"output": "2"
},
{
"input": "29442431889534807",
"output": "48"
},
{
"input": "70414767176369958",
"output": "13"
},
{
"input": "93886356235159944",
"output": "51"
},
{
"input": "97626528902553453",
"output": "551104613133"
},
{
"input": "52013157885656046",
"output": "880847395988"
},
{
"input": "37586570003500923",
"output": "548"
},
{
"input": "34391854792828422",
"output": "582429080812"
},
{
"input": "205891132094649",
"output": "1"
},
{
"input": "243",
"output": "1"
},
{
"input": "5559060566555523",
"output": "1"
},
{
"input": "81",
"output": "1"
},
{
"input": "108",
"output": "2"
},
{
"input": "2",
"output": "1"
},
{
"input": "1129718145924",
"output": "2"
}
] | 1,621,410,784
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 28
| 184
| 0
|
n=int(input())
while n%3==0:
n//=3
print((n-1)//3+1)
|
Title: Secrets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Gerald has been selling state secrets at leisure. All the secrets cost the same: *n* marks. The state which secrets Gerald is selling, has no paper money, only coins. But there are coins of all positive integer denominations that are powers of three: 1 mark, 3 marks, 9 marks, 27 marks and so on. There are no coins of other denominations. Of course, Gerald likes it when he gets money without the change. And all buyers respect him and try to give the desired sum without change, if possible. But this does not always happen.
One day an unlucky buyer came. He did not have the desired sum without change. Then he took out all his coins and tried to give Gerald a larger than necessary sum with as few coins as possible. What is the maximum number of coins he could get?
The formal explanation of the previous paragraph: we consider all the possible combinations of coins for which the buyer can not give Gerald the sum of *n* marks without change. For each such combination calculate the minimum number of coins that can bring the buyer at least *n* marks. Among all combinations choose the maximum of the minimum number of coins. This is the number we want.
Input Specification:
The single line contains a single integer *n* (1<=≤<=*n*<=≤<=1017).
Please, do not use the %lld specifier to read or write 64 bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Output Specification:
In a single line print an integer: the maximum number of coins the unlucky buyer could have paid with.
Demo Input:
['1\n', '4\n']
Demo Output:
['1\n', '2\n']
Note:
In the first test case, if a buyer has exactly one coin of at least 3 marks, then, to give Gerald one mark, he will have to give this coin. In this sample, the customer can not have a coin of one mark, as in this case, he will be able to give the money to Gerald without any change.
In the second test case, if the buyer had exactly three coins of 3 marks, then, to give Gerald 4 marks, he will have to give two of these coins. The buyer cannot give three coins as he wants to minimize the number of coins that he gives.
|
```python
n=int(input())
while n%3==0:
n//=3
print((n-1)//3+1)
```
| 3
|
|
427
|
A
|
Police Recruits
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups.
Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime.
If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated.
Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated.
|
The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers.
If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time.
|
Print a single integer, the number of crimes which will go untreated.
|
[
"3\n-1 -1 1\n",
"8\n1 -1 1 -1 -1 1 1 1\n",
"11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n"
] |
[
"2\n",
"1\n",
"8\n"
] |
Lets consider the second example:
1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired.
The answer is one, as one crime (on step 5) will go untreated.
| 500
|
[
{
"input": "3\n-1 -1 1",
"output": "2"
},
{
"input": "8\n1 -1 1 -1 -1 1 1 1",
"output": "1"
},
{
"input": "11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1",
"output": "8"
},
{
"input": "7\n-1 -1 1 1 -1 -1 1",
"output": "2"
},
{
"input": "21\n-1 -1 -1 -1 -1 3 2 -1 6 -1 -1 2 1 -1 2 2 1 6 5 -1 5",
"output": "5"
},
{
"input": "98\n-1 -1 1 -1 -1 -1 -1 1 -1 -1 1 -1 -1 1 -1 1 1 1 -1 1 1 1 1 1 -1 1 -1 -1 -1 -1 1 -1 -1 1 1 -1 1 1 1 -1 -1 -1 -1 -1 -1 1 -1 -1 -1 1 -1 1 -1 1 -1 1 1 1 1 1 1 1 -1 -1 1 1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 1 -1 1 1 1 -1 1 1 -1 -1 -1 1 1 1 -1 -1 -1 1 -1 1 1",
"output": "13"
},
{
"input": "3\n-1 5 4",
"output": "1"
},
{
"input": "146\n4 -1 -1 -1 -1 -1 -1 -1 -1 -1 4 -1 3 -1 3 -1 -1 1 4 -1 2 -1 -1 3 -1 -1 -1 4 1 -1 -1 -1 4 -1 -1 -1 -1 -1 -1 3 2 -1 3 2 4 5 2 4 1 5 -1 -1 2 -1 -1 1 -1 5 3 -1 1 2 2 3 5 3 -1 -1 3 -1 -1 3 5 5 -1 -1 5 -1 4 4 1 -1 -1 -1 2 1 -1 -1 -1 2 5 3 -1 -1 -1 3 -1 5 4 -1 1 -1 -1 3 -1 -1 3 1 1 2 -1 -1 -1 1 3 1 -1 2 -1 -1 5 5 -1 -1 3 4 5 1 -1 2 -1 -1 -1 3 -1 5 3 2 -1 2 -1 -1 5 -1 3 -1",
"output": "5"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "1\n-1",
"output": "1"
},
{
"input": "2\n1 -1",
"output": "0"
},
{
"input": "2\n-1 1",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n-1 -1",
"output": "2"
},
{
"input": "4\n10 -1 -1 -1",
"output": "0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "4\n-1 -1 1 1",
"output": "2"
}
] | 1,685,574,558
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 63
| 61
| 9,728,000
|
import sys
import math
def main():
#n,k = map(int, input().split())
#a = [int(x) for x in sys.stdin.readline().split()]
#t = int(input())
t = int(input())
a = [int(x) for x in sys.stdin.readline().split()]
crimes=0
soldiers=0
for x in a:
if x >= 1:
soldiers += x
if x == -1:
if soldiers>0:
#crimes -= 1
soldiers -=1
else:
crimes += 1
print(crimes)
main()
|
Title: Police Recruits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups.
Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime.
If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated.
Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated.
Input Specification:
The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers.
If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time.
Output Specification:
Print a single integer, the number of crimes which will go untreated.
Demo Input:
['3\n-1 -1 1\n', '8\n1 -1 1 -1 -1 1 1 1\n', '11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n']
Demo Output:
['2\n', '1\n', '8\n']
Note:
Lets consider the second example:
1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired.
The answer is one, as one crime (on step 5) will go untreated.
|
```python
import sys
import math
def main():
#n,k = map(int, input().split())
#a = [int(x) for x in sys.stdin.readline().split()]
#t = int(input())
t = int(input())
a = [int(x) for x in sys.stdin.readline().split()]
crimes=0
soldiers=0
for x in a:
if x >= 1:
soldiers += x
if x == -1:
if soldiers>0:
#crimes -= 1
soldiers -=1
else:
crimes += 1
print(crimes)
main()
```
| 3
|
|
180
|
A
|
Defragmentation
|
PROGRAMMING
| 1,800
|
[
"implementation"
] | null | null |
In this problem you have to implement an algorithm to defragment your hard disk. The hard disk consists of a sequence of clusters, numbered by integers from 1 to *n*. The disk has *m* recorded files, the *i*-th file occupies clusters with numbers *a**i*,<=1, *a**i*,<=2, ..., *a**i*,<=*n**i*. These clusters are not necessarily located consecutively on the disk, but the order in which they are given corresponds to their sequence in the file (cluster *a**i*,<=1 contains the first fragment of the *i*-th file, cluster *a**i*,<=2 has the second fragment, etc.). Also the disc must have one or several clusters which are free from files.
You are permitted to perform operations of copying the contents of cluster number *i* to cluster number *j* (*i* and *j* must be different). Moreover, if the cluster number *j* used to keep some information, it is lost forever. Clusters are not cleaned, but after the defragmentation is complete, some of them are simply declared unusable (although they may possibly still contain some fragments of files).
Your task is to use a sequence of copy operations to ensure that each file occupies a contiguous area of memory. Each file should occupy a consecutive cluster section, the files must follow one after another from the beginning of the hard disk. After defragmentation all free (unused) clusters should be at the end of the hard disk. After defragmenting files can be placed in an arbitrary order. Clusters of each file should go consecutively from first to last. See explanatory examples in the notes.
Print the sequence of operations leading to the disk defragmentation. Note that you do not have to minimize the number of operations, but it should not exceed 2*n*.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=200) — the number of clusters and the number of files, correspondingly. Next *m* lines contain descriptions of the files. The first number in the line is *n**i* (*n**i*<=≥<=1), the number of clusters occupied by the *i*-th file. Then follow *n**i* numbers *a**i*,<=1, *a**i*,<=2, ..., *a**i*,<=*n**i* (1<=≤<=*a**i*,<=*j*<=≤<=*n*). It is guaranteed that each cluster number occurs not more than once and , that is, there exists at least one unused cluster. Numbers on each line are separated by spaces.
|
In the first line print a single integer *k* (0<=≤<=*k*<=≤<=2*n*) — the number of operations needed to defragment the disk. Next *k* lines should contain the operations' descriptions as "*i* *j*" (copy the contents of the cluster number *i* to the cluster number *j*).
|
[
"7 2\n2 1 2\n3 3 4 5\n",
"7 2\n2 1 3\n3 2 4 5\n"
] |
[
"0\n",
"3\n2 6\n3 2\n6 3\n"
] |
Let's say that a disk consists of 8 clusters and contains two files. The first file occupies two clusters and the second file occupies three clusters. Let's look at examples of correct and incorrect positions of files after defragmentation.
Example 2: each file must occupy a contiguous area of memory.
Example 3: the order of files to each other is not important, at first the second file can be written, and then — the first one.
Example 4: violating the order of file fragments to each other is not allowed.
Example 5: unused clusters should be located at the end, and in this example the unused clusters are 3, 7, 8.
| 0
|
[
{
"input": "7 2\n2 1 2\n3 3 4 5",
"output": "0"
},
{
"input": "7 2\n2 1 3\n3 2 4 5",
"output": "3\n2 6\n3 2\n6 3"
},
{
"input": "2 1\n1 2",
"output": "1\n2 1"
},
{
"input": "3 1\n2 3 1",
"output": "2\n1 2\n3 1"
},
{
"input": "3 2\n1 3\n1 2",
"output": "1\n3 1"
},
{
"input": "5 3\n1 2\n1 4\n1 5",
"output": "3\n2 1\n4 2\n5 3"
},
{
"input": "7 3\n1 7\n2 6 5\n3 4 3 2",
"output": "7\n7 1\n2 7\n6 2\n3 6\n5 3\n6 5\n7 6"
},
{
"input": "7 2\n3 1 3 5\n3 2 4 6",
"output": "5\n2 7\n3 2\n5 3\n4 5\n7 4"
},
{
"input": "10 1\n5 7 4 6 9 2",
"output": "7\n7 1\n2 3\n4 2\n3 4\n6 3\n4 5\n9 4"
},
{
"input": "7 2\n2 2 1\n3 3 4 5",
"output": "3\n1 6\n2 1\n6 2"
},
{
"input": "7 2\n2 1 2\n3 4 5 6",
"output": "3\n4 3\n5 4\n6 5"
},
{
"input": "20 5\n7 12 16 14 17 20 4 15\n2 7 8\n1 5\n5 3 6 18 11 2\n4 9 13 19 1",
"output": "36\n1 10\n12 1\n2 12\n16 2\n3 16\n14 3\n4 14\n17 4\n5 17\n20 5\n6 20\n14 6\n7 14\n15 7\n8 15\n14 8\n9 14\n15 9\n10 15\n17 10\n11 17\n16 11\n12 16\n20 12\n13 20\n18 13\n14 18\n17 14\n15 17\n16 15\n18 16\n17 18\n20 17\n18 20\n19 18\n20 19"
},
{
"input": "20 10\n1 2\n2 14 11\n2 9 15\n2 16 8\n2 3 13\n3 17 12 6\n1 5\n1 7\n2 20 19\n1 1",
"output": "25\n1 4\n2 1\n14 2\n3 10\n11 3\n4 11\n9 4\n5 9\n15 5\n6 14\n16 6\n7 15\n8 7\n10 8\n9 10\n13 9\n10 13\n17 10\n11 16\n12 11\n14 12\n15 14\n20 15\n16 17\n19 16"
},
{
"input": "100 30\n8 62 50 93 34 82 24 87 65\n2 64 86\n3 91 42 88\n2 76 7\n2 35 63\n3 78 84 15\n4 90 46 73 9\n4 74 13 95 58\n3 71 59 55\n2 4 31\n1 19\n1 10\n2 45 23\n2 27 69\n4 12 66 44 22\n1 36\n2 67 2\n2 77 54\n4 96 47 25 52\n5 18 29 43 70 56\n2 14 41\n2 100 6\n3 30 94 75\n2 32 28\n1 53\n9 26 39 51 68 33 99 79 89 49\n4 5 17 81 37\n3 57 8 16\n3 21 72 98\n4 83 48 40 61",
"output": "168\n62 1\n2 3\n50 2\n3 11\n93 3\n4 20\n34 4\n5 34\n82 5\n6 38\n24 6\n7 24\n87 7\n8 50\n65 8\n9 60\n64 9\n10 62\n86 10\n11 64\n91 11\n12 65\n42 12\n13 42\n88 13\n14 80\n76 14\n15 76\n24 15\n16 24\n35 16\n17 35\n63 17\n18 63\n78 18\n19 78\n84 19\n20 82\n76 20\n21 76\n90 21\n22 84\n46 22\n23 46\n73 23\n24 73\n60 24\n25 60\n74 25\n26 74\n42 26\n27 42\n95 27\n28 85\n58 28\n29 58\n71 29\n30 71\n59 30\n31 59\n55 31\n32 55\n82 32\n33 82\n59 33\n34 59\n78 34\n35 78\n62 35\n36 62\n45 36\n37 45\n46 37\n38 46\n42 38\n..."
},
{
"input": "200 10\n17 110 31 67 40 144 57 90 186 25 112 3 14 79 193 159 26 165\n4 91 1 30 62\n11 64 94 60 49 176 172 54 106 68 51 22\n4 131 114 2 15\n33 58 83 164 190 5 21 17 19 181 46 7 140 29 82 147 6 28 192 27 39 196 101 10 53 156 23 98 48 195 88 126 170 55\n2 81 4\n10 177 16 32 78 119 69 171 127 117 133\n14 184 34 145 43 9 134 168 97 63 191 102 50 72 120\n2 45 99\n3 169 163 104",
"output": "177\n1 8\n110 1\n2 11\n31 2\n3 12\n67 3\n4 13\n40 4\n5 18\n144 5\n6 20\n57 6\n7 24\n90 7\n8 31\n186 8\n9 33\n25 9\n10 25\n112 10\n11 35\n12 11\n14 12\n13 14\n79 13\n14 36\n193 14\n15 37\n159 15\n16 38\n26 16\n17 26\n165 17\n18 40\n91 18\n19 41\n31 19\n20 31\n30 20\n21 30\n62 21\n22 42\n64 22\n23 44\n94 23\n24 47\n60 24\n25 52\n49 25\n26 49\n176 26\n27 56\n172 27\n28 57\n54 28\n29 54\n106 29\n30 59\n68 30\n31 60\n51 31\n32 51\n42 32\n33 42\n131 33\n34 61\n114 34\n36 62\n37 36\n58 37\n38 58\n83 38\n39 64\n16..."
}
] | 1,584,480,894
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 24
| 248
| 512,000
|
import sys
n, m, *inp = map(int, sys.stdin.read().split())
inp.reverse()
f = [[0 for x in range(201)] for y in range(201)] #2D Array
c = [(0,0)]*201
f_size = [0]*201
def putData(f_id, s_id, c_id):
global f, c
f[f_id][s_id] = c_id
c[c_id] = (f_id, s_id)
for f_id in range(1, m+1):
f_size[f_id] = inp.pop()
for s_id in range(1, f_size[f_id]+1):
c_id = inp.pop()
putData(f_id, s_id, c_id)
e_id = c[1:].index((0,0))+1
next_id = 1
op = []
for f_id in range(1, m+1):
for s_id in range(1, f_size[f_id]+1):
if c[next_id]==(f_id, s_id):
next_id += 1
continue
if c[next_id] != (0, 0):
op.append((next_id, e_id))
putData(c[next_id][0], c[next_id][1], e_id)
e_id = f[f_id][s_id]
c[e_id] = (0,0)
op.append((e_id, next_id))
putData(f_id, s_id, next_id)
next_id += 1
print(len(op))
for p in op:
print("%d %d" % p)
|
Title: Defragmentation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In this problem you have to implement an algorithm to defragment your hard disk. The hard disk consists of a sequence of clusters, numbered by integers from 1 to *n*. The disk has *m* recorded files, the *i*-th file occupies clusters with numbers *a**i*,<=1, *a**i*,<=2, ..., *a**i*,<=*n**i*. These clusters are not necessarily located consecutively on the disk, but the order in which they are given corresponds to their sequence in the file (cluster *a**i*,<=1 contains the first fragment of the *i*-th file, cluster *a**i*,<=2 has the second fragment, etc.). Also the disc must have one or several clusters which are free from files.
You are permitted to perform operations of copying the contents of cluster number *i* to cluster number *j* (*i* and *j* must be different). Moreover, if the cluster number *j* used to keep some information, it is lost forever. Clusters are not cleaned, but after the defragmentation is complete, some of them are simply declared unusable (although they may possibly still contain some fragments of files).
Your task is to use a sequence of copy operations to ensure that each file occupies a contiguous area of memory. Each file should occupy a consecutive cluster section, the files must follow one after another from the beginning of the hard disk. After defragmentation all free (unused) clusters should be at the end of the hard disk. After defragmenting files can be placed in an arbitrary order. Clusters of each file should go consecutively from first to last. See explanatory examples in the notes.
Print the sequence of operations leading to the disk defragmentation. Note that you do not have to minimize the number of operations, but it should not exceed 2*n*.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=200) — the number of clusters and the number of files, correspondingly. Next *m* lines contain descriptions of the files. The first number in the line is *n**i* (*n**i*<=≥<=1), the number of clusters occupied by the *i*-th file. Then follow *n**i* numbers *a**i*,<=1, *a**i*,<=2, ..., *a**i*,<=*n**i* (1<=≤<=*a**i*,<=*j*<=≤<=*n*). It is guaranteed that each cluster number occurs not more than once and , that is, there exists at least one unused cluster. Numbers on each line are separated by spaces.
Output Specification:
In the first line print a single integer *k* (0<=≤<=*k*<=≤<=2*n*) — the number of operations needed to defragment the disk. Next *k* lines should contain the operations' descriptions as "*i* *j*" (copy the contents of the cluster number *i* to the cluster number *j*).
Demo Input:
['7 2\n2 1 2\n3 3 4 5\n', '7 2\n2 1 3\n3 2 4 5\n']
Demo Output:
['0\n', '3\n2 6\n3 2\n6 3\n']
Note:
Let's say that a disk consists of 8 clusters and contains two files. The first file occupies two clusters and the second file occupies three clusters. Let's look at examples of correct and incorrect positions of files after defragmentation.
Example 2: each file must occupy a contiguous area of memory.
Example 3: the order of files to each other is not important, at first the second file can be written, and then — the first one.
Example 4: violating the order of file fragments to each other is not allowed.
Example 5: unused clusters should be located at the end, and in this example the unused clusters are 3, 7, 8.
|
```python
import sys
n, m, *inp = map(int, sys.stdin.read().split())
inp.reverse()
f = [[0 for x in range(201)] for y in range(201)] #2D Array
c = [(0,0)]*201
f_size = [0]*201
def putData(f_id, s_id, c_id):
global f, c
f[f_id][s_id] = c_id
c[c_id] = (f_id, s_id)
for f_id in range(1, m+1):
f_size[f_id] = inp.pop()
for s_id in range(1, f_size[f_id]+1):
c_id = inp.pop()
putData(f_id, s_id, c_id)
e_id = c[1:].index((0,0))+1
next_id = 1
op = []
for f_id in range(1, m+1):
for s_id in range(1, f_size[f_id]+1):
if c[next_id]==(f_id, s_id):
next_id += 1
continue
if c[next_id] != (0, 0):
op.append((next_id, e_id))
putData(c[next_id][0], c[next_id][1], e_id)
e_id = f[f_id][s_id]
c[e_id] = (0,0)
op.append((e_id, next_id))
putData(f_id, s_id, next_id)
next_id += 1
print(len(op))
for p in op:
print("%d %d" % p)
```
| 3
|
|
715
|
D
|
Create a Maze
|
PROGRAMMING
| 3,100
|
[
"constructive algorithms"
] | null | null |
ZS the Coder loves mazes. Your job is to create one so that he can play with it. A maze consists of *n*<=×<=*m* rooms, and the rooms are arranged in *n* rows (numbered from the top to the bottom starting from 1) and *m* columns (numbered from the left to the right starting from 1). The room in the *i*-th row and *j*-th column is denoted by (*i*,<=*j*). A player starts in the room (1,<=1) and wants to reach the room (*n*,<=*m*).
Each room has four doors (except for ones at the maze border), one on each of its walls, and two adjacent by the wall rooms shares the same door. Some of the doors are locked, which means it is impossible to pass through the door. For example, if the door connecting (*i*,<=*j*) and (*i*,<=*j*<=+<=1) is locked, then we can't go from (*i*,<=*j*) to (*i*,<=*j*<=+<=1). Also, one can only travel between the rooms downwards (from the room (*i*,<=*j*) to the room (*i*<=+<=1,<=*j*)) or rightwards (from the room (*i*,<=*j*) to the room (*i*,<=*j*<=+<=1)) provided the corresponding door is not locked.
ZS the Coder considers a maze to have difficulty *x* if there is exactly *x* ways of travelling from the room (1,<=1) to the room (*n*,<=*m*). Two ways are considered different if they differ by the sequence of rooms visited while travelling.
Your task is to create a maze such that its difficulty is exactly equal to *T*. In addition, ZS the Coder doesn't like large mazes, so the size of the maze and the number of locked doors are limited. Sounds simple enough, right?
|
The first and only line of the input contains a single integer *T* (1<=≤<=*T*<=≤<=1018), the difficulty of the required maze.
|
The first line should contain two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=50) — the number of rows and columns of the maze respectively.
The next line should contain a single integer *k* (0<=≤<=*k*<=≤<=300) — the number of locked doors in the maze.
Then, *k* lines describing locked doors should follow. Each of them should contain four integers, *x*1,<=*y*1,<=*x*2,<=*y*2. This means that the door connecting room (*x*1,<=*y*1) and room (*x*2,<=*y*2) is locked. Note that room (*x*2,<=*y*2) should be adjacent either to the right or to the bottom of (*x*1,<=*y*1), i.e. *x*2<=+<=*y*2 should be equal to *x*1<=+<=*y*1<=+<=1. There should not be a locked door that appears twice in the list.
It is guaranteed that at least one solution exists. If there are multiple solutions, print any of them.
|
[
"3\n",
"4\n"
] |
[
"3 2\n0\n",
"4 3\n3\n1 2 2 2\n3 2 3 3\n1 3 2 3"
] |
Here are how the sample input and output looks like. The colored arrows denotes all the possible paths while a red cross denotes a locked door.
In the first sample case:
In the second sample case:
| 2,500
|
[
{
"input": "3",
"output": "4 4\n5\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n4 1 4 2"
},
{
"input": "4",
"output": "4 4\n4\n1 2 2 2\n1 3 2 3\n2 1 2 2\n4 1 4 2"
},
{
"input": "576460752303423488",
"output": "48 48\n233\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n11 14 1..."
},
{
"input": "576460752303423487",
"output": "48 48\n234\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n11 14 1..."
},
{
"input": "99999988898898889",
"output": "46 46\n232\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n..."
},
{
"input": "989466010702279111",
"output": "50 50\n251\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 1..."
},
{
"input": "1000000000000000000",
"output": "50 50\n240\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 ..."
},
{
"input": "1",
"output": "4 4\n5\n1 2 2 2\n1 3 2 3\n2 1 2 2\n3 1 3 2\n4 1 4 2"
},
{
"input": "2",
"output": "4 4\n4\n1 2 2 2\n1 3 2 3\n2 1 2 2\n3 1 3 2"
},
{
"input": "201620162016201600",
"output": "48 48\n241\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 ..."
},
{
"input": "138944482508455329",
"output": "48 48\n244\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11..."
},
{
"input": "327543848458922240",
"output": "48 48\n231\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12 8 12 9\n12..."
},
{
"input": "516143210114421854",
"output": "48 48\n231\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13..."
},
{
"input": "481370539210112956",
"output": "48 48\n231\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 ..."
},
{
"input": "639733286738742273",
"output": "48 48\n235\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12 8 12 9\n12 10 13 10\n12 11..."
},
{
"input": "604960615834433375",
"output": "48 48\n239\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n1..."
},
{
"input": "793559981784900286",
"output": "50 50\n252\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n..."
},
{
"input": "982159343440399900",
"output": "50 50\n240\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n..."
},
{
"input": "170758705095899514",
"output": "48 48\n232\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n..."
},
{
"input": "513930638418673772",
"output": "48 48\n233\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 ..."
},
{
"input": "702530000074173386",
"output": "48 48\n242\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n..."
},
{
"input": "891129366024640296",
"output": "50 50\n247\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12..."
},
{
"input": "79728727680139911",
"output": "46 46\n224\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9..."
},
{
"input": "268328089335639525",
"output": "48 48\n234\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n11 ..."
},
{
"input": "297819469440675531",
"output": "48 48\n231\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n1..."
},
{
"input": "486418831096175146",
"output": "48 48\n237\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 ..."
},
{
"input": "675018197046642056",
"output": "48 48\n228\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 1..."
},
{
"input": "863617562997108966",
"output": "50 50\n252\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 1..."
},
{
"input": "632172093115904261",
"output": "48 48\n227\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12 8 12 9\n12 10 13 10\n12..."
},
{
"input": "395388853680415542",
"output": "48 48\n237\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n1..."
},
{
"input": "583988219630882453",
"output": "48 48\n231\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13..."
},
{
"input": "772587581286382067",
"output": "48 48\n231\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n12 11 13 11\n12 ..."
},
{
"input": "737814910382073169",
"output": "48 48\n231\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n12 10 13..."
},
{
"input": "926414272037572783",
"output": "50 50\n251\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 ..."
},
{
"input": "179277684702417302",
"output": "48 48\n235\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 ..."
},
{
"input": "367877050652884212",
"output": "48 48\n234\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n12 10 ..."
},
{
"input": "333104375453608019",
"output": "48 48\n230\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 ..."
},
{
"input": "325030946722146418",
"output": "48 48\n234\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n12 11 13 11\n12..."
},
{
"input": "513630312672613328",
"output": "48 48\n235\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n12 11 13 11\n12 14..."
},
{
"input": "53475036382348801",
"output": "46 46\n222\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 ..."
},
{
"input": "242074398037848415",
"output": "48 48\n227\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n1..."
},
{
"input": "430673763988315325",
"output": "48 48\n232\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n11 14 12 14\n..."
},
{
"input": "619273125643814940",
"output": "48 48\n238\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12 8 12 ..."
},
{
"input": "807872491594281850",
"output": "50 50\n244\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12..."
},
{
"input": "837363867404350560",
"output": "50 50\n254\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 ..."
},
{
"input": "25963229059850175",
"output": "46 46\n228\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 1..."
},
{
"input": "281442720373954210",
"output": "48 48\n232\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n12 11 13 ..."
},
{
"input": "983117125129112380",
"output": "50 50\n239\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10..."
},
{
"input": "171716491079579290",
"output": "48 48\n227\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n12 10 13 1..."
},
{
"input": "934933251644090571",
"output": "50 50\n248\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 ..."
},
{
"input": "123532617594557481",
"output": "46 46\n221\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12 8 12 9\n12 1..."
},
{
"input": "312131979250057096",
"output": "48 48\n235\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10..."
},
{
"input": "500731345200524006",
"output": "48 48\n235\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n12 10 13 10\n12 11 ..."
},
{
"input": "465958670001247812",
"output": "48 48\n233\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12..."
},
{
"input": "718822086961059627",
"output": "48 48\n226\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n12 ..."
},
{
"input": "487376621374822218",
"output": "48 48\n231\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12..."
},
{
"input": "675975978735354536",
"output": "48 48\n222\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n12 10 1..."
},
{
"input": "864575344685821446",
"output": "50 50\n244\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 1..."
},
{
"input": "53174706341321061",
"output": "46 46\n222\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n..."
},
{
"input": "880549474766385254",
"output": "50 50\n248\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 ..."
},
{
"input": "69148836421884868",
"output": "46 46\n219\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n..."
},
{
"input": "257748198077384482",
"output": "48 48\n230\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n12 11 13 11\n12 14..."
},
{
"input": "446347564027851393",
"output": "48 48\n241\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n..."
},
{
"input": "634946925683351007",
"output": "48 48\n227\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n12 11 13 11\n1..."
},
{
"input": "467765511106458502",
"output": "48 48\n235\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n1..."
},
{
"input": "656364872761958116",
"output": "48 48\n228\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n..."
},
{
"input": "621592201857649219",
"output": "48 48\n234\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 ..."
},
{
"input": "810191567808116129",
"output": "50 50\n247\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 1..."
},
{
"input": "998790929463615743",
"output": "50 50\n244\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 ..."
},
{
"input": "762007690028127024",
"output": "48 48\n241\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12 8 12 9\n12 9 12 10\n12 ..."
},
{
"input": "950607055978593934",
"output": "50 50\n248\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 1..."
},
{
"input": "139206417634093549",
"output": "48 48\n239\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 1..."
},
{
"input": "104433742434817355",
"output": "46 46\n220\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10..."
},
{
"input": "96360313703355754",
"output": "46 46\n215\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 1..."
},
{
"input": "125851689513424465",
"output": "46 46\n224\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12 8 12 9\n12..."
},
{
"input": "314451055463891375",
"output": "48 48\n235\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 ..."
},
{
"input": "503050417119390989",
"output": "48 48\n232\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 1..."
},
{
"input": "691649783069857899",
"output": "48 48\n231\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13..."
},
{
"input": "880249149020324810",
"output": "50 50\n255\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 ..."
},
{
"input": "420093872730060283",
"output": "48 48\n234\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 ..."
},
{
"input": "608693234385559897",
"output": "48 48\n234\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n12 11 13 ..."
},
{
"input": "797292600336026807",
"output": "50 50\n248\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n..."
},
{
"input": "789219171604565206",
"output": "48 48\n229\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n12 10 13 10\n12 11 13 11\n12 14..."
},
{
"input": "754446496405289013",
"output": "48 48\n228\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12 8 12 9\n12 ..."
},
{
"input": "7309909070133531",
"output": "44 44\n210\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12 8 12 9\n12 10 13 10\n12 11 13 11\n12 14 12 1..."
},
{
"input": "195909270725633145",
"output": "48 48\n240\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12 8..."
},
{
"input": "384508636676100056",
"output": "48 48\n237\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n11 14 1..."
},
{
"input": "349735961476823862",
"output": "48 48\n236\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12 8 12 9\n12 10..."
},
{
"input": "538335327427290772",
"output": "48 48\n231\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13..."
},
{
"input": "301552087991802053",
"output": "48 48\n235\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n12 11 13 ..."
},
{
"input": "490151453942268963",
"output": "48 48\n233\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n..."
},
{
"input": "258705984061064258",
"output": "48 48\n232\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n12 10..."
},
{
"input": "447305350011531169",
"output": "48 48\n230\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9..."
},
{
"input": "635904715961998079",
"output": "48 48\n221\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n12 10 13 10\n12 11 13 11\n..."
},
{
"input": "665396091772066789",
"output": "48 48\n236\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n12 11 13 ..."
},
{
"input": "853995453427566404",
"output": "50 50\n240\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n1..."
},
{
"input": "42594815083066018",
"output": "46 46\n216\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n12 11 ..."
},
{
"input": "231194181033532928",
"output": "48 48\n235\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n1..."
},
{
"input": "419793542689032543",
"output": "48 48\n235\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8..."
},
{
"input": "183010307548511120",
"output": "48 48\n230\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n..."
},
{
"input": "977109881915691245",
"output": "50 50\n252\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n..."
},
{
"input": "165709243571190859",
"output": "48 48\n234\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n11 1..."
},
{
"input": "354308605226690473",
"output": "48 48\n232\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12 8 12 ..."
},
{
"input": "542907971177157383",
"output": "48 48\n228\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n..."
},
{
"input": "572399346987226094",
"output": "48 48\n234\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n..."
},
{
"input": "760998712937693004",
"output": "48 48\n238\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12 8 12 9\n12 10..."
},
{
"input": "949598074593192619",
"output": "50 50\n249\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8..."
},
{
"input": "138197440543659529",
"output": "48 48\n237\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8..."
},
{
"input": "326796802199159143",
"output": "48 48\n224\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n12 10 13 10\n12 ..."
},
{
"input": "446665360611696202",
"output": "48 48\n239\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13..."
},
{
"input": "635264726562163113",
"output": "48 48\n230\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12 8 12 9\n12 9 12 10\n1..."
},
{
"input": "823864088217662727",
"output": "50 50\n250\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 1..."
},
{
"input": "789091417313353829",
"output": "48 48\n221\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n12 11 13 11\n12 14 12 15\n12 16 13 16\n12 1..."
},
{
"input": "977690778968853444",
"output": "50 50\n248\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n..."
},
{
"input": "230554191633697962",
"output": "48 48\n237\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 ..."
},
{
"input": "419153557584164872",
"output": "48 48\n237\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 ..."
},
{
"input": "384380882384888679",
"output": "48 48\n232\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 1..."
},
{
"input": "572980248335355589",
"output": "48 48\n236\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n..."
},
{
"input": "761579609990855203",
"output": "48 48\n228\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n12 10 13 10\n12 1..."
},
{
"input": "104751543313629461",
"output": "46 46\n213\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12 8 12 9\n12 10 ..."
},
{
"input": "293350904969129075",
"output": "48 48\n232\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n..."
},
{
"input": "481950270919595985",
"output": "48 48\n233\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n12 11 1..."
},
{
"input": "670549632575095600",
"output": "48 48\n241\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n11 14 12 14\n..."
},
{
"input": "859148998525562510",
"output": "50 50\n248\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 1..."
},
{
"input": "888640378630598516",
"output": "50 50\n252\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 1..."
},
{
"input": "77239735991130835",
"output": "46 46\n226\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13..."
},
{
"input": "265839101941597745",
"output": "48 48\n233\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13..."
},
{
"input": "454438463597097359",
"output": "48 48\n232\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12 8 12 9..."
},
{
"input": "222992998010859950",
"output": "48 48\n233\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n..."
},
{
"input": "986209758575371231",
"output": "50 50\n244\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n12 10 13 1..."
},
{
"input": "174809124525838142",
"output": "48 48\n234\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n12 11 1..."
},
{
"input": "363408486181337756",
"output": "48 48\n234\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 1..."
},
{
"input": "552007852131804666",
"output": "48 48\n232\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n..."
},
{
"input": "517235176932528472",
"output": "48 48\n226\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n12 10 13 1..."
},
{
"input": "770098593892340287",
"output": "48 48\n239\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n12 10 ..."
},
{
"input": "958697959842807197",
"output": "50 50\n245\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n1..."
},
{
"input": "147297317203339516",
"output": "48 48\n235\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8..."
},
{
"input": "915851851617102107",
"output": "50 50\n239\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n..."
},
{
"input": "104451213272601721",
"output": "46 46\n224\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 1..."
},
{
"input": "867667978132080298",
"output": "50 50\n243\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 1..."
},
{
"input": "832895302932804104",
"output": "50 50\n245\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9..."
},
{
"input": "21494668883271014",
"output": "44 44\n214\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n12 11 13 11\n1..."
},
{
"input": "210094030538770629",
"output": "48 48\n234\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9..."
},
{
"input": "398693396489237539",
"output": "48 48\n234\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10..."
},
{
"input": "428184772299306249",
"output": "48 48\n236\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 ..."
},
{
"input": "616784138249773160",
"output": "48 48\n234\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n11 14 12 1..."
},
{
"input": "608710709518311559",
"output": "48 48\n233\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n11 14 12 14\n12 8 12 9\n12 10 13 ..."
},
{
"input": "797310071173811173",
"output": "50 50\n244\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n..."
},
{
"input": "762537395974534979",
"output": "48 48\n235\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n12..."
},
{
"input": "525754160834013556",
"output": "48 48\n227\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n12 10 13 10\n12 11 13 11\n..."
},
{
"input": "789730223053602816",
"output": "50 50\n279\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n..."
},
{
"input": "789730223053602815",
"output": "48 48\n199\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n12 11 13 11\n12 14 12 15\n12 16 13 16\n12 17 13 17\n13..."
},
{
"input": "947676267664323379",
"output": "50 50\n256\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13..."
},
{
"input": "315892089221441126",
"output": "48 48\n222\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 10 13 10\n12 11 ..."
},
{
"input": "473838133832161689",
"output": "48 48\n245\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 ..."
},
{
"input": "631784178442882252",
"output": "48 48\n222\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n12 10 13 10\n12 1..."
},
{
"input": "999999999999999999",
"output": "50 50\n241\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n5 8 6 8\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 ..."
},
{
"input": "12345678987654321",
"output": "44 44\n219\n1 2 2 2\n1 3 2 3\n1 4 2 4\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n..."
},
{
"input": "100055128505716009",
"output": "46 46\n222\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n11 14 12 1..."
},
{
"input": "981168724994134051",
"output": "50 50\n243\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n11 14 12 1..."
},
{
"input": "213025900602118694",
"output": "48 48\n233\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 7 9 8\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n1..."
},
{
"input": "163428781826190151",
"output": "48 48\n243\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 5 7 6\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 9 11 10\n11 12 11 13\n11 13 12 13\n12 8 12 9\n..."
},
{
"input": "149046408559208370",
"output": "48 48\n238\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 1 3 2\n3 4 3 5\n3 5 4 5\n3 6 4 6\n4 1 4 2\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 3 6 4\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n9 12 10 12\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n1..."
},
{
"input": "718882536615471983",
"output": "48 48\n228\n1 2 2 2\n1 3 2 3\n2 1 2 2\n2 4 2 5\n2 6 3 6\n2 7 3 7\n3 4 3 5\n3 5 4 5\n4 2 5 2\n4 3 5 3\n4 6 4 7\n4 8 5 8\n4 9 5 9\n5 3 5 4\n5 6 5 7\n5 7 6 7\n6 2 6 3\n6 4 7 4\n6 5 7 5\n6 8 6 9\n6 10 7 10\n6 11 7 11\n7 2 7 3\n7 8 7 9\n7 9 8 9\n7 10 8 10\n8 4 8 5\n8 5 8 6\n8 6 9 6\n8 7 9 7\n8 10 8 11\n8 12 9 12\n8 13 9 13\n9 4 9 5\n9 10 9 11\n9 11 10 11\n10 6 10 7\n10 7 10 8\n10 8 11 8\n10 9 11 9\n10 12 10 13\n10 14 11 14\n10 15 11 15\n11 6 11 7\n11 12 11 13\n11 13 12 13\n12 8 12 9\n12 9 12 10\n12 10 13 10\n12..."
}
] | 1,653,312,338
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 164
| 93
| 2,457,600
|
corr = lambda x, y: 1 <= x <= n and 1 <= y <= m
T = int(input())
a = []
while T:
a.append(T % 6)
T //= 6
L = len(a)
n = m = L * 2 + 2
ans = [(1, 2, 2, 2), (2, 1, 2, 2)]
f = [[1] * 9 for i in range(7)]
f[1][2] = f[2][2] = f[2][6] = f[3][5] = 0
f[4][5] = f[4][6] = f[5][2] = f[5][5] = f[5][6] = 0
p = [0] * 9
p[1] = 3, 1, 3, 2
p[2] = 4, 1, 4, 2
p[3] = 4, 2, 5, 2
p[4] = 4, 3, 5, 3
p[5] = 1, 3, 2, 3
p[6] = 1, 4, 2, 4
p[7] = 2, 4, 2, 5
p[8] = 3, 4, 3, 5
for i in range(L):
bit = a[L - i - 1]
for j in range(1, 9):
if not f[bit][j]: continue
x1, y1, x2, y2 = p[j]; D = 2 * i
x1 += D; y1 += D; x2 += D; y2 += D
if corr(x2, y2): ans.append((x1, y1, x2, y2))
for i in range(L - 1):
x1, y1 = 5 + i * 2, 1 + i * 2
x2, y2 = 1 + i * 2, 5 + i * 2
ans.append((x1, y1, x1 + 1, y1))
ans.append((x1, y1 + 1, x1 + 1, y1 + 1))
ans.append((x2, y2, x2, y2 + 1))
ans.append((x2 + 1, y2, x2 + 1, y2 + 1))
print(n, m)
print(len(ans))
[print(*i) for i in ans]
|
Title: Create a Maze
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
ZS the Coder loves mazes. Your job is to create one so that he can play with it. A maze consists of *n*<=×<=*m* rooms, and the rooms are arranged in *n* rows (numbered from the top to the bottom starting from 1) and *m* columns (numbered from the left to the right starting from 1). The room in the *i*-th row and *j*-th column is denoted by (*i*,<=*j*). A player starts in the room (1,<=1) and wants to reach the room (*n*,<=*m*).
Each room has four doors (except for ones at the maze border), one on each of its walls, and two adjacent by the wall rooms shares the same door. Some of the doors are locked, which means it is impossible to pass through the door. For example, if the door connecting (*i*,<=*j*) and (*i*,<=*j*<=+<=1) is locked, then we can't go from (*i*,<=*j*) to (*i*,<=*j*<=+<=1). Also, one can only travel between the rooms downwards (from the room (*i*,<=*j*) to the room (*i*<=+<=1,<=*j*)) or rightwards (from the room (*i*,<=*j*) to the room (*i*,<=*j*<=+<=1)) provided the corresponding door is not locked.
ZS the Coder considers a maze to have difficulty *x* if there is exactly *x* ways of travelling from the room (1,<=1) to the room (*n*,<=*m*). Two ways are considered different if they differ by the sequence of rooms visited while travelling.
Your task is to create a maze such that its difficulty is exactly equal to *T*. In addition, ZS the Coder doesn't like large mazes, so the size of the maze and the number of locked doors are limited. Sounds simple enough, right?
Input Specification:
The first and only line of the input contains a single integer *T* (1<=≤<=*T*<=≤<=1018), the difficulty of the required maze.
Output Specification:
The first line should contain two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=50) — the number of rows and columns of the maze respectively.
The next line should contain a single integer *k* (0<=≤<=*k*<=≤<=300) — the number of locked doors in the maze.
Then, *k* lines describing locked doors should follow. Each of them should contain four integers, *x*1,<=*y*1,<=*x*2,<=*y*2. This means that the door connecting room (*x*1,<=*y*1) and room (*x*2,<=*y*2) is locked. Note that room (*x*2,<=*y*2) should be adjacent either to the right or to the bottom of (*x*1,<=*y*1), i.e. *x*2<=+<=*y*2 should be equal to *x*1<=+<=*y*1<=+<=1. There should not be a locked door that appears twice in the list.
It is guaranteed that at least one solution exists. If there are multiple solutions, print any of them.
Demo Input:
['3\n', '4\n']
Demo Output:
['3 2\n0\n', '4 3\n3\n1 2 2 2\n3 2 3 3\n1 3 2 3']
Note:
Here are how the sample input and output looks like. The colored arrows denotes all the possible paths while a red cross denotes a locked door.
In the first sample case:
In the second sample case:
|
```python
corr = lambda x, y: 1 <= x <= n and 1 <= y <= m
T = int(input())
a = []
while T:
a.append(T % 6)
T //= 6
L = len(a)
n = m = L * 2 + 2
ans = [(1, 2, 2, 2), (2, 1, 2, 2)]
f = [[1] * 9 for i in range(7)]
f[1][2] = f[2][2] = f[2][6] = f[3][5] = 0
f[4][5] = f[4][6] = f[5][2] = f[5][5] = f[5][6] = 0
p = [0] * 9
p[1] = 3, 1, 3, 2
p[2] = 4, 1, 4, 2
p[3] = 4, 2, 5, 2
p[4] = 4, 3, 5, 3
p[5] = 1, 3, 2, 3
p[6] = 1, 4, 2, 4
p[7] = 2, 4, 2, 5
p[8] = 3, 4, 3, 5
for i in range(L):
bit = a[L - i - 1]
for j in range(1, 9):
if not f[bit][j]: continue
x1, y1, x2, y2 = p[j]; D = 2 * i
x1 += D; y1 += D; x2 += D; y2 += D
if corr(x2, y2): ans.append((x1, y1, x2, y2))
for i in range(L - 1):
x1, y1 = 5 + i * 2, 1 + i * 2
x2, y2 = 1 + i * 2, 5 + i * 2
ans.append((x1, y1, x1 + 1, y1))
ans.append((x1, y1 + 1, x1 + 1, y1 + 1))
ans.append((x2, y2, x2, y2 + 1))
ans.append((x2 + 1, y2, x2 + 1, y2 + 1))
print(n, m)
print(len(ans))
[print(*i) for i in ans]
```
| 3
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,601,870,017
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 109
| 0
|
li = ['h','e','l','l','o']
str = input()
i=0
for j in range(0,len(str)):
if(str[j] == li[i]):
i=i+1
if(i==len(li)):
break;
if(i>=5):
print('YES')
else:
print('NO')
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
li = ['h','e','l','l','o']
str = input()
i=0
for j in range(0,len(str)):
if(str[j] == li[i]):
i=i+1
if(i==len(li)):
break;
if(i>=5):
print('YES')
else:
print('NO')
```
| 3.9455
|
525
|
A
|
Vitaliy and Pie
|
PROGRAMMING
| 1,100
|
[
"greedy",
"hashing",
"strings"
] | null | null |
After a hard day Vitaly got very hungry and he wants to eat his favorite potato pie. But it's not that simple. Vitaly is in the first room of the house with *n* room located in a line and numbered starting from one from left to right. You can go from the first room to the second room, from the second room to the third room and so on — you can go from the (*n*<=-<=1)-th room to the *n*-th room. Thus, you can go to room *x* only from room *x*<=-<=1.
The potato pie is located in the *n*-th room and Vitaly needs to go there.
Each pair of consecutive rooms has a door between them. In order to go to room *x* from room *x*<=-<=1, you need to open the door between the rooms with the corresponding key.
In total the house has several types of doors (represented by uppercase Latin letters) and several types of keys (represented by lowercase Latin letters). The key of type *t* can open the door of type *T* if and only if *t* and *T* are the same letter, written in different cases. For example, key f can open door F.
Each of the first *n*<=-<=1 rooms contains exactly one key of some type that Vitaly can use to get to next rooms. Once the door is open with some key, Vitaly won't get the key from the keyhole but he will immediately run into the next room. In other words, each key can open no more than one door.
Vitaly realizes that he may end up in some room without the key that opens the door to the next room. Before the start his run for the potato pie Vitaly can buy any number of keys of any type that is guaranteed to get to room *n*.
Given the plan of the house, Vitaly wants to know what is the minimum number of keys he needs to buy to surely get to the room *n*, which has a delicious potato pie. Write a program that will help Vitaly find out this number.
|
The first line of the input contains a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of rooms in the house.
The second line of the input contains string *s* of length 2·*n*<=-<=2. Let's number the elements of the string from left to right, starting from one.
The odd positions in the given string *s* contain lowercase Latin letters — the types of the keys that lie in the corresponding rooms. Thus, each odd position *i* of the given string *s* contains a lowercase Latin letter — the type of the key that lies in room number (*i*<=+<=1)<=/<=2.
The even positions in the given string contain uppercase Latin letters — the types of doors between the rooms. Thus, each even position *i* of the given string *s* contains an uppercase letter — the type of the door that leads from room *i*<=/<=2 to room *i*<=/<=2<=+<=1.
|
Print the only integer — the minimum number of keys that Vitaly needs to buy to surely get from room one to room *n*.
|
[
"3\naAbB\n",
"4\naBaCaB\n",
"5\nxYyXzZaZ\n"
] |
[
"0\n",
"3\n",
"2\n"
] |
none
| 250
|
[
{
"input": "3\naAbB",
"output": "0"
},
{
"input": "4\naBaCaB",
"output": "3"
},
{
"input": "5\nxYyXzZaZ",
"output": "2"
},
{
"input": "26\naAbBcCdDeEfFgGhHiIjJkKlLmMnNoOpPqQrRsStTuUvVwWxXyY",
"output": "0"
},
{
"input": "26\nzAyBxCwDvEuFtGsHrIqJpKoLnMmNlOkPjQiRhSgTfUeVdWcXbY",
"output": "13"
},
{
"input": "5\naArRaRaR",
"output": "2"
},
{
"input": "2\ndA",
"output": "1"
},
{
"input": "2\ncB",
"output": "1"
},
{
"input": "10\nhNcMeXsSlHsUwYeMcA",
"output": "7"
},
{
"input": "100\nqDpInBmCrFwXpDbFgOzVvOcEmJrUcToAdEwEgTvBvBfWwRpGyEaXgDdRwVlQnYgWmWhMrHaIzPyXvGaFlRsVzHhZrOuVpXrKxFzAmWwPlFtNfPtJxVmLuHjKfYyArHrEnSwSzOvDpQhCgCqLlAcNpGhXrEeFuCmAqIkXyYtSsQwIxJzNiIuTgEbVuWrMwPrAlLyKaZ",
"output": "42"
},
{
"input": "2\ndD",
"output": "0"
},
{
"input": "2\ndE",
"output": "1"
},
{
"input": "3\ndDdD",
"output": "0"
},
{
"input": "3\ndEdD",
"output": "1"
},
{
"input": "3\ndEeD",
"output": "1"
},
{
"input": "3\ndEeF",
"output": "2"
}
] | 1,685,625,248
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 46
| 140
| 409,600
|
n = int(input())
s = input()
d = {}
lt = 'qwertyuiopasdfghjklmnbvcxz'
for l in lt:
d[l] = 0
cnt = 0
for i in s:
if i.islower():
d[i] += 1
else:
if d[i.lower()] <= 0:
cnt += 1
else:
d[i.lower()] -= 1
print(cnt)
|
Title: Vitaliy and Pie
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After a hard day Vitaly got very hungry and he wants to eat his favorite potato pie. But it's not that simple. Vitaly is in the first room of the house with *n* room located in a line and numbered starting from one from left to right. You can go from the first room to the second room, from the second room to the third room and so on — you can go from the (*n*<=-<=1)-th room to the *n*-th room. Thus, you can go to room *x* only from room *x*<=-<=1.
The potato pie is located in the *n*-th room and Vitaly needs to go there.
Each pair of consecutive rooms has a door between them. In order to go to room *x* from room *x*<=-<=1, you need to open the door between the rooms with the corresponding key.
In total the house has several types of doors (represented by uppercase Latin letters) and several types of keys (represented by lowercase Latin letters). The key of type *t* can open the door of type *T* if and only if *t* and *T* are the same letter, written in different cases. For example, key f can open door F.
Each of the first *n*<=-<=1 rooms contains exactly one key of some type that Vitaly can use to get to next rooms. Once the door is open with some key, Vitaly won't get the key from the keyhole but he will immediately run into the next room. In other words, each key can open no more than one door.
Vitaly realizes that he may end up in some room without the key that opens the door to the next room. Before the start his run for the potato pie Vitaly can buy any number of keys of any type that is guaranteed to get to room *n*.
Given the plan of the house, Vitaly wants to know what is the minimum number of keys he needs to buy to surely get to the room *n*, which has a delicious potato pie. Write a program that will help Vitaly find out this number.
Input Specification:
The first line of the input contains a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of rooms in the house.
The second line of the input contains string *s* of length 2·*n*<=-<=2. Let's number the elements of the string from left to right, starting from one.
The odd positions in the given string *s* contain lowercase Latin letters — the types of the keys that lie in the corresponding rooms. Thus, each odd position *i* of the given string *s* contains a lowercase Latin letter — the type of the key that lies in room number (*i*<=+<=1)<=/<=2.
The even positions in the given string contain uppercase Latin letters — the types of doors between the rooms. Thus, each even position *i* of the given string *s* contains an uppercase letter — the type of the door that leads from room *i*<=/<=2 to room *i*<=/<=2<=+<=1.
Output Specification:
Print the only integer — the minimum number of keys that Vitaly needs to buy to surely get from room one to room *n*.
Demo Input:
['3\naAbB\n', '4\naBaCaB\n', '5\nxYyXzZaZ\n']
Demo Output:
['0\n', '3\n', '2\n']
Note:
none
|
```python
n = int(input())
s = input()
d = {}
lt = 'qwertyuiopasdfghjklmnbvcxz'
for l in lt:
d[l] = 0
cnt = 0
for i in s:
if i.islower():
d[i] += 1
else:
if d[i.lower()] <= 0:
cnt += 1
else:
d[i.lower()] -= 1
print(cnt)
```
| 3
|
|
1,003
|
A
|
Polycarp's Pockets
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. Polycarp wants to distribute all the coins between his pockets, but he cannot put two coins with the same value into the same pocket.
For example, if Polycarp has got six coins represented as an array $a = [1, 2, 4, 3, 3, 2]$, he can distribute the coins into two pockets as follows: $[1, 2, 3], [2, 3, 4]$.
Polycarp wants to distribute all the coins with the minimum number of used pockets. Help him to do that.
|
The first line of the input contains one integer $n$ ($1 \le n \le 100$) — the number of coins.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$) — values of coins.
|
Print only one integer — the minimum number of pockets Polycarp needs to distribute all the coins so no two coins with the same value are put into the same pocket.
|
[
"6\n1 2 4 3 3 2\n",
"1\n100\n"
] |
[
"2\n",
"1\n"
] |
none
| 0
|
[
{
"input": "6\n1 2 4 3 3 2",
"output": "2"
},
{
"input": "1\n100",
"output": "1"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "100"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "100\n59 47 39 47 47 71 47 28 58 47 35 79 58 47 38 47 47 47 47 27 47 43 29 95 47 49 46 71 47 74 79 47 47 32 45 67 47 47 30 37 47 47 16 67 22 76 47 86 84 10 5 47 47 47 47 47 1 51 47 54 47 8 47 47 9 47 47 47 47 28 47 47 26 47 47 47 47 47 47 92 47 47 77 47 47 24 45 47 10 47 47 89 47 27 47 89 47 67 24 71",
"output": "51"
},
{
"input": "100\n45 99 10 27 16 85 39 38 17 32 15 23 67 48 50 97 42 70 62 30 44 81 64 73 34 22 46 5 83 52 58 60 33 74 47 88 18 61 78 53 25 95 94 31 3 75 1 57 20 54 59 9 68 7 77 43 21 87 86 24 4 80 11 49 2 72 36 84 71 8 65 55 79 100 41 14 35 89 66 69 93 37 56 82 90 91 51 19 26 92 6 96 13 98 12 28 76 40 63 29",
"output": "1"
},
{
"input": "100\n45 29 5 2 6 50 22 36 14 15 9 48 46 20 8 37 7 47 12 50 21 38 18 27 33 19 40 10 5 49 38 42 34 37 27 30 35 24 10 3 40 49 41 3 4 44 13 25 28 31 46 36 23 1 1 23 7 22 35 26 21 16 48 42 32 8 11 16 34 11 39 32 47 28 43 41 39 4 14 19 26 45 13 18 15 25 2 44 17 29 17 33 43 6 12 30 9 20 31 24",
"output": "2"
},
{
"input": "50\n7 7 3 3 7 4 5 6 4 3 7 5 6 4 5 4 4 5 6 7 7 7 4 5 5 5 3 7 6 3 4 6 3 6 4 4 5 4 6 6 3 5 6 3 5 3 3 7 7 6",
"output": "10"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "99"
},
{
"input": "7\n1 2 3 3 3 1 2",
"output": "3"
},
{
"input": "5\n1 2 3 4 5",
"output": "1"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "1"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "1"
},
{
"input": "9\n1 2 3 4 5 6 7 8 9",
"output": "1"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "1"
},
{
"input": "3\n2 1 1",
"output": "2"
},
{
"input": "11\n1 2 3 4 5 6 7 8 9 1 1",
"output": "3"
},
{
"input": "12\n1 2 1 1 1 1 1 1 1 1 1 1",
"output": "11"
},
{
"input": "13\n1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "13"
},
{
"input": "14\n1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "14"
},
{
"input": "15\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "15"
},
{
"input": "16\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "16"
},
{
"input": "3\n1 1 1",
"output": "3"
},
{
"input": "3\n1 2 3",
"output": "1"
},
{
"input": "10\n1 1 1 1 2 2 1 1 9 10",
"output": "6"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "56\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "56"
},
{
"input": "99\n35 96 73 72 70 83 22 93 98 75 45 32 81 82 45 54 25 7 53 72 29 2 94 19 21 98 34 28 39 99 55 85 44 23 6 47 98 2 33 34 19 57 49 35 67 4 60 4 4 23 55 6 57 66 16 68 34 45 84 79 48 63 4 9 46 88 98 13 19 27 83 12 4 63 57 22 44 77 44 62 28 52 44 64 9 24 55 22 48 4 2 9 80 76 45 1 56 22 92",
"output": "6"
},
{
"input": "10\n1 2 2 3 3 3 4 4 4 4",
"output": "4"
},
{
"input": "99\n97 44 33 56 42 10 61 85 64 26 40 39 82 34 75 9 51 51 39 73 58 38 74 31 13 99 58 1 28 89 76 19 52 7 40 56 12 27 72 72 67 75 62 46 22 55 35 16 18 39 60 63 92 42 85 69 34 61 73 50 57 95 30 4 45 63 76 58 32 35 48 81 10 78 95 79 55 97 21 21 22 94 30 17 78 57 89 93 100 44 16 89 68 55 19 46 42 73 21",
"output": "3"
},
{
"input": "5\n5 5 5 5 1",
"output": "4"
},
{
"input": "6\n2 3 2 5 2 6",
"output": "3"
},
{
"input": "3\n58 59 58",
"output": "2"
},
{
"input": "9\n1 2 3 4 5 6 7 8 8",
"output": "2"
},
{
"input": "97\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "97"
},
{
"input": "3\n95 95 4",
"output": "2"
},
{
"input": "3\n2 2 5",
"output": "2"
}
] | 1,599,199,869
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 37
| 140
| 0
|
n=int(input())
l=input().split()
li=[int(i) for i in l]
maxa=0
hashi=dict()
for i in li:
if i in hashi:
hashi[i]+=1
else:
hashi[i]=1
for i in hashi:
maxa=max(maxa,hashi[i])
print(maxa)
|
Title: Polycarp's Pockets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. Polycarp wants to distribute all the coins between his pockets, but he cannot put two coins with the same value into the same pocket.
For example, if Polycarp has got six coins represented as an array $a = [1, 2, 4, 3, 3, 2]$, he can distribute the coins into two pockets as follows: $[1, 2, 3], [2, 3, 4]$.
Polycarp wants to distribute all the coins with the minimum number of used pockets. Help him to do that.
Input Specification:
The first line of the input contains one integer $n$ ($1 \le n \le 100$) — the number of coins.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$) — values of coins.
Output Specification:
Print only one integer — the minimum number of pockets Polycarp needs to distribute all the coins so no two coins with the same value are put into the same pocket.
Demo Input:
['6\n1 2 4 3 3 2\n', '1\n100\n']
Demo Output:
['2\n', '1\n']
Note:
none
|
```python
n=int(input())
l=input().split()
li=[int(i) for i in l]
maxa=0
hashi=dict()
for i in li:
if i in hashi:
hashi[i]+=1
else:
hashi[i]=1
for i in hashi:
maxa=max(maxa,hashi[i])
print(maxa)
```
| 3
|
|
409
|
D
|
Big Data
|
PROGRAMMING
| 1,700
|
[
"*special"
] | null | null |
Little Petya wanted to give an April Fools Day present to some scientists. After some hesitation he decided to give them the array that he got as a present in Codeforces Round #153 (Div.2). The scientists rejoiced at the gift and decided to put some important facts to this array. Here are the first few of the facts:
- The highest mountain above sea level in the world is Mount Everest. Its peak rises to 8848 m. - The largest board game tournament consisted of 958 participants playing chapaev.- The largest online maths competition consisted of 12766 participants.- The Nile is credited as the longest river in the world. From its farthest stream in Burundi, it extends 6695 km in length.- While not in flood, the main stretches of the Amazon river in South America can reach widths of up to 1100 km at its widest points.- Angel Falls is the highest waterfall. Its greatest single drop measures 807 m.- The Hotel Everest View above Namche, Nepal — the village closest to Everest base camp – is at a record height of 31962 m- Uranium is the heaviest of all the naturally occurring elements. Its most common isotope has a nucleus containing 146 neutrons.- The coldest permanently inhabited place is the Siberian village of Oymyakon, where the temperature of -68°C was registered in the twentieth century.- The longest snake held in captivity is over 25 feet long. Its name is Medusa.- Colonel Meow holds the world record for longest fur on a cat — almost 134 centimeters.- Sea otters can have up to 10000 hairs per square inch. This is the most dense fur in the animal kingdom.- The largest state of USA is Alaska; its area is 663268 square miles- Alaska has a longer coastline than all of the other 49 U.S. States put together: it is 154103 miles long.- Lake Baikal is the largest freshwater lake in the world. It reaches 1642 meters in depth and contains around one-fifth of the world’s unfrozen fresh water.- The most colorful national flag is the one of Turkmenistan, with 106 colors.
|
The input will contain a single integer between 1 and 16.
|
Output a single integer.
|
[
"1\n",
"7\n"
] |
[
"1\n",
"0\n"
] |
none
| 0
|
[
{
"input": "1",
"output": "1"
},
{
"input": "7",
"output": "0"
},
{
"input": "13",
"output": "1"
},
{
"input": "3",
"output": "0"
},
{
"input": "8",
"output": "1"
},
{
"input": "16",
"output": "0"
},
{
"input": "11",
"output": "0"
},
{
"input": "2",
"output": "0"
},
{
"input": "5",
"output": "0"
},
{
"input": "10",
"output": "1"
},
{
"input": "9",
"output": "1"
},
{
"input": "15",
"output": "1"
},
{
"input": "4",
"output": "1"
},
{
"input": "12",
"output": "0"
},
{
"input": "6",
"output": "1"
},
{
"input": "14",
"output": "0"
}
] | 1,622,285,409
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 16
| 62
| 0
|
print("1001010111001010"[int(input())-1])
|
Title: Big Data
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Petya wanted to give an April Fools Day present to some scientists. After some hesitation he decided to give them the array that he got as a present in Codeforces Round #153 (Div.2). The scientists rejoiced at the gift and decided to put some important facts to this array. Here are the first few of the facts:
- The highest mountain above sea level in the world is Mount Everest. Its peak rises to 8848 m. - The largest board game tournament consisted of 958 participants playing chapaev.- The largest online maths competition consisted of 12766 participants.- The Nile is credited as the longest river in the world. From its farthest stream in Burundi, it extends 6695 km in length.- While not in flood, the main stretches of the Amazon river in South America can reach widths of up to 1100 km at its widest points.- Angel Falls is the highest waterfall. Its greatest single drop measures 807 m.- The Hotel Everest View above Namche, Nepal — the village closest to Everest base camp – is at a record height of 31962 m- Uranium is the heaviest of all the naturally occurring elements. Its most common isotope has a nucleus containing 146 neutrons.- The coldest permanently inhabited place is the Siberian village of Oymyakon, where the temperature of -68°C was registered in the twentieth century.- The longest snake held in captivity is over 25 feet long. Its name is Medusa.- Colonel Meow holds the world record for longest fur on a cat — almost 134 centimeters.- Sea otters can have up to 10000 hairs per square inch. This is the most dense fur in the animal kingdom.- The largest state of USA is Alaska; its area is 663268 square miles- Alaska has a longer coastline than all of the other 49 U.S. States put together: it is 154103 miles long.- Lake Baikal is the largest freshwater lake in the world. It reaches 1642 meters in depth and contains around one-fifth of the world’s unfrozen fresh water.- The most colorful national flag is the one of Turkmenistan, with 106 colors.
Input Specification:
The input will contain a single integer between 1 and 16.
Output Specification:
Output a single integer.
Demo Input:
['1\n', '7\n']
Demo Output:
['1\n', '0\n']
Note:
none
|
```python
print("1001010111001010"[int(input())-1])
```
| 3
|
|
151
|
A
|
Soft Drinking
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
This winter is so cold in Nvodsk! A group of *n* friends decided to buy *k* bottles of a soft drink called "Take-It-Light" to warm up a bit. Each bottle has *l* milliliters of the drink. Also they bought *c* limes and cut each of them into *d* slices. After that they found *p* grams of salt.
To make a toast, each friend needs *nl* milliliters of the drink, a slice of lime and *np* grams of salt. The friends want to make as many toasts as they can, provided they all drink the same amount. How many toasts can each friend make?
|
The first and only line contains positive integers *n*, *k*, *l*, *c*, *d*, *p*, *nl*, *np*, not exceeding 1000 and no less than 1. The numbers are separated by exactly one space.
|
Print a single integer — the number of toasts each friend can make.
|
[
"3 4 5 10 8 100 3 1\n",
"5 100 10 1 19 90 4 3\n",
"10 1000 1000 25 23 1 50 1\n"
] |
[
"2\n",
"3\n",
"0\n"
] |
A comment to the first sample:
Overall the friends have 4 * 5 = 20 milliliters of the drink, it is enough to make 20 / 3 = 6 toasts. The limes are enough for 10 * 8 = 80 toasts and the salt is enough for 100 / 1 = 100 toasts. However, there are 3 friends in the group, so the answer is *min*(6, 80, 100) / 3 = 2.
| 500
|
[
{
"input": "3 4 5 10 8 100 3 1",
"output": "2"
},
{
"input": "5 100 10 1 19 90 4 3",
"output": "3"
},
{
"input": "10 1000 1000 25 23 1 50 1",
"output": "0"
},
{
"input": "1 7 4 5 5 8 3 2",
"output": "4"
},
{
"input": "2 3 3 5 5 10 1 3",
"output": "1"
},
{
"input": "2 6 4 5 6 5 1 3",
"output": "0"
},
{
"input": "1 7 3 5 3 6 2 1",
"output": "6"
},
{
"input": "2 4 5 4 5 7 3 2",
"output": "1"
},
{
"input": "2 3 6 5 7 8 2 1",
"output": "4"
},
{
"input": "1 4 5 5 3 10 3 1",
"output": "6"
},
{
"input": "1 4 6 7 3 5 1 3",
"output": "1"
},
{
"input": "1 6 5 5 5 8 3 1",
"output": "8"
},
{
"input": "1 7 5 3 3 9 2 1",
"output": "9"
},
{
"input": "3 5 3 7 6 10 3 1",
"output": "1"
},
{
"input": "3 6 3 5 3 6 3 1",
"output": "2"
},
{
"input": "1 7 5 5 5 5 2 2",
"output": "2"
},
{
"input": "2 5 3 5 6 9 2 1",
"output": "3"
},
{
"input": "3 4 3 5 3 6 2 1",
"output": "2"
},
{
"input": "1 5 5 4 7 6 3 1",
"output": "6"
},
{
"input": "2 3 7 6 5 9 3 1",
"output": "3"
},
{
"input": "2 6 5 3 3 8 1 1",
"output": "4"
},
{
"input": "2 4 7 3 4 10 2 1",
"output": "5"
},
{
"input": "1 1000 1000 1000 1000 1000 1 1",
"output": "1000"
},
{
"input": "17 1000 1000 1000 1000 1000 3 7",
"output": "8"
},
{
"input": "115 1000 1000 1000 1000 1000 17 15",
"output": "0"
},
{
"input": "1 587 981 1 2 1 1 1",
"output": "1"
},
{
"input": "1 1 2 1 2 2 1 1",
"output": "2"
}
] | 1,684,320,878
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 27
| 92
| 0
|
a,b,c,d,e,f,g,h=map(int,input().split())
q=b*c
w=q//g
e=d*e
r=f//h
print(int(min(w,e,r)/a))
|
Title: Soft Drinking
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This winter is so cold in Nvodsk! A group of *n* friends decided to buy *k* bottles of a soft drink called "Take-It-Light" to warm up a bit. Each bottle has *l* milliliters of the drink. Also they bought *c* limes and cut each of them into *d* slices. After that they found *p* grams of salt.
To make a toast, each friend needs *nl* milliliters of the drink, a slice of lime and *np* grams of salt. The friends want to make as many toasts as they can, provided they all drink the same amount. How many toasts can each friend make?
Input Specification:
The first and only line contains positive integers *n*, *k*, *l*, *c*, *d*, *p*, *nl*, *np*, not exceeding 1000 and no less than 1. The numbers are separated by exactly one space.
Output Specification:
Print a single integer — the number of toasts each friend can make.
Demo Input:
['3 4 5 10 8 100 3 1\n', '5 100 10 1 19 90 4 3\n', '10 1000 1000 25 23 1 50 1\n']
Demo Output:
['2\n', '3\n', '0\n']
Note:
A comment to the first sample:
Overall the friends have 4 * 5 = 20 milliliters of the drink, it is enough to make 20 / 3 = 6 toasts. The limes are enough for 10 * 8 = 80 toasts and the salt is enough for 100 / 1 = 100 toasts. However, there are 3 friends in the group, so the answer is *min*(6, 80, 100) / 3 = 2.
|
```python
a,b,c,d,e,f,g,h=map(int,input().split())
q=b*c
w=q//g
e=d*e
r=f//h
print(int(min(w,e,r)/a))
```
| 3
|
|
1,009
|
A
|
Game Shopping
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Maxim wants to buy some games at the local game shop. There are $n$ games in the shop, the $i$-th game costs $c_i$.
Maxim has a wallet which can be represented as an array of integers. His wallet contains $m$ bills, the $j$-th bill has value $a_j$.
Games in the shop are ordered from left to right, Maxim tries to buy every game in that order.
When Maxim stands at the position $i$ in the shop, he takes the first bill from his wallet (if his wallet is empty then he proceeds to the next position immediately) and tries to buy the $i$-th game using this bill. After Maxim tried to buy the $n$-th game, he leaves the shop.
Maxim buys the $i$-th game if and only if the value of the first bill (which he takes) from his wallet is greater or equal to the cost of the $i$-th game. If he successfully buys the $i$-th game, the first bill from his wallet disappears and the next bill becomes first. Otherwise Maxim leaves the first bill in his wallet (this bill still remains the first one) and proceeds to the next game.
For example, for array $c = [2, 4, 5, 2, 4]$ and array $a = [5, 3, 4, 6]$ the following process takes place: Maxim buys the first game using the first bill (its value is $5$), the bill disappears, after that the second bill (with value $3$) becomes the first one in Maxim's wallet, then Maxim doesn't buy the second game because $c_2 > a_2$, the same with the third game, then he buys the fourth game using the bill of value $a_2$ (the third bill becomes the first one in Maxim's wallet) and buys the fifth game using the bill of value $a_3$.
Your task is to get the number of games Maxim will buy.
|
The first line of the input contains two integers $n$ and $m$ ($1 \le n, m \le 1000$) — the number of games and the number of bills in Maxim's wallet.
The second line of the input contains $n$ integers $c_1, c_2, \dots, c_n$ ($1 \le c_i \le 1000$), where $c_i$ is the cost of the $i$-th game.
The third line of the input contains $m$ integers $a_1, a_2, \dots, a_m$ ($1 \le a_j \le 1000$), where $a_j$ is the value of the $j$-th bill from the Maxim's wallet.
|
Print a single integer — the number of games Maxim will buy.
|
[
"5 4\n2 4 5 2 4\n5 3 4 6\n",
"5 2\n20 40 50 20 40\n19 20\n",
"6 4\n4 8 15 16 23 42\n1000 1000 1000 1000\n"
] |
[
"3\n",
"0\n",
"4\n"
] |
The first example is described in the problem statement.
In the second example Maxim cannot buy any game because the value of the first bill in his wallet is smaller than the cost of any game in the shop.
In the third example the values of the bills in Maxim's wallet are large enough to buy any game he encounter until he runs out of bills in his wallet.
| 0
|
[
{
"input": "5 4\n2 4 5 2 4\n5 3 4 6",
"output": "3"
},
{
"input": "5 2\n20 40 50 20 40\n19 20",
"output": "0"
},
{
"input": "6 4\n4 8 15 16 23 42\n1000 1000 1000 1000",
"output": "4"
},
{
"input": "5 1\n1 1 1 1 1\n5",
"output": "1"
},
{
"input": "5 1\n10 1 1 1 1\n1000",
"output": "1"
},
{
"input": "5 1\n100 100 100 100 100\n100",
"output": "1"
},
{
"input": "2 1\n2 1\n1",
"output": "1"
},
{
"input": "2 3\n3 1\n2 4 2",
"output": "1"
},
{
"input": "1 5\n4\n1 4 3 3 2",
"output": "0"
},
{
"input": "5 3\n4 2 3 1 1\n2 1 3",
"output": "3"
},
{
"input": "3 5\n5 2 5\n1 4 1 4 2",
"output": "0"
},
{
"input": "7 3\n9 7 10 2 1 1 1\n8 9 6",
"output": "3"
},
{
"input": "5 3\n2 5 3 3 2\n2 5 3",
"output": "3"
}
] | 1,547,913,598
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 19
| 109
| 0
|
n, m = map(int, input().split())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
zero1 = 0 ; zero2 = 0
for i in a:
if zero2 < m and i <= b[zero2]:
zero1 += 1 ; zero2 += 1
print(zero1)
|
Title: Game Shopping
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Maxim wants to buy some games at the local game shop. There are $n$ games in the shop, the $i$-th game costs $c_i$.
Maxim has a wallet which can be represented as an array of integers. His wallet contains $m$ bills, the $j$-th bill has value $a_j$.
Games in the shop are ordered from left to right, Maxim tries to buy every game in that order.
When Maxim stands at the position $i$ in the shop, he takes the first bill from his wallet (if his wallet is empty then he proceeds to the next position immediately) and tries to buy the $i$-th game using this bill. After Maxim tried to buy the $n$-th game, he leaves the shop.
Maxim buys the $i$-th game if and only if the value of the first bill (which he takes) from his wallet is greater or equal to the cost of the $i$-th game. If he successfully buys the $i$-th game, the first bill from his wallet disappears and the next bill becomes first. Otherwise Maxim leaves the first bill in his wallet (this bill still remains the first one) and proceeds to the next game.
For example, for array $c = [2, 4, 5, 2, 4]$ and array $a = [5, 3, 4, 6]$ the following process takes place: Maxim buys the first game using the first bill (its value is $5$), the bill disappears, after that the second bill (with value $3$) becomes the first one in Maxim's wallet, then Maxim doesn't buy the second game because $c_2 > a_2$, the same with the third game, then he buys the fourth game using the bill of value $a_2$ (the third bill becomes the first one in Maxim's wallet) and buys the fifth game using the bill of value $a_3$.
Your task is to get the number of games Maxim will buy.
Input Specification:
The first line of the input contains two integers $n$ and $m$ ($1 \le n, m \le 1000$) — the number of games and the number of bills in Maxim's wallet.
The second line of the input contains $n$ integers $c_1, c_2, \dots, c_n$ ($1 \le c_i \le 1000$), where $c_i$ is the cost of the $i$-th game.
The third line of the input contains $m$ integers $a_1, a_2, \dots, a_m$ ($1 \le a_j \le 1000$), where $a_j$ is the value of the $j$-th bill from the Maxim's wallet.
Output Specification:
Print a single integer — the number of games Maxim will buy.
Demo Input:
['5 4\n2 4 5 2 4\n5 3 4 6\n', '5 2\n20 40 50 20 40\n19 20\n', '6 4\n4 8 15 16 23 42\n1000 1000 1000 1000\n']
Demo Output:
['3\n', '0\n', '4\n']
Note:
The first example is described in the problem statement.
In the second example Maxim cannot buy any game because the value of the first bill in his wallet is smaller than the cost of any game in the shop.
In the third example the values of the bills in Maxim's wallet are large enough to buy any game he encounter until he runs out of bills in his wallet.
|
```python
n, m = map(int, input().split())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
zero1 = 0 ; zero2 = 0
for i in a:
if zero2 < m and i <= b[zero2]:
zero1 += 1 ; zero2 += 1
print(zero1)
```
| 3
|
|
835
|
A
|
Key races
|
PROGRAMMING
| 800
|
[
"math"
] | null | null |
Two boys decided to compete in text typing on the site "Key races". During the competition, they have to type a text consisting of *s* characters. The first participant types one character in *v*1 milliseconds and has ping *t*1 milliseconds. The second participant types one character in *v*2 milliseconds and has ping *t*2 milliseconds.
If connection ping (delay) is *t* milliseconds, the competition passes for a participant as follows:
1. Exactly after *t* milliseconds after the start of the competition the participant receives the text to be entered. 1. Right after that he starts to type it. 1. Exactly *t* milliseconds after he ends typing all the text, the site receives information about it.
The winner is the participant whose information on the success comes earlier. If the information comes from both participants at the same time, it is considered that there is a draw.
Given the length of the text and the information about participants, determine the result of the game.
|
The first line contains five integers *s*, *v*1, *v*2, *t*1, *t*2 (1<=≤<=*s*,<=*v*1,<=*v*2,<=*t*1,<=*t*2<=≤<=1000) — the number of characters in the text, the time of typing one character for the first participant, the time of typing one character for the the second participant, the ping of the first participant and the ping of the second participant.
|
If the first participant wins, print "First". If the second participant wins, print "Second". In case of a draw print "Friendship".
|
[
"5 1 2 1 2\n",
"3 3 1 1 1\n",
"4 5 3 1 5\n"
] |
[
"First\n",
"Second\n",
"Friendship\n"
] |
In the first example, information on the success of the first participant comes in 7 milliseconds, of the second participant — in 14 milliseconds. So, the first wins.
In the second example, information on the success of the first participant comes in 11 milliseconds, of the second participant — in 5 milliseconds. So, the second wins.
In the third example, information on the success of the first participant comes in 22 milliseconds, of the second participant — in 22 milliseconds. So, it is be a draw.
| 500
|
[
{
"input": "5 1 2 1 2",
"output": "First"
},
{
"input": "3 3 1 1 1",
"output": "Second"
},
{
"input": "4 5 3 1 5",
"output": "Friendship"
},
{
"input": "1000 1000 1000 1000 1000",
"output": "Friendship"
},
{
"input": "1 1 1 1 1",
"output": "Friendship"
},
{
"input": "8 8 1 1 1",
"output": "Second"
},
{
"input": "15 14 32 65 28",
"output": "First"
},
{
"input": "894 197 325 232 902",
"output": "First"
},
{
"input": "1 2 8 8 5",
"output": "Friendship"
},
{
"input": "37 261 207 1 1000",
"output": "Friendship"
},
{
"input": "29 344 406 900 1",
"output": "Friendship"
},
{
"input": "1 2 8 9 8",
"output": "First"
},
{
"input": "2 9 8 8 9",
"output": "Friendship"
},
{
"input": "213 480 811 134 745",
"output": "First"
},
{
"input": "2 313 856 964 421",
"output": "Friendship"
},
{
"input": "1 10 2 6 10",
"output": "Friendship"
},
{
"input": "2 7 6 2 3",
"output": "Friendship"
},
{
"input": "637 324 69 612 998",
"output": "Second"
},
{
"input": "13 849 819 723 918",
"output": "Friendship"
},
{
"input": "9 5 7 8 7",
"output": "First"
},
{
"input": "6 5 7 10 4",
"output": "Friendship"
},
{
"input": "61 464 623 89 548",
"output": "First"
},
{
"input": "641 31 29 161 802",
"output": "Friendship"
},
{
"input": "3 3 1 6 9",
"output": "Friendship"
},
{
"input": "2 3 9 8 2",
"output": "Friendship"
},
{
"input": "485 117 368 567 609",
"output": "First"
},
{
"input": "4 202 512 995 375",
"output": "Friendship"
},
{
"input": "424 41 41 909 909",
"output": "Friendship"
},
{
"input": "884 913 263 641 265",
"output": "Second"
},
{
"input": "12 462 8 311 327",
"output": "Second"
},
{
"input": "436 306 266 493 580",
"output": "Second"
},
{
"input": "69 1 2 1 2",
"output": "First"
}
] | 1,628,969,138
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 32
| 108
| 20,172,800
|
from sys import stdin, stdout
def read():
return stdin.readline().rstrip()
def read_int():
return int(read())
def read_ints():
return list(map(int, read().split()))
def solve():
s,v1,v2,t1,t2 = read_ints()
if v1*s+2*t1 < v2*s+2*t2:
print("First")
elif v1*s+2*t1 > v2*s+2*t2:
print("Second")
else:
print("Friendship")
solve()
|
Title: Key races
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two boys decided to compete in text typing on the site "Key races". During the competition, they have to type a text consisting of *s* characters. The first participant types one character in *v*1 milliseconds and has ping *t*1 milliseconds. The second participant types one character in *v*2 milliseconds and has ping *t*2 milliseconds.
If connection ping (delay) is *t* milliseconds, the competition passes for a participant as follows:
1. Exactly after *t* milliseconds after the start of the competition the participant receives the text to be entered. 1. Right after that he starts to type it. 1. Exactly *t* milliseconds after he ends typing all the text, the site receives information about it.
The winner is the participant whose information on the success comes earlier. If the information comes from both participants at the same time, it is considered that there is a draw.
Given the length of the text and the information about participants, determine the result of the game.
Input Specification:
The first line contains five integers *s*, *v*1, *v*2, *t*1, *t*2 (1<=≤<=*s*,<=*v*1,<=*v*2,<=*t*1,<=*t*2<=≤<=1000) — the number of characters in the text, the time of typing one character for the first participant, the time of typing one character for the the second participant, the ping of the first participant and the ping of the second participant.
Output Specification:
If the first participant wins, print "First". If the second participant wins, print "Second". In case of a draw print "Friendship".
Demo Input:
['5 1 2 1 2\n', '3 3 1 1 1\n', '4 5 3 1 5\n']
Demo Output:
['First\n', 'Second\n', 'Friendship\n']
Note:
In the first example, information on the success of the first participant comes in 7 milliseconds, of the second participant — in 14 milliseconds. So, the first wins.
In the second example, information on the success of the first participant comes in 11 milliseconds, of the second participant — in 5 milliseconds. So, the second wins.
In the third example, information on the success of the first participant comes in 22 milliseconds, of the second participant — in 22 milliseconds. So, it is be a draw.
|
```python
from sys import stdin, stdout
def read():
return stdin.readline().rstrip()
def read_int():
return int(read())
def read_ints():
return list(map(int, read().split()))
def solve():
s,v1,v2,t1,t2 = read_ints()
if v1*s+2*t1 < v2*s+2*t2:
print("First")
elif v1*s+2*t1 > v2*s+2*t2:
print("Second")
else:
print("Friendship")
solve()
```
| 3
|
|
26
|
B
|
Regular Bracket Sequence
|
PROGRAMMING
| 1,400
|
[
"greedy"
] |
B. Regular Bracket Sequence
|
5
|
256
|
A bracket sequence is called regular if it is possible to obtain correct arithmetic expression by inserting characters «+» and «1» into this sequence. For example, sequences «(())()», «()» and «(()(()))» are regular, while «)(», «(()» and «(()))(» are not.
One day Johnny got bracket sequence. He decided to remove some of the brackets from it in order to obtain a regular bracket sequence. What is the maximum length of a regular bracket sequence which can be obtained?
|
Input consists of a single line with non-empty string of «(» and «)» characters. Its length does not exceed 106.
|
Output the maximum possible length of a regular bracket sequence.
|
[
"(()))(\n",
"((()())\n"
] |
[
"4\n",
"6\n"
] |
none
| 1,000
|
[
{
"input": "(()))(",
"output": "4"
},
{
"input": "((()())",
"output": "6"
},
{
"input": "(",
"output": "0"
},
{
"input": ")",
"output": "0"
},
{
"input": ")(()(",
"output": "2"
},
{
"input": "))))))(",
"output": "0"
},
{
"input": "()()(()(((",
"output": "6"
},
{
"input": "()))(()((((()(())",
"output": "10"
},
{
"input": "())))((()())())))))())",
"output": "14"
},
{
"input": ")))((((())(()((()((((()()())((",
"output": "16"
},
{
"input": "))()()((()()))())()(((((((())((((((((())()()((())(",
"output": "32"
},
{
"input": "))())))))))())))))()()))()()))))())))))()))))))))))))(()))())(()))))(()))))())))((((()()))))()))()))",
"output": "48"
}
] | 1,679,224,950
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 38
| 872
| 6,144,000
|
x = list(input())
c1 = 0
c2 = 0
for i in range(len(x)):
if x[-1] == "(" and c1 == 0:
x.pop()
elif x[-1] == ")":
x.pop()
c1+=1
else:
x.pop()
c1-=1
c2+=2
print(c2)
|
Title: Regular Bracket Sequence
Time Limit: 5 seconds
Memory Limit: 256 megabytes
Problem Description:
A bracket sequence is called regular if it is possible to obtain correct arithmetic expression by inserting characters «+» and «1» into this sequence. For example, sequences «(())()», «()» and «(()(()))» are regular, while «)(», «(()» and «(()))(» are not.
One day Johnny got bracket sequence. He decided to remove some of the brackets from it in order to obtain a regular bracket sequence. What is the maximum length of a regular bracket sequence which can be obtained?
Input Specification:
Input consists of a single line with non-empty string of «(» and «)» characters. Its length does not exceed 106.
Output Specification:
Output the maximum possible length of a regular bracket sequence.
Demo Input:
['(()))(\n', '((()())\n']
Demo Output:
['4\n', '6\n']
Note:
none
|
```python
x = list(input())
c1 = 0
c2 = 0
for i in range(len(x)):
if x[-1] == "(" and c1 == 0:
x.pop()
elif x[-1] == ")":
x.pop()
c1+=1
else:
x.pop()
c1-=1
c2+=2
print(c2)
```
| 3.901356
|
437
|
C
|
The Child and Toy
|
PROGRAMMING
| 1,400
|
[
"graphs",
"greedy",
"sortings"
] | null | null |
On Children's Day, the child got a toy from Delayyy as a present. However, the child is so naughty that he can't wait to destroy the toy.
The toy consists of *n* parts and *m* ropes. Each rope links two parts, but every pair of parts is linked by at most one rope. To split the toy, the child must remove all its parts. The child can remove a single part at a time, and each remove consume an energy. Let's define an energy value of part *i* as *v**i*. The child spend *v**f*1<=+<=*v**f*2<=+<=...<=+<=*v**f**k* energy for removing part *i* where *f*1,<=*f*2,<=...,<=*f**k* are the parts that are directly connected to the *i*-th and haven't been removed.
Help the child to find out, what is the minimum total energy he should spend to remove all *n* parts.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=1000; 0<=≤<=*m*<=≤<=2000). The second line contains *n* integers: *v*1,<=*v*2,<=...,<=*v**n* (0<=≤<=*v**i*<=≤<=105). Then followed *m* lines, each line contains two integers *x**i* and *y**i*, representing a rope from part *x**i* to part *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*; *x**i*<=≠<=*y**i*).
Consider all the parts are numbered from 1 to *n*.
|
Output the minimum total energy the child should spend to remove all *n* parts of the toy.
|
[
"4 3\n10 20 30 40\n1 4\n1 2\n2 3\n",
"4 4\n100 100 100 100\n1 2\n2 3\n2 4\n3 4\n",
"7 10\n40 10 20 10 20 80 40\n1 5\n4 7\n4 5\n5 2\n5 7\n6 4\n1 6\n1 3\n4 3\n1 4\n"
] |
[
"40\n",
"400\n",
"160\n"
] |
One of the optimal sequence of actions in the first sample is:
- First, remove part 3, cost of the action is 20. - Then, remove part 2, cost of the action is 10. - Next, remove part 4, cost of the action is 10. - At last, remove part 1, cost of the action is 0.
So the total energy the child paid is 20 + 10 + 10 + 0 = 40, which is the minimum.
In the second sample, the child will spend 400 no matter in what order he will remove the parts.
| 1,500
|
[
{
"input": "4 3\n10 20 30 40\n1 4\n1 2\n2 3",
"output": "40"
},
{
"input": "4 4\n100 100 100 100\n1 2\n2 3\n2 4\n3 4",
"output": "400"
},
{
"input": "7 10\n40 10 20 10 20 80 40\n1 5\n4 7\n4 5\n5 2\n5 7\n6 4\n1 6\n1 3\n4 3\n1 4",
"output": "160"
},
{
"input": "1 0\n23333",
"output": "0"
},
{
"input": "5 4\n1 2 2 2 2\n1 2\n1 3\n1 4\n1 5",
"output": "4"
},
{
"input": "10 30\n3 6 17 15 13 15 6 12 9 1\n3 8\n1 10\n4 7\n1 7\n3 7\n2 9\n8 10\n3 1\n3 4\n8 6\n10 3\n3 9\n2 3\n10 4\n2 10\n5 8\n9 5\n6 1\n2 1\n7 2\n7 6\n7 10\n4 8\n5 6\n3 6\n4 1\n8 9\n7 9\n4 2\n5 10",
"output": "188"
},
{
"input": "3 3\n1 1 1\n1 2\n2 3\n3 1",
"output": "3"
}
] | 1,640,872,503
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 62
| 102,400
|
from collections import defaultdict
n,m = map(int,input().split())
A = list(map(int,input().split()))
d = defaultdict(list)
ans = 0
for i in range(m):
a,b = map(int,input().split())
ans += min(A[a-1],A[b-1])
print(ans)
|
Title: The Child and Toy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
On Children's Day, the child got a toy from Delayyy as a present. However, the child is so naughty that he can't wait to destroy the toy.
The toy consists of *n* parts and *m* ropes. Each rope links two parts, but every pair of parts is linked by at most one rope. To split the toy, the child must remove all its parts. The child can remove a single part at a time, and each remove consume an energy. Let's define an energy value of part *i* as *v**i*. The child spend *v**f*1<=+<=*v**f*2<=+<=...<=+<=*v**f**k* energy for removing part *i* where *f*1,<=*f*2,<=...,<=*f**k* are the parts that are directly connected to the *i*-th and haven't been removed.
Help the child to find out, what is the minimum total energy he should spend to remove all *n* parts.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=1000; 0<=≤<=*m*<=≤<=2000). The second line contains *n* integers: *v*1,<=*v*2,<=...,<=*v**n* (0<=≤<=*v**i*<=≤<=105). Then followed *m* lines, each line contains two integers *x**i* and *y**i*, representing a rope from part *x**i* to part *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*; *x**i*<=≠<=*y**i*).
Consider all the parts are numbered from 1 to *n*.
Output Specification:
Output the minimum total energy the child should spend to remove all *n* parts of the toy.
Demo Input:
['4 3\n10 20 30 40\n1 4\n1 2\n2 3\n', '4 4\n100 100 100 100\n1 2\n2 3\n2 4\n3 4\n', '7 10\n40 10 20 10 20 80 40\n1 5\n4 7\n4 5\n5 2\n5 7\n6 4\n1 6\n1 3\n4 3\n1 4\n']
Demo Output:
['40\n', '400\n', '160\n']
Note:
One of the optimal sequence of actions in the first sample is:
- First, remove part 3, cost of the action is 20. - Then, remove part 2, cost of the action is 10. - Next, remove part 4, cost of the action is 10. - At last, remove part 1, cost of the action is 0.
So the total energy the child paid is 20 + 10 + 10 + 0 = 40, which is the minimum.
In the second sample, the child will spend 400 no matter in what order he will remove the parts.
|
```python
from collections import defaultdict
n,m = map(int,input().split())
A = list(map(int,input().split()))
d = defaultdict(list)
ans = 0
for i in range(m):
a,b = map(int,input().split())
ans += min(A[a-1],A[b-1])
print(ans)
```
| 3
|
|
148
|
A
|
Insomnia cure
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation",
"math"
] | null | null |
«One dragon. Two dragon. Three dragon», — the princess was counting. She had trouble falling asleep, and she got bored of counting lambs when she was nine.
However, just counting dragons was boring as well, so she entertained herself at best she could. Tonight she imagined that all dragons were here to steal her, and she was fighting them off. Every *k*-th dragon got punched in the face with a frying pan. Every *l*-th dragon got his tail shut into the balcony door. Every *m*-th dragon got his paws trampled with sharp heels. Finally, she threatened every *n*-th dragon to call her mom, and he withdrew in panic.
How many imaginary dragons suffered moral or physical damage tonight, if the princess counted a total of *d* dragons?
|
Input data contains integer numbers *k*,<=*l*,<=*m*,<=*n* and *d*, each number in a separate line (1<=≤<=*k*,<=*l*,<=*m*,<=*n*<=≤<=10, 1<=≤<=*d*<=≤<=105).
|
Output the number of damaged dragons.
|
[
"1\n2\n3\n4\n12\n",
"2\n3\n4\n5\n24\n"
] |
[
"12\n",
"17\n"
] |
In the first case every first dragon got punched with a frying pan. Some of the dragons suffered from other reasons as well, but the pan alone would be enough.
In the second case dragons 1, 7, 11, 13, 17, 19 and 23 escaped unharmed.
| 1,000
|
[
{
"input": "1\n2\n3\n4\n12",
"output": "12"
},
{
"input": "2\n3\n4\n5\n24",
"output": "17"
},
{
"input": "1\n1\n1\n1\n100000",
"output": "100000"
},
{
"input": "10\n9\n8\n7\n6",
"output": "0"
},
{
"input": "8\n4\n4\n3\n65437",
"output": "32718"
},
{
"input": "8\n4\n1\n10\n59392",
"output": "59392"
},
{
"input": "4\n1\n8\n7\n44835",
"output": "44835"
},
{
"input": "6\n1\n7\n2\n62982",
"output": "62982"
},
{
"input": "2\n7\n4\n9\n56937",
"output": "35246"
},
{
"input": "2\n9\n8\n1\n75083",
"output": "75083"
},
{
"input": "8\n7\n7\n6\n69038",
"output": "24656"
},
{
"input": "4\n4\n2\n3\n54481",
"output": "36320"
},
{
"input": "6\n4\n9\n8\n72628",
"output": "28244"
},
{
"input": "9\n7\n8\n10\n42357",
"output": "16540"
},
{
"input": "5\n6\n4\n3\n60504",
"output": "36302"
},
{
"input": "7\n2\n3\n8\n21754",
"output": "15539"
},
{
"input": "1\n2\n10\n4\n39901",
"output": "39901"
},
{
"input": "3\n4\n7\n1\n58048",
"output": "58048"
},
{
"input": "9\n10\n4\n6\n52003",
"output": "21956"
},
{
"input": "5\n10\n9\n3\n70149",
"output": "32736"
},
{
"input": "5\n5\n5\n10\n55592",
"output": "11118"
},
{
"input": "1\n5\n2\n6\n49547",
"output": "49547"
},
{
"input": "3\n7\n7\n7\n84046",
"output": "36019"
},
{
"input": "10\n2\n1\n8\n63537",
"output": "63537"
},
{
"input": "7\n2\n10\n5\n81684",
"output": "53678"
},
{
"input": "7\n1\n6\n8\n99831",
"output": "99831"
},
{
"input": "3\n9\n3\n3\n61082",
"output": "20360"
},
{
"input": "5\n5\n8\n9\n79228",
"output": "29931"
},
{
"input": "1\n5\n5\n6\n89535",
"output": "89535"
},
{
"input": "5\n5\n2\n1\n7682",
"output": "7682"
},
{
"input": "7\n4\n8\n8\n25829",
"output": "9224"
},
{
"input": "3\n4\n3\n3\n87079",
"output": "43539"
},
{
"input": "5\n8\n4\n9\n5226",
"output": "2438"
},
{
"input": "4\n9\n6\n6\n1070",
"output": "415"
},
{
"input": "10\n10\n10\n10\n100000",
"output": "10000"
},
{
"input": "1\n1\n1\n1\n1",
"output": "1"
},
{
"input": "10\n10\n10\n10\n1",
"output": "0"
},
{
"input": "10\n10\n1\n10\n10",
"output": "10"
},
{
"input": "10\n10\n1\n10\n100",
"output": "100"
},
{
"input": "2\n2\n2\n2\n1",
"output": "0"
}
] | 1,679,124,450
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 92
| 0
|
#using inclusion exclusion principle
def lcm(l):
if len(l)==2:
for i in range(1,l[0]*l[1]+1):
if i%l[0]==0 and i%l[1]==0:
return i
if len(l)==3:
for i in range(1,l[0]*l[1]*l[2]+1):
if i%l[0]==0 and i%l[1]==0 and i%l[2]==0:
return i
if len(l)==4:
for i in range(1,l[0]*l[1]*l[2]*l[3]+1):
if i%l[0]==0 and i%l[1]==0 and i%l[2]==0 and i%l[3]==0:
return i
a=int(input())
b=int(input())
c=int(input())
d=int(input())
n=int(input())
lcm_ab=n//lcm([a,b])
lcm_ac=n//lcm([a,c])
lcm_ad=n//lcm([a,d])
lcm_bc=n//lcm([b,c])
lcm_bd=n//lcm([b,d])
lcm_cd=n//lcm([c,d])
lcm_abc=n//lcm([a,b,c])
lcm_abd=n//lcm([a,b,d])
lcm_acd=n//lcm([a,c,d])
lcm_bcd=n//lcm([b,c,d])
lcm_abcd=n//lcm([a,b,c,d])
dragons=(n//a+n//b+n//c+n//d)-(lcm_ab+lcm_ac+lcm_ad+lcm_bc+lcm_bd+lcm_cd)+(lcm_abc+lcm_abd+lcm_acd+lcm_bcd)-lcm_abcd
print(dragons)
#alternate method but time inefficient
'''a=int(input())
b=int(input())
c=int(input())
d=int(input())
n=int(input())
l=[]
if a==1 or b==1 or c==1 or d==1:
print(n)
elif a>n and b>n and c>n and d>n:
print(0)
else:
for i in range(1,n+1):
l.append(i)
damaged=[]
for i in range(1,n+1,a):
if i not in damaged:
damaged.append(i)
for i in range(1,n+1,b):
if i not in damaged:
damaged.append(i)
for i in range(1,n+1,c):
if i not in damaged:
damaged.append(i)
for i in range(1,n+1,d):
if i not in damaged:
damaged.append(i)
print(len(damaged))'''
|
Title: Insomnia cure
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
«One dragon. Two dragon. Three dragon», — the princess was counting. She had trouble falling asleep, and she got bored of counting lambs when she was nine.
However, just counting dragons was boring as well, so she entertained herself at best she could. Tonight she imagined that all dragons were here to steal her, and she was fighting them off. Every *k*-th dragon got punched in the face with a frying pan. Every *l*-th dragon got his tail shut into the balcony door. Every *m*-th dragon got his paws trampled with sharp heels. Finally, she threatened every *n*-th dragon to call her mom, and he withdrew in panic.
How many imaginary dragons suffered moral or physical damage tonight, if the princess counted a total of *d* dragons?
Input Specification:
Input data contains integer numbers *k*,<=*l*,<=*m*,<=*n* and *d*, each number in a separate line (1<=≤<=*k*,<=*l*,<=*m*,<=*n*<=≤<=10, 1<=≤<=*d*<=≤<=105).
Output Specification:
Output the number of damaged dragons.
Demo Input:
['1\n2\n3\n4\n12\n', '2\n3\n4\n5\n24\n']
Demo Output:
['12\n', '17\n']
Note:
In the first case every first dragon got punched with a frying pan. Some of the dragons suffered from other reasons as well, but the pan alone would be enough.
In the second case dragons 1, 7, 11, 13, 17, 19 and 23 escaped unharmed.
|
```python
#using inclusion exclusion principle
def lcm(l):
if len(l)==2:
for i in range(1,l[0]*l[1]+1):
if i%l[0]==0 and i%l[1]==0:
return i
if len(l)==3:
for i in range(1,l[0]*l[1]*l[2]+1):
if i%l[0]==0 and i%l[1]==0 and i%l[2]==0:
return i
if len(l)==4:
for i in range(1,l[0]*l[1]*l[2]*l[3]+1):
if i%l[0]==0 and i%l[1]==0 and i%l[2]==0 and i%l[3]==0:
return i
a=int(input())
b=int(input())
c=int(input())
d=int(input())
n=int(input())
lcm_ab=n//lcm([a,b])
lcm_ac=n//lcm([a,c])
lcm_ad=n//lcm([a,d])
lcm_bc=n//lcm([b,c])
lcm_bd=n//lcm([b,d])
lcm_cd=n//lcm([c,d])
lcm_abc=n//lcm([a,b,c])
lcm_abd=n//lcm([a,b,d])
lcm_acd=n//lcm([a,c,d])
lcm_bcd=n//lcm([b,c,d])
lcm_abcd=n//lcm([a,b,c,d])
dragons=(n//a+n//b+n//c+n//d)-(lcm_ab+lcm_ac+lcm_ad+lcm_bc+lcm_bd+lcm_cd)+(lcm_abc+lcm_abd+lcm_acd+lcm_bcd)-lcm_abcd
print(dragons)
#alternate method but time inefficient
'''a=int(input())
b=int(input())
c=int(input())
d=int(input())
n=int(input())
l=[]
if a==1 or b==1 or c==1 or d==1:
print(n)
elif a>n and b>n and c>n and d>n:
print(0)
else:
for i in range(1,n+1):
l.append(i)
damaged=[]
for i in range(1,n+1,a):
if i not in damaged:
damaged.append(i)
for i in range(1,n+1,b):
if i not in damaged:
damaged.append(i)
for i in range(1,n+1,c):
if i not in damaged:
damaged.append(i)
for i in range(1,n+1,d):
if i not in damaged:
damaged.append(i)
print(len(damaged))'''
```
| 3
|
|
600
|
B
|
Queries about less or equal elements
|
PROGRAMMING
| 1,300
|
[
"binary search",
"data structures",
"sortings",
"two pointers"
] | null | null |
You are given two arrays of integers *a* and *b*. For each element of the second array *b**j* you should find the number of elements in array *a* that are less than or equal to the value *b**j*.
|
The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=2·105) — the sizes of arrays *a* and *b*.
The second line contains *n* integers — the elements of array *a* (<=-<=109<=≤<=*a**i*<=≤<=109).
The third line contains *m* integers — the elements of array *b* (<=-<=109<=≤<=*b**j*<=≤<=109).
|
Print *m* integers, separated by spaces: the *j*-th of which is equal to the number of such elements in array *a* that are less than or equal to the value *b**j*.
|
[
"5 4\n1 3 5 7 9\n6 4 2 8\n",
"5 5\n1 2 1 2 5\n3 1 4 1 5\n"
] |
[
"3 2 1 4\n",
"4 2 4 2 5\n"
] |
none
| 0
|
[
{
"input": "5 4\n1 3 5 7 9\n6 4 2 8",
"output": "3 2 1 4"
},
{
"input": "5 5\n1 2 1 2 5\n3 1 4 1 5",
"output": "4 2 4 2 5"
},
{
"input": "1 1\n-1\n-2",
"output": "0"
},
{
"input": "1 1\n-80890826\n686519510",
"output": "1"
},
{
"input": "11 11\n237468511 -779187544 -174606592 193890085 404563196 -71722998 -617934776 170102710 -442808289 109833389 953091341\n994454001 322957429 216874735 -606986750 -455806318 -663190696 3793295 41395397 -929612742 -787653860 -684738874",
"output": "11 9 8 2 2 1 5 5 0 0 1"
},
{
"input": "20 22\n858276994 -568758442 -918490847 -983345984 -172435358 389604931 200224783 486556113 413281867 -258259500 -627945379 -584563643 444685477 -602481243 -370745158 965672503 630955806 -626138773 -997221880 633102929\n-61330638 -977252080 -212144219 385501731 669589742 954357160 563935906 584468977 -895883477 405774444 853372186 186056475 -964575261 -952431965 632332084 -388829939 -23011650 310957048 -770695392 977376693 321435214 199223897",
"output": "11 2 10 12 18 19 16 16 3 13 18 11 2 2 17 8 11 12 3 20 12 11"
},
{
"input": "5 9\n1 3 5 7 9\n1 2 3 4 5 6 7 8 9",
"output": "1 1 2 2 3 3 4 4 5"
},
{
"input": "22 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22\n1",
"output": "1"
},
{
"input": "5 1\n1 3 3 3 5\n3",
"output": "4"
},
{
"input": "4 5\n1 1 1 4\n1 5 5 4 3",
"output": "3 4 4 4 3"
},
{
"input": "5 4\n0 5 5 5 6\n5 1 6 3",
"output": "4 1 5 1"
},
{
"input": "1 3\n0\n-1 0 1",
"output": "0 1 1"
},
{
"input": "96 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1",
"output": "96"
},
{
"input": "7 1\n1 2 3 4 5 6 7\n1",
"output": "1"
},
{
"input": "13 13\n-1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000\n-1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000",
"output": "7 13 7 13 7 13 7 13 7 13 7 13 7"
},
{
"input": "9 5\n1 2 3 4 5 6 7 8 9\n1 2 3 4 5",
"output": "1 2 3 4 5"
},
{
"input": "3 8\n1 1 1\n1 1 1 1 1 1 1 1",
"output": "3 3 3 3 3 3 3 3"
},
{
"input": "1 1\n-11111\n-5938",
"output": "1"
},
{
"input": "1 1\n1\n400000009",
"output": "1"
},
{
"input": "1 1\n1\n300000009",
"output": "1"
},
{
"input": "1 1\n1\n200000009",
"output": "1"
},
{
"input": "1 1\n1\n200000003",
"output": "1"
}
] | 1,650,817,694
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 60
| 623
| 17,203,200
|
from bisect import *
I=lambda:map(int,input().split())
I()
l=sorted(I())
for e in I():print(bisect_right(l,e),end=' ')
|
Title: Queries about less or equal elements
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two arrays of integers *a* and *b*. For each element of the second array *b**j* you should find the number of elements in array *a* that are less than or equal to the value *b**j*.
Input Specification:
The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=2·105) — the sizes of arrays *a* and *b*.
The second line contains *n* integers — the elements of array *a* (<=-<=109<=≤<=*a**i*<=≤<=109).
The third line contains *m* integers — the elements of array *b* (<=-<=109<=≤<=*b**j*<=≤<=109).
Output Specification:
Print *m* integers, separated by spaces: the *j*-th of which is equal to the number of such elements in array *a* that are less than or equal to the value *b**j*.
Demo Input:
['5 4\n1 3 5 7 9\n6 4 2 8\n', '5 5\n1 2 1 2 5\n3 1 4 1 5\n']
Demo Output:
['3 2 1 4\n', '4 2 4 2 5\n']
Note:
none
|
```python
from bisect import *
I=lambda:map(int,input().split())
I()
l=sorted(I())
for e in I():print(bisect_right(l,e),end=' ')
```
| 3
|
|
723
|
A
|
The New Year: Meeting Friends
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"sortings"
] | null | null |
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
|
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
|
Print one integer — the minimum total distance the friends need to travel in order to meet together.
|
[
"7 1 4\n",
"30 20 10\n"
] |
[
"6\n",
"20\n"
] |
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
| 500
|
[
{
"input": "7 1 4",
"output": "6"
},
{
"input": "30 20 10",
"output": "20"
},
{
"input": "1 4 100",
"output": "99"
},
{
"input": "100 1 91",
"output": "99"
},
{
"input": "1 45 100",
"output": "99"
},
{
"input": "1 2 3",
"output": "2"
},
{
"input": "71 85 88",
"output": "17"
},
{
"input": "30 38 99",
"output": "69"
},
{
"input": "23 82 95",
"output": "72"
},
{
"input": "22 41 47",
"output": "25"
},
{
"input": "9 94 77",
"output": "85"
},
{
"input": "1 53 51",
"output": "52"
},
{
"input": "25 97 93",
"output": "72"
},
{
"input": "42 53 51",
"output": "11"
},
{
"input": "81 96 94",
"output": "15"
},
{
"input": "21 5 93",
"output": "88"
},
{
"input": "50 13 75",
"output": "62"
},
{
"input": "41 28 98",
"output": "70"
},
{
"input": "69 46 82",
"output": "36"
},
{
"input": "87 28 89",
"output": "61"
},
{
"input": "44 45 40",
"output": "5"
},
{
"input": "86 97 68",
"output": "29"
},
{
"input": "43 92 30",
"output": "62"
},
{
"input": "16 70 1",
"output": "69"
},
{
"input": "40 46 19",
"output": "27"
},
{
"input": "71 38 56",
"output": "33"
},
{
"input": "82 21 80",
"output": "61"
},
{
"input": "75 8 35",
"output": "67"
},
{
"input": "75 24 28",
"output": "51"
},
{
"input": "78 23 56",
"output": "55"
},
{
"input": "85 31 10",
"output": "75"
},
{
"input": "76 50 9",
"output": "67"
},
{
"input": "95 37 34",
"output": "61"
},
{
"input": "84 61 35",
"output": "49"
},
{
"input": "87 85 37",
"output": "50"
},
{
"input": "1 3 2",
"output": "2"
},
{
"input": "4 2 6",
"output": "4"
},
{
"input": "6 9 3",
"output": "6"
},
{
"input": "12 4 8",
"output": "8"
},
{
"input": "15 10 5",
"output": "10"
},
{
"input": "1 50 17",
"output": "49"
},
{
"input": "10 5 15",
"output": "10"
},
{
"input": "8 1 9",
"output": "8"
},
{
"input": "3 5 4",
"output": "2"
},
{
"input": "2 1 3",
"output": "2"
},
{
"input": "1 8 2",
"output": "7"
},
{
"input": "1 100 2",
"output": "99"
},
{
"input": "1 4 6",
"output": "5"
}
] | 1,681,794,458
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 48
| 62
| 0
|
arr = input().split()
arr = [int(x) for x in arr]
arr.sort()
distanceArr = []
for i in range(arr[0], arr[2] + 1):
distanceArr.append(abs(arr[0] - i) + abs(arr[1] - i) + abs(arr[2] - i))
print(min(distanceArr))
|
Title: The New Year: Meeting Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
Input Specification:
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
Output Specification:
Print one integer — the minimum total distance the friends need to travel in order to meet together.
Demo Input:
['7 1 4\n', '30 20 10\n']
Demo Output:
['6\n', '20\n']
Note:
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
|
```python
arr = input().split()
arr = [int(x) for x in arr]
arr.sort()
distanceArr = []
for i in range(arr[0], arr[2] + 1):
distanceArr.append(abs(arr[0] - i) + abs(arr[1] - i) + abs(arr[2] - i))
print(min(distanceArr))
```
| 3
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,688,446,321
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 31
| 0
|
# Codeforces 1A Theatre Square
def tiles(size, length):
reqd = size // length
rem = size % length
return reqd if rem == 0 else reqd + 1
n, m, a = (int(i) for i in input().split())
print(tiles(n, a) * tiles(m, a))
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
# Codeforces 1A Theatre Square
def tiles(size, length):
reqd = size // length
rem = size % length
return reqd if rem == 0 else reqd + 1
n, m, a = (int(i) for i in input().split())
print(tiles(n, a) * tiles(m, a))
```
| 3.9845
|
267
|
A
|
Subtractions
|
PROGRAMMING
| 900
|
[
"math",
"number theory"
] | null | null |
You've got two numbers. As long as they are both larger than zero, they go through the same operation: subtract the lesser number from the larger one. If they equal substract one number from the another. For example, one operation transforms pair (4,17) to pair (4,13), it transforms (5,5) to (0,5).
You've got some number of pairs (*a**i*,<=*b**i*). How many operations will be performed for each of them?
|
The first line contains the number of pairs *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000). Then follow *n* lines, each line contains a pair of positive integers *a**i*,<=*b**i* (1<=<=≤<=<=*a**i*,<=<=*b**i*<=<=≤<=<=109).
|
Print the sought number of operations for each pair on a single line.
|
[
"2\n4 17\n7 987654321\n"
] |
[
"8\n141093479\n"
] |
none
| 500
|
[
{
"input": "2\n4 17\n7 987654321",
"output": "8\n141093479"
},
{
"input": "10\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321",
"output": "141093479\n141093479\n141093479\n141093479\n141093479\n141093479\n141093479\n141093479\n141093479\n141093479"
},
{
"input": "1\n536870912 32",
"output": "16777216"
},
{
"input": "20\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999",
"output": "1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000"
},
{
"input": "3\n1000000000 1\n1000000000 1\n1 100000000",
"output": "1000000000\n1000000000\n100000000"
}
] | 1,633,726,217
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 62
| 6,963,200
|
for x in range(int(input())):
a, b = [int(x) for x in input().split()]
count = 0
while a != 0 and b != 0:
if a > b:
factor = (a-b)//b + 1
a -= factor*b
count+=factor
else:
factor = (b-a)//a+1
b -= factor*a
count+=factor
print(count)
|
Title: Subtractions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got two numbers. As long as they are both larger than zero, they go through the same operation: subtract the lesser number from the larger one. If they equal substract one number from the another. For example, one operation transforms pair (4,17) to pair (4,13), it transforms (5,5) to (0,5).
You've got some number of pairs (*a**i*,<=*b**i*). How many operations will be performed for each of them?
Input Specification:
The first line contains the number of pairs *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000). Then follow *n* lines, each line contains a pair of positive integers *a**i*,<=*b**i* (1<=<=≤<=<=*a**i*,<=<=*b**i*<=<=≤<=<=109).
Output Specification:
Print the sought number of operations for each pair on a single line.
Demo Input:
['2\n4 17\n7 987654321\n']
Demo Output:
['8\n141093479\n']
Note:
none
|
```python
for x in range(int(input())):
a, b = [int(x) for x in input().split()]
count = 0
while a != 0 and b != 0:
if a > b:
factor = (a-b)//b + 1
a -= factor*b
count+=factor
else:
factor = (b-a)//a+1
b -= factor*a
count+=factor
print(count)
```
| 3
|
|
918
|
B
|
Radio Station
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] | null | null |
As the guys fried the radio station facilities, the school principal gave them tasks as a punishment. Dustin's task was to add comments to nginx configuration for school's website. The school has *n* servers. Each server has a name and an ip (names aren't necessarily unique, but ips are). Dustin knows the ip and name of each server. For simplicity, we'll assume that an nginx command is of form "command ip;" where command is a string consisting of English lowercase letter only, and ip is the ip of one of school servers.
Each ip is of form "a.b.c.d" where *a*, *b*, *c* and *d* are non-negative integers less than or equal to 255 (with no leading zeros). The nginx configuration file Dustin has to add comments to has *m* commands. Nobody ever memorizes the ips of servers, so to understand the configuration better, Dustin has to comment the name of server that the ip belongs to at the end of each line (after each command). More formally, if a line is "command ip;" Dustin has to replace it with "command ip; #name" where name is the name of the server with ip equal to ip.
Dustin doesn't know anything about nginx, so he panicked again and his friends asked you to do his task for him.
|
The first line of input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000).
The next *n* lines contain the names and ips of the servers. Each line contains a string name, name of the server and a string ip, ip of the server, separated by space (1<=≤<=|*name*|<=≤<=10, *name* only consists of English lowercase letters). It is guaranteed that all ip are distinct.
The next *m* lines contain the commands in the configuration file. Each line is of form "command ip;" (1<=≤<=|*command*|<=≤<=10, command only consists of English lowercase letters). It is guaranteed that ip belongs to one of the *n* school servers.
|
Print *m* lines, the commands in the configuration file after Dustin did his task.
|
[
"2 2\nmain 192.168.0.2\nreplica 192.168.0.1\nblock 192.168.0.1;\nproxy 192.168.0.2;\n",
"3 5\ngoogle 8.8.8.8\ncodeforces 212.193.33.27\nserver 138.197.64.57\nredirect 138.197.64.57;\nblock 8.8.8.8;\ncf 212.193.33.27;\nunblock 8.8.8.8;\ncheck 138.197.64.57;\n"
] |
[
"block 192.168.0.1; #replica\nproxy 192.168.0.2; #main\n",
"redirect 138.197.64.57; #server\nblock 8.8.8.8; #google\ncf 212.193.33.27; #codeforces\nunblock 8.8.8.8; #google\ncheck 138.197.64.57; #server\n"
] |
none
| 1,000
|
[
{
"input": "2 2\nmain 192.168.0.2\nreplica 192.168.0.1\nblock 192.168.0.1;\nproxy 192.168.0.2;",
"output": "block 192.168.0.1; #replica\nproxy 192.168.0.2; #main"
},
{
"input": "3 5\ngoogle 8.8.8.8\ncodeforces 212.193.33.27\nserver 138.197.64.57\nredirect 138.197.64.57;\nblock 8.8.8.8;\ncf 212.193.33.27;\nunblock 8.8.8.8;\ncheck 138.197.64.57;",
"output": "redirect 138.197.64.57; #server\nblock 8.8.8.8; #google\ncf 212.193.33.27; #codeforces\nunblock 8.8.8.8; #google\ncheck 138.197.64.57; #server"
},
{
"input": "10 10\nittmcs 112.147.123.173\njkt 228.40.73.178\nfwckqtz 88.28.31.198\nkal 224.226.34.213\nnacuyokm 49.57.13.44\nfouynv 243.18.250.17\ns 45.248.83.247\ne 75.69.23.169\nauwoqlch 100.44.219.187\nlkldjq 46.123.169.140\ngjcylatwzi 46.123.169.140;\ndxfi 88.28.31.198;\ngv 46.123.169.140;\nety 88.28.31.198;\notbmgcrn 46.123.169.140;\nw 112.147.123.173;\np 75.69.23.169;\nvdsnigk 46.123.169.140;\nmmc 46.123.169.140;\ngtc 49.57.13.44;",
"output": "gjcylatwzi 46.123.169.140; #lkldjq\ndxfi 88.28.31.198; #fwckqtz\ngv 46.123.169.140; #lkldjq\nety 88.28.31.198; #fwckqtz\notbmgcrn 46.123.169.140; #lkldjq\nw 112.147.123.173; #ittmcs\np 75.69.23.169; #e\nvdsnigk 46.123.169.140; #lkldjq\nmmc 46.123.169.140; #lkldjq\ngtc 49.57.13.44; #nacuyokm"
},
{
"input": "1 1\nervbfot 185.32.99.2\nzygoumbmx 185.32.99.2;",
"output": "zygoumbmx 185.32.99.2; #ervbfot"
},
{
"input": "1 2\ny 245.182.246.189\nlllq 245.182.246.189;\nxds 245.182.246.189;",
"output": "lllq 245.182.246.189; #y\nxds 245.182.246.189; #y"
},
{
"input": "2 1\ntdwmshz 203.115.124.110\neksckjya 201.80.191.212\nzbtjzzue 203.115.124.110;",
"output": "zbtjzzue 203.115.124.110; #tdwmshz"
},
{
"input": "8 5\nfhgkq 5.19.189.178\nphftablcr 75.18.177.178\nxnpcg 158.231.167.176\ncfahrkq 26.165.124.191\nfkgtnqtfoh 230.13.13.129\nt 101.24.94.85\nvjoirslx 59.6.179.72\ntwktmskb 38.194.117.184\nrvzzlygosc 26.165.124.191;\ndcsgxrkgv 101.24.94.85;\nyvmyppn 59.6.179.72;\ngpdjjuq 75.18.177.178;\nvdviz 101.24.94.85;",
"output": "rvzzlygosc 26.165.124.191; #cfahrkq\ndcsgxrkgv 101.24.94.85; #t\nyvmyppn 59.6.179.72; #vjoirslx\ngpdjjuq 75.18.177.178; #phftablcr\nvdviz 101.24.94.85; #t"
},
{
"input": "2 1\nmain 1.1.1.1\nget 11.1.1.1\ncommand 11.1.1.1;",
"output": "command 11.1.1.1; #get"
},
{
"input": "2 2\nmain 0.0.0.255\nmainn 0.0.2.55\nblock 0.0.0.255;\nblock 0.0.2.55;",
"output": "block 0.0.0.255; #main\nblock 0.0.2.55; #mainn"
},
{
"input": "2 2\nmain 0.0.63.0\nreplica 0.38.0.56\nblock 0.0.63.0;\nproxy 0.38.0.56;",
"output": "block 0.0.63.0; #main\nproxy 0.38.0.56; #replica"
},
{
"input": "2 2\nmain 192.168.10.12\nreplica 192.167.10.12\nblock 192.168.10.12;\nproxy 192.167.10.12;",
"output": "block 192.168.10.12; #main\nproxy 192.167.10.12; #replica"
},
{
"input": "2 1\nneserver 185.218.47.91\nserver 255.255.255.255\nblock 255.255.255.255;",
"output": "block 255.255.255.255; #server"
},
{
"input": "2 1\nalp 22.222.30.10\nbet 222.22.30.10\nblock 22.222.30.10;",
"output": "block 22.222.30.10; #alp"
}
] | 1,563,450,879
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 28
| 124
| 409,600
|
n,m=map(int, input().split())
name=[]
ip1=[]
command=[]
ip2=[]
for i in range(n):
s=input().split()
name.append(s[0])
ip1.append(s[1])
for i in range(m):
s=input().split()
command.append(s[0])
ip2.append(s[1])
for i in range(m):
index=ip1.index(ip2[i][0:len(ip2[i])-1])
print("{} {} {}".format(command[i], ip2[i], "#"+name[index]))
|
Title: Radio Station
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As the guys fried the radio station facilities, the school principal gave them tasks as a punishment. Dustin's task was to add comments to nginx configuration for school's website. The school has *n* servers. Each server has a name and an ip (names aren't necessarily unique, but ips are). Dustin knows the ip and name of each server. For simplicity, we'll assume that an nginx command is of form "command ip;" where command is a string consisting of English lowercase letter only, and ip is the ip of one of school servers.
Each ip is of form "a.b.c.d" where *a*, *b*, *c* and *d* are non-negative integers less than or equal to 255 (with no leading zeros). The nginx configuration file Dustin has to add comments to has *m* commands. Nobody ever memorizes the ips of servers, so to understand the configuration better, Dustin has to comment the name of server that the ip belongs to at the end of each line (after each command). More formally, if a line is "command ip;" Dustin has to replace it with "command ip; #name" where name is the name of the server with ip equal to ip.
Dustin doesn't know anything about nginx, so he panicked again and his friends asked you to do his task for him.
Input Specification:
The first line of input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000).
The next *n* lines contain the names and ips of the servers. Each line contains a string name, name of the server and a string ip, ip of the server, separated by space (1<=≤<=|*name*|<=≤<=10, *name* only consists of English lowercase letters). It is guaranteed that all ip are distinct.
The next *m* lines contain the commands in the configuration file. Each line is of form "command ip;" (1<=≤<=|*command*|<=≤<=10, command only consists of English lowercase letters). It is guaranteed that ip belongs to one of the *n* school servers.
Output Specification:
Print *m* lines, the commands in the configuration file after Dustin did his task.
Demo Input:
['2 2\nmain 192.168.0.2\nreplica 192.168.0.1\nblock 192.168.0.1;\nproxy 192.168.0.2;\n', '3 5\ngoogle 8.8.8.8\ncodeforces 212.193.33.27\nserver 138.197.64.57\nredirect 138.197.64.57;\nblock 8.8.8.8;\ncf 212.193.33.27;\nunblock 8.8.8.8;\ncheck 138.197.64.57;\n']
Demo Output:
['block 192.168.0.1; #replica\nproxy 192.168.0.2; #main\n', 'redirect 138.197.64.57; #server\nblock 8.8.8.8; #google\ncf 212.193.33.27; #codeforces\nunblock 8.8.8.8; #google\ncheck 138.197.64.57; #server\n']
Note:
none
|
```python
n,m=map(int, input().split())
name=[]
ip1=[]
command=[]
ip2=[]
for i in range(n):
s=input().split()
name.append(s[0])
ip1.append(s[1])
for i in range(m):
s=input().split()
command.append(s[0])
ip2.append(s[1])
for i in range(m):
index=ip1.index(ip2[i][0:len(ip2[i])-1])
print("{} {} {}".format(command[i], ip2[i], "#"+name[index]))
```
| 3
|
|
39
|
B
|
Company Income Growth
|
PROGRAMMING
| 1,300
|
[
"greedy"
] |
B. Company Income Growth
|
2
|
64
|
Petya works as a PR manager for a successful Berland company BerSoft. He needs to prepare a presentation on the company income growth since 2001 (the year of its founding) till now. Petya knows that in 2001 the company income amounted to *a*1 billion bourles, in 2002 — to *a*2 billion, ..., and in the current (2000<=+<=*n*)-th year — *a**n* billion bourles. On the base of the information Petya decided to show in his presentation the linear progress history which is in his opinion perfect. According to a graph Petya has already made, in the first year BerSoft company income must amount to 1 billion bourles, in the second year — 2 billion bourles etc., each following year the income increases by 1 billion bourles. Unfortunately, the real numbers are different from the perfect ones. Among the numbers *a**i* can even occur negative ones that are a sign of the company’s losses in some years. That is why Petya wants to ignore some data, in other words, cross some numbers *a**i* from the sequence and leave only some subsequence that has perfect growth.
Thus Petya has to choose a sequence of years *y*1, *y*2, ..., *y**k*,so that in the year *y*1 the company income amounted to 1 billion bourles, in the year *y*2 — 2 billion bourles etc., in accordance with the perfect growth dynamics. Help him to choose the longest such sequence.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). The next line contains *n* integers *a**i* (<=-<=100<=≤<=*a**i*<=≤<=100). The number *a**i* determines the income of BerSoft company in the (2000<=+<=*i*)-th year. The numbers in the line are separated by spaces.
|
Output *k* — the maximum possible length of a perfect sequence. In the next line output the sequence of years *y*1, *y*2, ..., *y**k*. Separate the numbers by spaces. If the answer is not unique, output any. If no solution exist, output one number 0.
|
[
"10\n-2 1 1 3 2 3 4 -10 -2 5\n",
"3\n-1 -2 -3\n"
] |
[
"5\n2002 2005 2006 2007 2010\n",
"0\n"
] |
none
| 0
|
[
{
"input": "10\n-2 1 1 3 2 3 4 -10 -2 5",
"output": "5\n2002 2005 2006 2007 2010 "
},
{
"input": "3\n-1 -2 -3",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "2\n-1 1",
"output": "1\n2002 "
},
{
"input": "2\n-1 1",
"output": "1\n2002 "
},
{
"input": "2\n-2 0",
"output": "0"
},
{
"input": "2\n3 -3",
"output": "0"
},
{
"input": "3\n1 1 1",
"output": "1\n2001 "
},
{
"input": "3\n-2 -2 1",
"output": "1\n2003 "
},
{
"input": "4\n-4 2 3 -1",
"output": "0"
},
{
"input": "5\n-3 -3 -4 2 -2",
"output": "0"
},
{
"input": "100\n-1 -9 0 -2 -7 -3 -1 -1 6 -5 -3 5 10 -5 7 7 4 9 -6 1 0 3 0 1 -9 -9 6 -8 3 7 -9 -4 -5 -6 8 2 2 7 2 2 0 -6 5 3 9 7 -7 -7 -2 6 -3 -4 10 3 3 -4 2 -9 9 9 -6 -1 -7 -3 -6 10 10 -1 -8 -3 8 1 10 9 -9 10 4 -10 -6 9 7 8 5 -3 2 2 2 -7 -6 0 -4 -1 4 -2 -4 -1 2 -8 10 9",
"output": "5\n2020 2036 2044 2077 2083 "
},
{
"input": "100\n5 -1 6 0 2 10 -6 6 -10 0 10 6 -10 3 8 4 2 6 3 -9 1 -1 -8 6 -6 -10 0 -3 -1 -6 -7 -9 -5 -5 5 -10 -3 4 -6 8 -4 2 2 8 2 -7 -4 -4 -9 4 -9 6 -4 -10 -8 -6 2 6 -4 3 3 4 -1 -9 8 9 -6 5 3 9 -4 0 -9 -10 3 -10 2 5 7 0 9 4 5 -3 5 -5 9 -4 6 -7 4 -1 -10 -1 -2 2 -1 4 -10 6",
"output": "6\n2021 2042 2060 2062 2068 2089 "
},
{
"input": "100\n10 9 -10 0 -9 1 10 -6 -3 8 0 5 -7 -9 9 -1 1 4 9 0 4 -7 3 10 -3 -10 -6 4 -3 0 -7 8 -6 -1 5 0 -6 1 5 -7 10 10 -2 -10 -4 -1 -1 2 5 1 6 -7 3 -1 1 10 4 2 4 -3 -10 9 4 5 1 -10 -1 -9 -8 -2 4 -4 -10 -9 -5 -9 -1 -3 -3 -8 -8 -3 6 -3 6 10 -4 -1 -3 8 -9 0 -2 2 1 6 -4 -7 -9 3",
"output": "6\n2006 2048 2053 2057 2064 2083 "
},
{
"input": "100\n-8 -3 -4 2 1 -9 5 4 4 -8 -8 6 -7 -1 9 -6 -1 1 -5 9 6 10 -8 -5 -2 10 7 10 -5 8 -7 5 -4 0 3 9 -9 -5 -4 -2 4 -1 -4 -5 -9 6 2 7 0 -2 2 3 -9 6 -10 6 5 -4 -9 -9 1 -7 -9 -3 -5 -8 4 0 4 10 -8 -6 -8 -9 5 -8 -6 -9 10 5 -6 -7 6 -5 8 3 1 3 7 3 -1 0 5 4 4 7 -7 5 -8 -2",
"output": "7\n2005 2047 2052 2067 2075 2083 2089 "
},
{
"input": "100\n-15 8 -20 -2 -16 3 -19 -15 16 19 -1 -17 -14 9 7 2 20 -16 8 20 10 3 17 -3 2 5 9 15 3 3 -17 12 7 17 -19 -15 -5 16 -10 -4 10 -15 -16 9 -15 15 -16 7 -15 12 -17 7 4 -8 9 -2 -19 14 12 -1 17 -6 19 14 19 -9 -12 3 14 -10 5 7 19 11 5 10 18 2 -6 -12 7 5 -9 20 10 2 -20 6 -10 -16 -6 -5 -15 -2 15 -12 0 -18 2 -5",
"output": "0"
},
{
"input": "100\n11 18 14 -19 -12 -5 -14 -3 13 14 -20 11 -6 12 -2 19 -16 -2 -4 -4 -18 -2 -15 5 -7 -18 11 5 -8 16 17 1 6 8 -20 13 17 -15 -20 7 16 -3 -17 -1 1 -18 2 9 4 2 -18 13 16 -14 -18 -14 16 19 13 4 -14 3 5 -7 5 -17 -14 13 20 16 -13 7 12 15 0 4 16 -16 -6 -15 18 -19 2 8 -4 -8 14 -4 20 -15 -20 14 7 -10 -17 -20 13 -1 -11 -4",
"output": "4\n2032 2047 2062 2076 "
},
{
"input": "100\n3 99 47 -26 96 90 21 -74 -19 -17 80 -43 -24 -82 -39 -40 44 84 87 72 -78 -94 -82 -87 96 71 -29 -90 66 49 -87 19 -31 97 55 -29 -98 16 -23 68 84 -54 74 -71 -60 -32 -72 95 -55 -17 -49 -73 63 39 -31 -91 40 -29 -60 -33 -33 49 93 -56 -81 -18 38 45 -29 63 -37 27 75 13 -100 52 -51 75 -38 -49 28 39 -7 -37 -86 100 -8 28 -89 -57 -17 -52 -98 -92 56 -49 -24 92 28 31",
"output": "0"
},
{
"input": "100\n-36 -88 -23 -71 33 53 21 49 97 -50 -91 24 -83 -100 -77 88 -56 -31 -27 7 -74 -69 -75 -59 78 -66 53 21 -41 72 -31 -93 26 98 58 78 -95 -64 -2 34 74 14 23 -25 -51 -94 -46 100 -44 79 46 -8 79 25 -55 16 35 67 29 58 49 75 -53 80 63 -50 -59 -5 -71 -72 -57 75 -71 6 -5 -44 34 -2 -10 -58 -98 67 -42 22 95 46 -58 88 62 82 85 -74 -94 -5 -64 12 -8 44 -57 87",
"output": "0"
},
{
"input": "100\n-76 -73 -93 85 -30 66 -29 -79 13 -82 -12 90 8 -68 86 15 -5 55 -91 92 80 5 83 19 59 -1 -17 83 52 44 25 -3 83 -51 62 -66 -91 58 20 51 15 -70 -77 22 -92 -4 -70 55 -33 -27 -59 6 94 60 -79 -28 -20 -38 -83 100 -20 100 51 -35 -44 -82 44 -5 88 -6 -26 -79 -16 -2 -61 12 -81 -80 68 -68 -23 96 -77 80 -75 -57 93 97 12 20 -65 -46 -90 81 16 -77 -43 -3 8 -58",
"output": "0"
},
{
"input": "100\n-64 -18 -21 46 28 -100 21 -98 49 -44 -38 52 -85 62 42 -85 19 -27 88 -45 28 -86 -20 15 34 61 17 88 95 21 -40 -2 -12 90 -61 30 7 -13 -74 43 -57 43 -30 51 -19 -51 -22 -2 -76 85 1 -53 -31 -77 96 -61 61 88 -62 88 -6 -59 -70 18 -65 90 91 -27 -86 37 8 -92 -82 -78 -57 -81 17 -53 3 29 -88 -92 -28 49 -2 -41 32 -89 -38 49 22 37 -17 -1 -78 -80 -12 36 -95 30",
"output": "1\n2051 "
},
{
"input": "1\n1",
"output": "1\n2001 "
},
{
"input": "2\n1 2",
"output": "2\n2001 2002 "
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "100\n2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 2046 2047 2048 2049 2050 2051 2052 2053 2054 2055 2056 2057 2058 2059 2060 2061 2062 2063 2064 2065 2066 2067 2068 2069 2070 2071 2072 2073 2074 2075 2076 2077 2078 2079 2080 2081 2082 2083 2084 2085 2086 2087 2088 2089 2090 2091 2092 2093 2094 2095 2096 2097 2098 2099 2100 "
},
{
"input": "100\n-29 -92 -94 81 -100 1 -29 2 3 97 -37 4 5 -52 6 7 -81 86 8 9 10 98 36 -99 11 -18 12 -46 13 14 15 16 17 18 19 20 21 23 53 22 23 24 6 17 45 25 99 26 -53 -51 48 -11 71 27 -56 28 29 -36 30 31 61 -53 -64 32 33 89 -90 34 35 54 36 -89 13 -89 5 37 38 39 -57 26 55 80 40 63 41 42 43 44 92 45 46 47 -10 -10 -32 48 49 50 -10 -99",
"output": "50\n2006 2008 2009 2012 2013 2015 2016 2019 2020 2021 2025 2027 2029 2030 2031 2032 2033 2034 2035 2036 2037 2040 2041 2042 2046 2048 2054 2056 2057 2059 2060 2064 2065 2068 2069 2071 2076 2077 2078 2083 2085 2086 2087 2088 2090 2091 2092 2096 2097 2098 "
},
{
"input": "100\n1 2 84 -97 3 -59 30 -55 4 -6 80 5 6 7 -8 8 3 -96 88 9 10 -20 -95 11 12 67 5 4 -15 -62 -74 13 14 15 16 17 18 19 20 21 22 -15 23 -35 -17 24 25 -99 26 27 69 2 -92 -96 -77 28 29 -95 -75 30 -36 31 17 -88 10 52 32 33 34 -94 35 -38 -16 36 37 38 31 -58 39 -81 83 46 40 41 42 43 -44 44 4 49 -60 17 64 45 46 47 48 49 -38 50",
"output": "50\n2001 2002 2005 2009 2012 2013 2014 2016 2020 2021 2024 2025 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2043 2046 2047 2049 2050 2056 2057 2060 2062 2067 2068 2069 2071 2074 2075 2076 2079 2083 2084 2085 2086 2088 2094 2095 2096 2097 2098 2100 "
},
{
"input": "100\n1 2 80 30 95 51 -3 -12 3 -11 4 -90 5 6 7 8 -18 52 77 -82 9 10 11 -51 -16 70 12 13 14 15 16 17 58 18 36 19 -86 20 21 40 -53 94 22 23 27 67 24 -90 -38 17 -71 40 25 72 -82 26 27 -4 28 29 30 31 32 67 33 34 90 42 -52 35 36 37 -6 38 39 -11 30 40 41 42 -42 21 -96 43 -50 44 -73 16 45 90 46 47 48 2 -37 -88 49 -27 -43 50",
"output": "50\n2001 2002 2009 2011 2013 2014 2015 2016 2021 2022 2023 2027 2028 2029 2030 2031 2032 2034 2036 2038 2039 2043 2044 2047 2053 2056 2057 2059 2060 2061 2062 2063 2065 2066 2070 2071 2072 2074 2075 2078 2079 2080 2084 2086 2089 2091 2092 2093 2097 2100 "
},
{
"input": "100\n1 2 3 -72 6 4 5 6 7 8 9 10 11 -57 12 13 14 -37 74 15 16 17 3 18 19 20 21 22 -6 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 -24 39 40 41 42 43 44 45 -52 46 -65 47 -82 48 49 50 47 -28 51 52 53 54 55 -30 56 57 58 59 12 60 61 62 63 -14 64 65 66 67 -77 68 69 70 71 72 73 74 -4 -6 -75 75 -26 76 49 77 -86",
"output": "77\n2001 2002 2003 2006 2007 2008 2009 2010 2011 2012 2013 2015 2016 2017 2020 2021 2022 2024 2025 2026 2027 2028 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 2047 2048 2049 2050 2051 2052 2053 2055 2057 2059 2060 2061 2064 2065 2066 2067 2068 2070 2071 2072 2073 2075 2076 2077 2078 2080 2081 2082 2083 2085 2086 2087 2088 2089 2090 2091 2095 2097 2099 "
},
{
"input": "100\n10 5 -69 1 -79 -57 -80 87 -38 -54 -91 33 29 81 20 -58 -97 70 2 -13 71 57 -15 98 -18 100 34 -25 -39 75 100 -88 3 95 48 -92 -20 -13 5 4 -19 -99 4 -46 -35 12 -43 -30 -37 -51 77 90 -47 -87 3 -84 -62 -51 69 -38 74 -63 -5 5 6 7 -65 90 -33 -23 8 19 -69 -98 24 28 100 9 -90 -34 -69 72 -15 8 27 -80 6 33 62 -57 -4 10 40 81 -78 58 43 83 57 21",
"output": "10\n2004 2019 2033 2040 2064 2065 2066 2071 2078 2092 "
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "10\n2 3 1 3 3 2 1 2 1 2",
"output": "2\n2003 2006 "
},
{
"input": "15\n4 1 4 6 3 2 1 1 3 2 4 4 1 4 1",
"output": "4\n2002 2006 2009 2011 "
},
{
"input": "15\n3 3 3 2 2 2 1 1 1 2 2 2 4 4 4",
"output": "2\n2007 2010 "
},
{
"input": "15\n6 5 2 3 4 1 3 2 4 5 1 2 6 4 4",
"output": "2\n2006 2008 "
}
] | 1,524,487,676
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 156
| 7,065,600
|
_, values,i,years = int(input()),[int(i) for i in input().split(" ")],1,[]
if 1 in values:
years.append(values.index(1))
i=2
while i in values[years[-1]:]:
years.append(values[years[-1]:].index(i)+years[-1])
i+=1
print(len(years))
if len(years) !=0:
for year in years:
print(2001+year,end=" ")
print()
|
Title: Company Income Growth
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Petya works as a PR manager for a successful Berland company BerSoft. He needs to prepare a presentation on the company income growth since 2001 (the year of its founding) till now. Petya knows that in 2001 the company income amounted to *a*1 billion bourles, in 2002 — to *a*2 billion, ..., and in the current (2000<=+<=*n*)-th year — *a**n* billion bourles. On the base of the information Petya decided to show in his presentation the linear progress history which is in his opinion perfect. According to a graph Petya has already made, in the first year BerSoft company income must amount to 1 billion bourles, in the second year — 2 billion bourles etc., each following year the income increases by 1 billion bourles. Unfortunately, the real numbers are different from the perfect ones. Among the numbers *a**i* can even occur negative ones that are a sign of the company’s losses in some years. That is why Petya wants to ignore some data, in other words, cross some numbers *a**i* from the sequence and leave only some subsequence that has perfect growth.
Thus Petya has to choose a sequence of years *y*1, *y*2, ..., *y**k*,so that in the year *y*1 the company income amounted to 1 billion bourles, in the year *y*2 — 2 billion bourles etc., in accordance with the perfect growth dynamics. Help him to choose the longest such sequence.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). The next line contains *n* integers *a**i* (<=-<=100<=≤<=*a**i*<=≤<=100). The number *a**i* determines the income of BerSoft company in the (2000<=+<=*i*)-th year. The numbers in the line are separated by spaces.
Output Specification:
Output *k* — the maximum possible length of a perfect sequence. In the next line output the sequence of years *y*1, *y*2, ..., *y**k*. Separate the numbers by spaces. If the answer is not unique, output any. If no solution exist, output one number 0.
Demo Input:
['10\n-2 1 1 3 2 3 4 -10 -2 5\n', '3\n-1 -2 -3\n']
Demo Output:
['5\n2002 2005 2006 2007 2010\n', '0\n']
Note:
none
|
```python
_, values,i,years = int(input()),[int(i) for i in input().split(" ")],1,[]
if 1 in values:
years.append(values.index(1))
i=2
while i in values[years[-1]:]:
years.append(values[years[-1]:].index(i)+years[-1])
i+=1
print(len(years))
if len(years) !=0:
for year in years:
print(2001+year,end=" ")
print()
```
| 3.908357
|
322
|
A
|
Ciel and Dancing
|
PROGRAMMING
| 1,000
|
[
"greedy"
] | null | null |
Fox Ciel and her friends are in a dancing room. There are *n* boys and *m* girls here, and they never danced before. There will be some songs, during each song, there must be exactly one boy and one girl are dancing. Besides, there is a special rule:
- either the boy in the dancing pair must dance for the first time (so, he didn't dance with anyone before); - or the girl in the dancing pair must dance for the first time.
Help Fox Ciel to make a schedule that they can dance as many songs as possible.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of boys and girls in the dancing room.
|
In the first line print *k* — the number of songs during which they can dance. Then in the following *k* lines, print the indexes of boys and girls dancing during songs chronologically. You can assume that the boys are indexed from 1 to *n*, and the girls are indexed from 1 to *m*.
|
[
"2 1\n",
"2 2\n"
] |
[
"2\n1 1\n2 1\n",
"3\n1 1\n1 2\n2 2\n"
] |
In test case 1, there are 2 boys and 1 girl. We can have 2 dances: the 1st boy and 1st girl (during the first song), the 2nd boy and 1st girl (during the second song).
And in test case 2, we have 2 boys with 2 girls, the answer is 3.
| 500
|
[
{
"input": "2 1",
"output": "2\n1 1\n2 1"
},
{
"input": "2 2",
"output": "3\n1 1\n1 2\n2 2"
},
{
"input": "1 1",
"output": "1\n1 1"
},
{
"input": "2 3",
"output": "4\n1 1\n1 2\n1 3\n2 3"
},
{
"input": "4 4",
"output": "7\n1 1\n1 2\n1 3\n1 4\n4 4\n3 4\n2 4"
},
{
"input": "1 12",
"output": "12\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12"
},
{
"input": "12 1",
"output": "12\n1 1\n12 1\n11 1\n10 1\n9 1\n8 1\n7 1\n6 1\n5 1\n4 1\n3 1\n2 1"
},
{
"input": "100 100",
"output": "199\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "24 6",
"output": "29\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n24 6\n23 6\n22 6\n21 6\n20 6\n19 6\n18 6\n17 6\n16 6\n15 6\n14 6\n13 6\n12 6\n11 6\n10 6\n9 6\n8 6\n7 6\n6 6\n5 6\n4 6\n3 6\n2 6"
},
{
"input": "7 59",
"output": "65\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n7 59\n6 59\n5 59\n4 59\n3 59\n2 59"
},
{
"input": "26 75",
"output": "100\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n26 75\n25 75\n24 75\n23 75\n22 75\n21 75\n20 75\n19 75\n18 75\n17..."
},
{
"input": "32 87",
"output": "118\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "42 51",
"output": "92\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n42 51\n41 51\n40 51\n39 51\n38 51\n37 51\n36 51\n35 51\n34 51\n33 51\n32 51\n31 51\n30 51\n29 51\n28 51\n27 51\n26 51\n25 51\n24 51\n23 51\n22 51\n21 51\n20 51\n19 51\n18 51\n17 51\n16 51\n15 51\n14 51\n13 51\n..."
},
{
"input": "4 63",
"output": "66\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n4 63\n3 63\n2 63"
},
{
"input": "10 79",
"output": "88\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n10 79\n9 79\n8 79\n7 79\n6 79\n5 79\n4 79\n..."
},
{
"input": "20 95",
"output": "114\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "35 55",
"output": "89\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n35 55\n34 55\n33 55\n32 55\n31 55\n30 55\n29 55\n28 55\n27 55\n26 55\n25 55\n24 55\n23 55\n22 55\n21 55\n20 55\n19 55\n18 55\n17 55\n16 55\n15 55\n14 55\n13 55\n12 55\n11 55\n10 55\n9 55..."
},
{
"input": "45 71",
"output": "115\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n45 71\n44 71\n43 71\n42 71\n41 71\n40 71\n39 71\n38 71\n37 71\n36 71\n35 71\n34 71\n33 71..."
},
{
"input": "7 83",
"output": "89\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n7 83\n6 83\n5 83\n..."
},
{
"input": "32 100",
"output": "131\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "42 17",
"output": "58\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n42 17\n41 17\n40 17\n39 17\n38 17\n37 17\n36 17\n35 17\n34 17\n33 17\n32 17\n31 17\n30 17\n29 17\n28 17\n27 17\n26 17\n25 17\n24 17\n23 17\n22 17\n21 17\n20 17\n19 17\n18 17\n17 17\n16 17\n15 17\n14 17\n13 17\n12 17\n11 17\n10 17\n9 17\n8 17\n7 17\n6 17\n5 17\n4 17\n3 17\n2 17"
},
{
"input": "1 77",
"output": "77\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77"
},
{
"input": "19 93",
"output": "111\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "25 5",
"output": "29\n1 1\n1 2\n1 3\n1 4\n1 5\n25 5\n24 5\n23 5\n22 5\n21 5\n20 5\n19 5\n18 5\n17 5\n16 5\n15 5\n14 5\n13 5\n12 5\n11 5\n10 5\n9 5\n8 5\n7 5\n6 5\n5 5\n4 5\n3 5\n2 5"
},
{
"input": "35 21",
"output": "55\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n35 21\n34 21\n33 21\n32 21\n31 21\n30 21\n29 21\n28 21\n27 21\n26 21\n25 21\n24 21\n23 21\n22 21\n21 21\n20 21\n19 21\n18 21\n17 21\n16 21\n15 21\n14 21\n13 21\n12 21\n11 21\n10 21\n9 21\n8 21\n7 21\n6 21\n5 21\n4 21\n3 21\n2 21"
},
{
"input": "99 99",
"output": "197\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "99 100",
"output": "198\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "100 99",
"output": "198\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
}
] | 1,626,766,833
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 28
| 248
| 20,172,800
|
b,g=map(int,input().split());g-=1
print(b+g)
for i in range(1,b+1):print(i,1)
for i in range(2,g+2):print(b,i)
|
Title: Ciel and Dancing
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Fox Ciel and her friends are in a dancing room. There are *n* boys and *m* girls here, and they never danced before. There will be some songs, during each song, there must be exactly one boy and one girl are dancing. Besides, there is a special rule:
- either the boy in the dancing pair must dance for the first time (so, he didn't dance with anyone before); - or the girl in the dancing pair must dance for the first time.
Help Fox Ciel to make a schedule that they can dance as many songs as possible.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of boys and girls in the dancing room.
Output Specification:
In the first line print *k* — the number of songs during which they can dance. Then in the following *k* lines, print the indexes of boys and girls dancing during songs chronologically. You can assume that the boys are indexed from 1 to *n*, and the girls are indexed from 1 to *m*.
Demo Input:
['2 1\n', '2 2\n']
Demo Output:
['2\n1 1\n2 1\n', '3\n1 1\n1 2\n2 2\n']
Note:
In test case 1, there are 2 boys and 1 girl. We can have 2 dances: the 1st boy and 1st girl (during the first song), the 2nd boy and 1st girl (during the second song).
And in test case 2, we have 2 boys with 2 girls, the answer is 3.
|
```python
b,g=map(int,input().split());g-=1
print(b+g)
for i in range(1,b+1):print(i,1)
for i in range(2,g+2):print(b,i)
```
| 3
|
|
961
|
A
|
Tetris
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
You are given a following process.
There is a platform with $n$ columns. $1 \times 1$ squares are appearing one after another in some columns on this platform. If there are no squares in the column, a square will occupy the bottom row. Otherwise a square will appear at the top of the highest square of this column.
When all of the $n$ columns have at least one square in them, the bottom row is being removed. You will receive $1$ point for this, and all the squares left will fall down one row.
You task is to calculate the amount of points you will receive.
|
The first line of input contain 2 integer numbers $n$ and $m$ ($1 \le n, m \le 1000$) — the length of the platform and the number of the squares.
The next line contain $m$ integer numbers $c_1, c_2, \dots, c_m$ ($1 \le c_i \le n$) — column in which $i$-th square will appear.
|
Print one integer — the amount of points you will receive.
|
[
"3 9\n1 1 2 2 2 3 1 2 3\n"
] |
[
"2\n"
] |
In the sample case the answer will be equal to $2$ because after the appearing of $6$-th square will be removed one row (counts of the squares on the platform will look like $[2~ 3~ 1]$, and after removing one row will be $[1~ 2~ 0]$).
After the appearing of $9$-th square counts will be $[2~ 3~ 1]$, and after removing one row it will look like $[1~ 2~ 0]$.
So the answer will be equal to $2$.
| 0
|
[
{
"input": "3 9\n1 1 2 2 2 3 1 2 3",
"output": "2"
},
{
"input": "1 7\n1 1 1 1 1 1 1",
"output": "7"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "3 5\n1 1 1 2 3",
"output": "1"
},
{
"input": "4 6\n4 4 4 4 4 4",
"output": "0"
},
{
"input": "4 6\n2 3 4 4 4 4",
"output": "0"
},
{
"input": "3 12\n1 1 1 1 2 2 2 2 3 3 3 3",
"output": "4"
},
{
"input": "8 8\n2 2 3 4 5 6 7 8",
"output": "0"
},
{
"input": "100 1\n50",
"output": "0"
},
{
"input": "2 1\n2",
"output": "0"
},
{
"input": "2 1\n1",
"output": "0"
},
{
"input": "2 4\n1 2 1 1",
"output": "1"
},
{
"input": "3 4\n3 2 2 2",
"output": "0"
},
{
"input": "2 2\n2 2",
"output": "0"
},
{
"input": "2 5\n2 1 1 2 1",
"output": "2"
},
{
"input": "15 3\n13 14 15",
"output": "0"
},
{
"input": "4 9\n1 2 3 1 2 3 1 2 3",
"output": "0"
},
{
"input": "100 3\n1 2 3",
"output": "0"
},
{
"input": "1000 10\n999 999 998 34 454 546 343 35 34 1000",
"output": "0"
},
{
"input": "4 2\n1 2",
"output": "0"
}
] | 1,637,379,064
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 46
| 0
|
n,m=[int(x) for x in input().split()]
a=[int(x) for x in input().split()]
lst=[0]*(n+1)
for i in a:
lst[i]+=1
res=max(lst)
for i in range(1,n+1):
if lst[i]<res:
res=lst[i]
print(res)
|
Title: Tetris
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a following process.
There is a platform with $n$ columns. $1 \times 1$ squares are appearing one after another in some columns on this platform. If there are no squares in the column, a square will occupy the bottom row. Otherwise a square will appear at the top of the highest square of this column.
When all of the $n$ columns have at least one square in them, the bottom row is being removed. You will receive $1$ point for this, and all the squares left will fall down one row.
You task is to calculate the amount of points you will receive.
Input Specification:
The first line of input contain 2 integer numbers $n$ and $m$ ($1 \le n, m \le 1000$) — the length of the platform and the number of the squares.
The next line contain $m$ integer numbers $c_1, c_2, \dots, c_m$ ($1 \le c_i \le n$) — column in which $i$-th square will appear.
Output Specification:
Print one integer — the amount of points you will receive.
Demo Input:
['3 9\n1 1 2 2 2 3 1 2 3\n']
Demo Output:
['2\n']
Note:
In the sample case the answer will be equal to $2$ because after the appearing of $6$-th square will be removed one row (counts of the squares on the platform will look like $[2~ 3~ 1]$, and after removing one row will be $[1~ 2~ 0]$).
After the appearing of $9$-th square counts will be $[2~ 3~ 1]$, and after removing one row it will look like $[1~ 2~ 0]$.
So the answer will be equal to $2$.
|
```python
n,m=[int(x) for x in input().split()]
a=[int(x) for x in input().split()]
lst=[0]*(n+1)
for i in a:
lst[i]+=1
res=max(lst)
for i in range(1,n+1):
if lst[i]<res:
res=lst[i]
print(res)
```
| 3
|
|
492
|
B
|
Vanya and Lanterns
|
PROGRAMMING
| 1,200
|
[
"binary search",
"implementation",
"math",
"sortings"
] | null | null |
Vanya walks late at night along a straight street of length *l*, lit by *n* lanterns. Consider the coordinate system with the beginning of the street corresponding to the point 0, and its end corresponding to the point *l*. Then the *i*-th lantern is at the point *a**i*. The lantern lights all points of the street that are at the distance of at most *d* from it, where *d* is some positive number, common for all lanterns.
Vanya wonders: what is the minimum light radius *d* should the lanterns have to light the whole street?
|
The first line contains two integers *n*, *l* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*l*<=≤<=109) — the number of lanterns and the length of the street respectively.
The next line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=*l*). Multiple lanterns can be located at the same point. The lanterns may be located at the ends of the street.
|
Print the minimum light radius *d*, needed to light the whole street. The answer will be considered correct if its absolute or relative error doesn't exceed 10<=-<=9.
|
[
"7 15\n15 5 3 7 9 14 0\n",
"2 5\n2 5\n"
] |
[
"2.5000000000\n",
"2.0000000000\n"
] |
Consider the second sample. At *d* = 2 the first lantern will light the segment [0, 4] of the street, and the second lantern will light segment [3, 5]. Thus, the whole street will be lit.
| 1,000
|
[
{
"input": "7 15\n15 5 3 7 9 14 0",
"output": "2.5000000000"
},
{
"input": "2 5\n2 5",
"output": "2.0000000000"
},
{
"input": "46 615683844\n431749087 271781274 274974690 324606253 480870261 401650581 13285442 478090364 266585394 425024433 588791449 492057200 391293435 563090494 317950 173675329 473068378 356306865 311731938 192959832 321180686 141984626 578985584 512026637 175885185 590844074 47103801 212211134 330150 509886963 565955809 315640375 612907074 500474373 524310737 568681652 315339618 478782781 518873818 271322031 74600969 539099112 85129347 222068995 106014720 77282307",
"output": "22258199.5000000000"
},
{
"input": "2 1000000000\n0 1000000000",
"output": "500000000.0000000000"
},
{
"input": "2 555\n200 300",
"output": "255.0000000000"
},
{
"input": "1 1\n1",
"output": "1.0000000000"
},
{
"input": "1 1\n0",
"output": "1.0000000000"
},
{
"input": "1 1000000000\n0",
"output": "1000000000.0000000000"
},
{
"input": "1 1000000000\n1000000000",
"output": "1000000000.0000000000"
},
{
"input": "1 999999999\n499999999",
"output": "500000000.0000000000"
},
{
"input": "4 700\n0 250 475 700",
"output": "125.0000000000"
},
{
"input": "4 700\n0 225 450 700",
"output": "125.0000000000"
},
{
"input": "5 1000\n0 250 500 750 1000",
"output": "125.0000000000"
},
{
"input": "5 2000\n1001 1001 1001 1001 1001",
"output": "1001.0000000000"
},
{
"input": "1 999\n501",
"output": "501.0000000000"
},
{
"input": "2 1000\n400 600",
"output": "400.0000000000"
},
{
"input": "4 15\n1 3 9 11",
"output": "4.0000000000"
},
{
"input": "1 5\n2",
"output": "3.0000000000"
}
] | 1,695,110,074
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 46
| 0
|
n,l = map(int,input().split())
l1 = list(map(int,input().split()))
l1.sort()
diff = 0
for i in range(n-1):
a = float( (l1[i+1] - l1[i])/2 )
diff = max(a ,diff)
diff = max((l-l1[-1]) , diff , l1[0] - 0)
diff= float(diff)
format(diff, '.6f')
print(diff)
|
Title: Vanya and Lanterns
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya walks late at night along a straight street of length *l*, lit by *n* lanterns. Consider the coordinate system with the beginning of the street corresponding to the point 0, and its end corresponding to the point *l*. Then the *i*-th lantern is at the point *a**i*. The lantern lights all points of the street that are at the distance of at most *d* from it, where *d* is some positive number, common for all lanterns.
Vanya wonders: what is the minimum light radius *d* should the lanterns have to light the whole street?
Input Specification:
The first line contains two integers *n*, *l* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*l*<=≤<=109) — the number of lanterns and the length of the street respectively.
The next line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=*l*). Multiple lanterns can be located at the same point. The lanterns may be located at the ends of the street.
Output Specification:
Print the minimum light radius *d*, needed to light the whole street. The answer will be considered correct if its absolute or relative error doesn't exceed 10<=-<=9.
Demo Input:
['7 15\n15 5 3 7 9 14 0\n', '2 5\n2 5\n']
Demo Output:
['2.5000000000\n', '2.0000000000\n']
Note:
Consider the second sample. At *d* = 2 the first lantern will light the segment [0, 4] of the street, and the second lantern will light segment [3, 5]. Thus, the whole street will be lit.
|
```python
n,l = map(int,input().split())
l1 = list(map(int,input().split()))
l1.sort()
diff = 0
for i in range(n-1):
a = float( (l1[i+1] - l1[i])/2 )
diff = max(a ,diff)
diff = max((l-l1[-1]) , diff , l1[0] - 0)
diff= float(diff)
format(diff, '.6f')
print(diff)
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,652,193,909
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 92
| 0
|
word = str(input())
upperCount = 0
lowerCount = 0
for item in word:
if item.isupper() == True:
upperCount += 1
else:
lowerCount += 1
if lowerCount >= upperCount:
print(word.lower())
else:
print(word.upper())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
word = str(input())
upperCount = 0
lowerCount = 0
for item in word:
if item.isupper() == True:
upperCount += 1
else:
lowerCount += 1
if lowerCount >= upperCount:
print(word.lower())
else:
print(word.upper())
```
| 3.977
|
743
|
C
|
Vladik and fractions
|
PROGRAMMING
| 1,500
|
[
"brute force",
"constructive algorithms",
"math",
"number theory"
] | null | null |
Vladik and Chloe decided to determine who of them is better at math. Vladik claimed that for any positive integer *n* he can represent fraction as a sum of three distinct positive fractions in form .
Help Vladik with that, i.e for a given *n* find three distinct positive integers *x*, *y* and *z* such that . Because Chloe can't check Vladik's answer if the numbers are large, he asks you to print numbers not exceeding 109.
If there is no such answer, print -1.
|
The single line contains single integer *n* (1<=≤<=*n*<=≤<=104).
|
If the answer exists, print 3 distinct numbers *x*, *y* and *z* (1<=≤<=*x*,<=*y*,<=*z*<=≤<=109, *x*<=≠<=*y*, *x*<=≠<=*z*, *y*<=≠<=*z*). Otherwise print -1.
If there are multiple answers, print any of them.
|
[
"3\n",
"7\n"
] |
[
"2 7 42\n",
"7 8 56\n"
] |
none
| 1,250
|
[
{
"input": "3",
"output": "2 7 42"
},
{
"input": "7",
"output": "7 8 56"
},
{
"input": "2",
"output": "2 3 6"
},
{
"input": "5",
"output": "5 6 30"
},
{
"input": "4",
"output": "4 5 20"
},
{
"input": "7",
"output": "7 8 56"
},
{
"input": "82",
"output": "82 83 6806"
},
{
"input": "56",
"output": "56 57 3192"
},
{
"input": "30",
"output": "30 31 930"
},
{
"input": "79",
"output": "79 80 6320"
},
{
"input": "28",
"output": "28 29 812"
},
{
"input": "4116",
"output": "4116 4117 16945572"
},
{
"input": "1",
"output": "-1"
},
{
"input": "6491",
"output": "6491 6492 42139572"
},
{
"input": "8865",
"output": "8865 8866 78597090"
},
{
"input": "1239",
"output": "1239 1240 1536360"
},
{
"input": "3614",
"output": "3614 3615 13064610"
},
{
"input": "5988",
"output": "5988 5989 35862132"
},
{
"input": "8363",
"output": "8363 8364 69948132"
},
{
"input": "737",
"output": "737 738 543906"
},
{
"input": "3112",
"output": "3112 3113 9687656"
},
{
"input": "9562",
"output": "9562 9563 91441406"
},
{
"input": "1936",
"output": "1936 1937 3750032"
},
{
"input": "4311",
"output": "4311 4312 18589032"
},
{
"input": "6685",
"output": "6685 6686 44695910"
},
{
"input": "9060",
"output": "9060 9061 82092660"
},
{
"input": "1434",
"output": "1434 1435 2057790"
},
{
"input": "3809",
"output": "3809 3810 14512290"
},
{
"input": "6183",
"output": "6183 6184 38235672"
},
{
"input": "8558",
"output": "8558 8559 73247922"
},
{
"input": "932",
"output": "932 933 869556"
},
{
"input": "7274",
"output": "7274 7275 52918350"
},
{
"input": "9648",
"output": "9648 9649 93093552"
},
{
"input": "2023",
"output": "2023 2024 4094552"
},
{
"input": "4397",
"output": "4397 4398 19338006"
},
{
"input": "6772",
"output": "6772 6773 45866756"
},
{
"input": "9146",
"output": "9146 9147 83658462"
},
{
"input": "1521",
"output": "1521 1522 2314962"
},
{
"input": "4938",
"output": "4938 4939 24388782"
},
{
"input": "6143",
"output": "6143 6144 37742592"
},
{
"input": "6230",
"output": "6230 6231 38819130"
},
{
"input": "10000",
"output": "10000 10001 100010000"
},
{
"input": "1",
"output": "-1"
},
{
"input": "101",
"output": "101 102 10302"
},
{
"input": "9999",
"output": "9999 10000 99990000"
},
{
"input": "512",
"output": "512 513 262656"
},
{
"input": "511",
"output": "511 512 261632"
},
{
"input": "513",
"output": "513 514 263682"
},
{
"input": "9973",
"output": "9973 9974 99470702"
},
{
"input": "9972",
"output": "9972 9973 99450756"
},
{
"input": "9974",
"output": "9974 9975 99490650"
},
{
"input": "9409",
"output": "9409 9410 88538690"
},
{
"input": "9408",
"output": "9408 9409 88519872"
},
{
"input": "9410",
"output": "9410 9411 88557510"
},
{
"input": "719",
"output": "719 720 517680"
},
{
"input": "720",
"output": "720 721 519120"
},
{
"input": "721",
"output": "721 722 520562"
},
{
"input": "9796",
"output": "9796 9797 95971412"
},
{
"input": "9797",
"output": "9797 9798 95991006"
},
{
"input": "9798",
"output": "9798 9799 96010602"
},
{
"input": "4999",
"output": "4999 5000 24995000"
},
{
"input": "9998",
"output": "9998 9999 99970002"
}
] | 1,626,499,105
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 62
| 109
| 20,172,800
|
# link: https://codeforces.com/problemset/problem/743/C
for _ in range(1):
n = int(input())
ans = -1
if n != 1:
a = n
b = n + 1
c = b * a
if a!=b and b!=c and a!=c:
print(a,b,c)
else: print(ans)
else:
print(ans)
|
Title: Vladik and fractions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vladik and Chloe decided to determine who of them is better at math. Vladik claimed that for any positive integer *n* he can represent fraction as a sum of three distinct positive fractions in form .
Help Vladik with that, i.e for a given *n* find three distinct positive integers *x*, *y* and *z* such that . Because Chloe can't check Vladik's answer if the numbers are large, he asks you to print numbers not exceeding 109.
If there is no such answer, print -1.
Input Specification:
The single line contains single integer *n* (1<=≤<=*n*<=≤<=104).
Output Specification:
If the answer exists, print 3 distinct numbers *x*, *y* and *z* (1<=≤<=*x*,<=*y*,<=*z*<=≤<=109, *x*<=≠<=*y*, *x*<=≠<=*z*, *y*<=≠<=*z*). Otherwise print -1.
If there are multiple answers, print any of them.
Demo Input:
['3\n', '7\n']
Demo Output:
['2 7 42\n', '7 8 56\n']
Note:
none
|
```python
# link: https://codeforces.com/problemset/problem/743/C
for _ in range(1):
n = int(input())
ans = -1
if n != 1:
a = n
b = n + 1
c = b * a
if a!=b and b!=c and a!=c:
print(a,b,c)
else: print(ans)
else:
print(ans)
```
| 3
|
|
602
|
B
|
Approximating a Constant Range
|
PROGRAMMING
| 1,400
|
[
"dp",
"implementation",
"two pointers"
] | null | null |
When Xellos was doing a practice course in university, he once had to measure the intensity of an effect that slowly approached equilibrium. A good way to determine the equilibrium intensity would be choosing a sufficiently large number of consecutive data points that seems as constant as possible and taking their average. Of course, with the usual sizes of data, it's nothing challenging — but why not make a similar programming contest problem while we're at it?
You're given a sequence of *n* data points *a*1,<=...,<=*a**n*. There aren't any big jumps between consecutive data points — for each 1<=≤<=*i*<=<<=*n*, it's guaranteed that |*a**i*<=+<=1<=-<=*a**i*|<=≤<=1.
A range [*l*,<=*r*] of data points is said to be almost constant if the difference between the largest and the smallest value in that range is at most 1. Formally, let *M* be the maximum and *m* the minimum value of *a**i* for *l*<=≤<=*i*<=≤<=*r*; the range [*l*,<=*r*] is almost constant if *M*<=-<=*m*<=≤<=1.
Find the length of the longest almost constant range.
|
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of data points.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100<=000).
|
Print a single number — the maximum length of an almost constant range of the given sequence.
|
[
"5\n1 2 3 3 2\n",
"11\n5 4 5 5 6 7 8 8 8 7 6\n"
] |
[
"4\n",
"5\n"
] |
In the first sample, the longest almost constant range is [2, 5]; its length (the number of data points in it) is 4.
In the second sample, there are three almost constant ranges of length 4: [1, 4], [6, 9] and [7, 10]; the only almost constant range of the maximum length 5 is [6, 10].
| 1,000
|
[
{
"input": "5\n1 2 3 3 2",
"output": "4"
},
{
"input": "11\n5 4 5 5 6 7 8 8 8 7 6",
"output": "5"
},
{
"input": "2\n3 2",
"output": "2"
},
{
"input": "4\n1001 1000 1000 1001",
"output": "4"
},
{
"input": "4\n1 1 2 3",
"output": "3"
},
{
"input": "3\n1 2 1",
"output": "3"
},
{
"input": "3\n1 2 3",
"output": "2"
},
{
"input": "18\n10 9 8 7 6 5 4 3 2 1 2 3 4 5 6 7 8 9",
"output": "3"
},
{
"input": "3\n1 2 2",
"output": "3"
},
{
"input": "4\n10 9 10 9",
"output": "4"
},
{
"input": "4\n4 3 2 3",
"output": "3"
},
{
"input": "4\n8 8 7 7",
"output": "4"
},
{
"input": "3\n99998 99999 100000",
"output": "2"
},
{
"input": "3\n100000 99999 99998",
"output": "2"
},
{
"input": "3\n1 1 1",
"output": "3"
},
{
"input": "2\n99999 100000",
"output": "2"
},
{
"input": "2\n100000 100000",
"output": "2"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "15\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000",
"output": "15"
}
] | 1,687,142,678
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 107
| 156
| 13,619,200
|
if __name__ == "__main__":
n = int(input())
a = list(map(int, input().split()))
cnt, l, ans = {}, 0, 0
for r, v in enumerate(a):
if v in cnt:
cnt[v] += 1
else:
cnt[v] = 1
while len(cnt) > 2:
cnt[a[l]] -= 1
if cnt[a[l]] == 0:
cnt.pop(a[l])
l += 1
ans = max(ans, r - l + 1)
print(ans)
|
Title: Approximating a Constant Range
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
When Xellos was doing a practice course in university, he once had to measure the intensity of an effect that slowly approached equilibrium. A good way to determine the equilibrium intensity would be choosing a sufficiently large number of consecutive data points that seems as constant as possible and taking their average. Of course, with the usual sizes of data, it's nothing challenging — but why not make a similar programming contest problem while we're at it?
You're given a sequence of *n* data points *a*1,<=...,<=*a**n*. There aren't any big jumps between consecutive data points — for each 1<=≤<=*i*<=<<=*n*, it's guaranteed that |*a**i*<=+<=1<=-<=*a**i*|<=≤<=1.
A range [*l*,<=*r*] of data points is said to be almost constant if the difference between the largest and the smallest value in that range is at most 1. Formally, let *M* be the maximum and *m* the minimum value of *a**i* for *l*<=≤<=*i*<=≤<=*r*; the range [*l*,<=*r*] is almost constant if *M*<=-<=*m*<=≤<=1.
Find the length of the longest almost constant range.
Input Specification:
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of data points.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100<=000).
Output Specification:
Print a single number — the maximum length of an almost constant range of the given sequence.
Demo Input:
['5\n1 2 3 3 2\n', '11\n5 4 5 5 6 7 8 8 8 7 6\n']
Demo Output:
['4\n', '5\n']
Note:
In the first sample, the longest almost constant range is [2, 5]; its length (the number of data points in it) is 4.
In the second sample, there are three almost constant ranges of length 4: [1, 4], [6, 9] and [7, 10]; the only almost constant range of the maximum length 5 is [6, 10].
|
```python
if __name__ == "__main__":
n = int(input())
a = list(map(int, input().split()))
cnt, l, ans = {}, 0, 0
for r, v in enumerate(a):
if v in cnt:
cnt[v] += 1
else:
cnt[v] = 1
while len(cnt) > 2:
cnt[a[l]] -= 1
if cnt[a[l]] == 0:
cnt.pop(a[l])
l += 1
ans = max(ans, r - l + 1)
print(ans)
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper.
To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes).
The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation.
|
The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits.
|
In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem.
|
[
"101\n",
"110010\n"
] |
[
"11\n",
"11010\n"
] |
In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>.
In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>.
| 0
|
[
{
"input": "101",
"output": "11"
},
{
"input": "110010",
"output": "11010"
},
{
"input": "10000",
"output": "1000"
},
{
"input": "1111111110",
"output": "111111111"
},
{
"input": "10100101011110101",
"output": "1100101011110101"
},
{
"input": "111010010111",
"output": "11110010111"
},
{
"input": "11110111011100000000",
"output": "1111111011100000000"
},
{
"input": "11110010010100001110110101110011110110100111101",
"output": "1111010010100001110110101110011110110100111101"
},
{
"input": "1001011111010010100111111",
"output": "101011111010010100111111"
},
{
"input": "1111111111",
"output": "111111111"
},
{
"input": "1111111111111111111100111101001110110111111000001111110101001101001110011000001011001111111000110101",
"output": "111111111111111111110111101001110110111111000001111110101001101001110011000001011001111111000110101"
},
{
"input": "11010110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100",
"output": "1110110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100"
},
{
"input": "11111111111111111111111110110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011",
"output": "1111111111111111111111111110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011"
},
{
"input": "11100010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011",
"output": "1110010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011"
},
{
"input": "11",
"output": "1"
},
{
"input": "111",
"output": "11"
},
{
"input": "111111",
"output": "11111"
},
{
"input": "11111",
"output": "1111"
},
{
"input": "1111",
"output": "111"
}
] | 1,517,258,487
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 404
| 6,246,400
|
from sys import stdin, stdout
n = str(stdin.readline().strip())
ok = True
i = 1
for x in n:
if ok and i == len(n):
continue
if x == '0' and ok:
ok = False
continue
else:
stdout.write(x)
i = i + 1
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper.
To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes).
The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation.
Input Specification:
The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits.
Output Specification:
In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem.
Demo Input:
['101\n', '110010\n']
Demo Output:
['11\n', '11010\n']
Note:
In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>.
In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>.
|
```python
from sys import stdin, stdout
n = str(stdin.readline().strip())
ok = True
i = 1
for x in n:
if ok and i == len(n):
continue
if x == '0' and ok:
ok = False
continue
else:
stdout.write(x)
i = i + 1
```
| 3
|
|
222
|
A
|
Shooshuns and Sequence
|
PROGRAMMING
| 1,200
|
[
"brute force",
"implementation"
] | null | null |
One day shooshuns found a sequence of *n* integers, written on a blackboard. The shooshuns can perform one operation with it, the operation consists of two steps:
1. Find the number that goes *k*-th in the current sequence and add the same number to the end of the sequence; 1. Delete the first number of the current sequence.
The shooshuns wonder after how many operations all numbers on the board will be the same and whether all numbers will ever be the same.
|
The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105).
The second line contains *n* space-separated integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105) — the sequence that the shooshuns found.
|
Print the minimum number of operations, required for all numbers on the blackboard to become the same. If it is impossible to achieve, print -1.
|
[
"3 2\n3 1 1\n",
"3 1\n3 1 1\n"
] |
[
"1\n",
"-1\n"
] |
In the first test case after the first operation the blackboard will have sequence [1, 1, 1]. So, one operation is enough to make all numbers the same. Thus, the answer equals one.
In the second test case the sequence will never consist of the same numbers. It will always contain at least two distinct numbers 3 and 1. Thus, the answer equals -1.
| 500
|
[
{
"input": "3 2\n3 1 1",
"output": "1"
},
{
"input": "3 1\n3 1 1",
"output": "-1"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "2 1\n1 1",
"output": "0"
},
{
"input": "2 1\n2 1",
"output": "-1"
},
{
"input": "4 4\n1 2 3 4",
"output": "3"
},
{
"input": "4 3\n1 2 3 4",
"output": "-1"
},
{
"input": "5 3\n2 1 1 1 1",
"output": "1"
},
{
"input": "5 3\n1 1 1 1 1",
"output": "0"
},
{
"input": "5 5\n1 1 1 1 1",
"output": "0"
},
{
"input": "10 1\n1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "10 1\n1 2 1 1 1 1 1 1 1 1",
"output": "-1"
},
{
"input": "10 1\n2 1 1 1 1 1 1 1 1 1",
"output": "-1"
},
{
"input": "10 2\n2 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "10 2\n1 2 1 1 1 1 1 1 1 1",
"output": "-1"
},
{
"input": "10 3\n3 2 1 1 1 1 1 1 1 1",
"output": "2"
},
{
"input": "10 1\n1 2 3 4 5 6 7 8 9 10",
"output": "-1"
},
{
"input": "10 10\n1 2 3 4 5 6 7 8 9 10",
"output": "9"
},
{
"input": "20 10\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1",
"output": "-1"
},
{
"input": "20 11\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1",
"output": "10"
},
{
"input": "20 9\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1",
"output": "-1"
},
{
"input": "20 10\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "20 20\n20 1 19 2 18 3 17 4 16 5 15 6 14 7 13 8 12 9 11 10",
"output": "19"
}
] | 1,452,434,612
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 47
| 342
| 7,372,800
|
n, k = map(int, input().split());
a = list(map(int, input().split()));
flag = 1
for i in range(k, n):
flag &= a[k - 1] == a[i];
if (flag == 0):
print(-1);
else:
cur = k - 1;
while (cur >= 0 and a[cur] == a[k - 1]):
cur -= 1;
print(cur + 1);
|
Title: Shooshuns and Sequence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day shooshuns found a sequence of *n* integers, written on a blackboard. The shooshuns can perform one operation with it, the operation consists of two steps:
1. Find the number that goes *k*-th in the current sequence and add the same number to the end of the sequence; 1. Delete the first number of the current sequence.
The shooshuns wonder after how many operations all numbers on the board will be the same and whether all numbers will ever be the same.
Input Specification:
The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105).
The second line contains *n* space-separated integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105) — the sequence that the shooshuns found.
Output Specification:
Print the minimum number of operations, required for all numbers on the blackboard to become the same. If it is impossible to achieve, print -1.
Demo Input:
['3 2\n3 1 1\n', '3 1\n3 1 1\n']
Demo Output:
['1\n', '-1\n']
Note:
In the first test case after the first operation the blackboard will have sequence [1, 1, 1]. So, one operation is enough to make all numbers the same. Thus, the answer equals one.
In the second test case the sequence will never consist of the same numbers. It will always contain at least two distinct numbers 3 and 1. Thus, the answer equals -1.
|
```python
n, k = map(int, input().split());
a = list(map(int, input().split()));
flag = 1
for i in range(k, n):
flag &= a[k - 1] == a[i];
if (flag == 0):
print(-1);
else:
cur = k - 1;
while (cur >= 0 and a[cur] == a[k - 1]):
cur -= 1;
print(cur + 1);
```
| 3
|
|
9
|
A
|
Die Roll
|
PROGRAMMING
| 800
|
[
"math",
"probabilities"
] |
A. Die Roll
|
1
|
64
|
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
|
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
|
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
|
[
"4 2\n"
] |
[
"1/2\n"
] |
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
| 0
|
[
{
"input": "4 2",
"output": "1/2"
},
{
"input": "1 1",
"output": "1/1"
},
{
"input": "1 2",
"output": "5/6"
},
{
"input": "1 3",
"output": "2/3"
},
{
"input": "1 4",
"output": "1/2"
},
{
"input": "1 5",
"output": "1/3"
},
{
"input": "1 6",
"output": "1/6"
},
{
"input": "2 1",
"output": "5/6"
},
{
"input": "2 2",
"output": "5/6"
},
{
"input": "2 3",
"output": "2/3"
},
{
"input": "2 4",
"output": "1/2"
},
{
"input": "2 5",
"output": "1/3"
},
{
"input": "2 6",
"output": "1/6"
},
{
"input": "3 1",
"output": "2/3"
},
{
"input": "3 2",
"output": "2/3"
},
{
"input": "3 3",
"output": "2/3"
},
{
"input": "3 4",
"output": "1/2"
},
{
"input": "3 5",
"output": "1/3"
},
{
"input": "3 6",
"output": "1/6"
},
{
"input": "4 1",
"output": "1/2"
},
{
"input": "4 3",
"output": "1/2"
},
{
"input": "4 4",
"output": "1/2"
},
{
"input": "4 5",
"output": "1/3"
},
{
"input": "4 6",
"output": "1/6"
},
{
"input": "5 1",
"output": "1/3"
},
{
"input": "5 2",
"output": "1/3"
},
{
"input": "5 3",
"output": "1/3"
},
{
"input": "5 4",
"output": "1/3"
},
{
"input": "5 5",
"output": "1/3"
},
{
"input": "5 6",
"output": "1/6"
},
{
"input": "6 1",
"output": "1/6"
},
{
"input": "6 2",
"output": "1/6"
},
{
"input": "6 3",
"output": "1/6"
},
{
"input": "6 4",
"output": "1/6"
},
{
"input": "6 5",
"output": "1/6"
},
{
"input": "6 6",
"output": "1/6"
}
] | 1,538,596,131
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 248
| 0
|
lis = ['1/6', '1/3', '1/2', '2/3', '5/6', '1/1']
input = input()
input = input.split()
Y = int(input[0])
W = int(input[1])
print(lis[6-(max(Y,W))])
|
Title: Die Roll
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
Input Specification:
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output Specification:
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
Demo Input:
['4 2\n']
Demo Output:
['1/2\n']
Note:
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
|
```python
lis = ['1/6', '1/3', '1/2', '2/3', '5/6', '1/1']
input = input()
input = input.split()
Y = int(input[0])
W = int(input[1])
print(lis[6-(max(Y,W))])
```
| 3.876
|
807
|
A
|
Is it rated?
|
PROGRAMMING
| 900
|
[
"implementation",
"sortings"
] | null | null |
Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not.
|
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings.
|
If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe".
|
[
"6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n",
"4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n",
"5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n"
] |
[
"rated\n",
"unrated\n",
"maybe\n"
] |
In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not.
| 500
|
[
{
"input": "6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884",
"output": "rated"
},
{
"input": "4\n1500 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n1 1\n1 1",
"output": "maybe"
},
{
"input": "2\n4126 4126\n4126 4126",
"output": "maybe"
},
{
"input": "10\n446 446\n1331 1331\n3594 3594\n1346 1902\n91 91\n3590 3590\n2437 2437\n4007 3871\n2797 699\n1423 1423",
"output": "rated"
},
{
"input": "10\n4078 4078\n2876 2876\n1061 1061\n3721 3721\n143 143\n2992 2992\n3279 3279\n3389 3389\n1702 1702\n1110 1110",
"output": "unrated"
},
{
"input": "10\n4078 4078\n3721 3721\n3389 3389\n3279 3279\n2992 2992\n2876 2876\n1702 1702\n1110 1110\n1061 1061\n143 143",
"output": "maybe"
},
{
"input": "2\n3936 3936\n2967 2967",
"output": "maybe"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 1\n1 2",
"output": "rated"
},
{
"input": "2\n2967 2967\n3936 3936",
"output": "unrated"
},
{
"input": "3\n1200 1200\n1200 1200\n1300 1300",
"output": "unrated"
},
{
"input": "3\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "3\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n3 2\n3 2",
"output": "rated"
},
{
"input": "3\n5 5\n4 4\n3 4",
"output": "rated"
},
{
"input": "3\n200 200\n200 200\n300 300",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n3 3",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2245 2245\n1699 1699",
"output": "maybe"
},
{
"input": "2\n10 10\n8 8",
"output": "maybe"
},
{
"input": "3\n1500 1500\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n100 100\n100 100\n70 70\n80 80",
"output": "unrated"
},
{
"input": "2\n1 2\n2 1",
"output": "rated"
},
{
"input": "3\n5 5\n4 3\n3 3",
"output": "rated"
},
{
"input": "3\n1600 1650\n1500 1550\n1400 1450",
"output": "rated"
},
{
"input": "4\n2000 2000\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n1500 1500\n1400 1400\n1400 1400\n1700 1700",
"output": "unrated"
},
{
"input": "2\n1600 1600\n1400 1400",
"output": "maybe"
},
{
"input": "2\n3 1\n9 8",
"output": "rated"
},
{
"input": "2\n2 1\n1 1",
"output": "rated"
},
{
"input": "4\n4123 4123\n4123 4123\n2670 2670\n3670 3670",
"output": "unrated"
},
{
"input": "2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n10 11\n5 4",
"output": "rated"
},
{
"input": "2\n15 14\n13 12",
"output": "rated"
},
{
"input": "2\n2 1\n2 2",
"output": "rated"
},
{
"input": "3\n2670 2670\n3670 3670\n4106 4106",
"output": "unrated"
},
{
"input": "3\n4 5\n3 3\n2 2",
"output": "rated"
},
{
"input": "2\n10 9\n10 10",
"output": "rated"
},
{
"input": "3\n1011 1011\n1011 999\n2200 2100",
"output": "rated"
},
{
"input": "2\n3 3\n5 5",
"output": "unrated"
},
{
"input": "2\n1500 1500\n3000 2000",
"output": "rated"
},
{
"input": "2\n5 6\n5 5",
"output": "rated"
},
{
"input": "3\n2000 2000\n1500 1501\n500 500",
"output": "rated"
},
{
"input": "2\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n1 2\n1 1",
"output": "rated"
},
{
"input": "4\n3123 3123\n2777 2777\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n15 14\n14 13",
"output": "rated"
},
{
"input": "4\n3000 3000\n2900 2900\n3000 3000\n2900 2900",
"output": "unrated"
},
{
"input": "6\n30 3060\n24 2194\n26 2903\n24 2624\n37 2991\n24 2884",
"output": "rated"
},
{
"input": "2\n100 99\n100 100",
"output": "rated"
},
{
"input": "4\n2 2\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n100 101\n100 100\n100 100",
"output": "rated"
},
{
"input": "4\n1000 1001\n900 900\n950 950\n890 890",
"output": "rated"
},
{
"input": "2\n2 3\n1 1",
"output": "rated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n3 2\n2 2",
"output": "rated"
},
{
"input": "2\n3 2\n3 3",
"output": "rated"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n3 2\n3 3\n3 3",
"output": "rated"
},
{
"input": "4\n1500 1501\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "3\n1000 1000\n500 500\n400 300",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n3000 3000",
"output": "unrated"
},
{
"input": "2\n1 1\n2 3",
"output": "rated"
},
{
"input": "2\n6 2\n6 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n1699 1699\n2777 2777\n2246 2246\n2246 2246",
"output": "unrated"
},
{
"input": "2\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2241 2241\n1699 1699",
"output": "maybe"
},
{
"input": "2\n20 30\n10 5",
"output": "rated"
},
{
"input": "3\n1 1\n2 2\n1 1",
"output": "unrated"
},
{
"input": "2\n1 2\n3 3",
"output": "rated"
},
{
"input": "5\n5 5\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 2\n2 1",
"output": "rated"
},
{
"input": "2\n100 100\n90 89",
"output": "rated"
},
{
"input": "2\n1000 900\n2000 2000",
"output": "rated"
},
{
"input": "2\n50 10\n10 50",
"output": "rated"
},
{
"input": "2\n200 200\n100 100",
"output": "maybe"
},
{
"input": "3\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "3\n1000 1000\n300 300\n100 100",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n3 3\n4 4",
"output": "unrated"
},
{
"input": "2\n5 3\n6 3",
"output": "rated"
},
{
"input": "2\n1200 1100\n1200 1000",
"output": "rated"
},
{
"input": "2\n5 5\n4 4",
"output": "maybe"
},
{
"input": "2\n5 5\n3 3",
"output": "maybe"
},
{
"input": "5\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n1100 1100",
"output": "unrated"
},
{
"input": "5\n10 10\n9 9\n8 8\n7 7\n6 6",
"output": "maybe"
},
{
"input": "3\n1000 1000\n300 300\n10 10",
"output": "maybe"
},
{
"input": "5\n6 6\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n3 3\n1 1",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n1000 1000\n700 700",
"output": "maybe"
},
{
"input": "2\n4 3\n5 3",
"output": "rated"
},
{
"input": "2\n1000 1000\n1100 1100",
"output": "unrated"
},
{
"input": "4\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "3\n1 1\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n1 2\n1 3",
"output": "rated"
},
{
"input": "2\n3 3\n1 2",
"output": "rated"
},
{
"input": "4\n1501 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "5\n1 1\n2 2\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "2\n10 10\n1 2",
"output": "rated"
},
{
"input": "6\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n1900 1900",
"output": "unrated"
},
{
"input": "6\n3123 3123\n2777 2777\n3000 3000\n2246 2246\n2246 2246\n1699 1699",
"output": "unrated"
},
{
"input": "2\n100 100\n110 110",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n3 3\n3 2\n4 4",
"output": "rated"
},
{
"input": "3\n5 2\n4 4\n3 3",
"output": "rated"
},
{
"input": "4\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n1 1\n3 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n2699 2699",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n3 4",
"output": "rated"
},
{
"input": "3\n1 2\n2 2\n3 3",
"output": "rated"
},
{
"input": "3\n1 2\n1 2\n1 2",
"output": "rated"
},
{
"input": "2\n2 1\n2 1",
"output": "rated"
},
{
"input": "2\n1 2\n3 4",
"output": "rated"
},
{
"input": "2\n3 2\n2 3",
"output": "rated"
},
{
"input": "3\n1500 1500\n1600 1600\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1 1\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n2 2",
"output": "unrated"
},
{
"input": "2\n10 12\n8 8",
"output": "rated"
},
{
"input": "5\n1200 1200\n1500 1500\n1500 1500\n1500 1500\n1500 1500",
"output": "unrated"
},
{
"input": "2\n1 2\n2 2",
"output": "rated"
},
{
"input": "3\n1500 1400\n1200 1200\n1100 1100",
"output": "rated"
},
{
"input": "2\n10 12\n10 10",
"output": "rated"
},
{
"input": "3\n1500 1500\n1400 1400\n1300 1300",
"output": "maybe"
},
{
"input": "3\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "3\n2 6\n3 5\n4 4",
"output": "rated"
},
{
"input": "2\n5 6\n4 6",
"output": "rated"
},
{
"input": "4\n10 10\n10 10\n7 7\n8 8",
"output": "unrated"
},
{
"input": "2\n4 4\n3 3",
"output": "maybe"
}
] | 1,620,588,887
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 150
| 124
| 21,606,400
|
n = int(input())
after = []
for _ in range(n):
a, b = map(int, input().split())
if a != b: print('rated'); exit(0)
after.append(b)
if sorted(after)[::-1] == after:
print('maybe')
else:
print('unrated')
|
Title: Is it rated?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings.
Output Specification:
If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe".
Demo Input:
['6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n', '4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n', '5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n']
Demo Output:
['rated\n', 'unrated\n', 'maybe\n']
Note:
In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not.
|
```python
n = int(input())
after = []
for _ in range(n):
a, b = map(int, input().split())
if a != b: print('rated'); exit(0)
after.append(b)
if sorted(after)[::-1] == after:
print('maybe')
else:
print('unrated')
```
| 3
|
|
285
|
A
|
Slightly Decreasing Permutations
|
PROGRAMMING
| 1,100
|
[
"greedy",
"implementation"
] | null | null |
Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*.
The decreasing coefficient of permutation *p*1,<=*p*2,<=...,<=*p**n* is the number of such *i* (1<=≤<=*i*<=<<=*n*), that *p**i*<=><=*p**i*<=+<=1.
You have numbers *n* and *k*. Your task is to print the permutation of length *n* with decreasing coefficient *k*.
|
The single line contains two space-separated integers: *n*,<=*k* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*k*<=<<=*n*) — the permutation length and the decreasing coefficient.
|
In a single line print *n* space-separated integers: *p*1,<=*p*2,<=...,<=*p**n* — the permutation of length *n* with decreasing coefficient *k*.
If there are several permutations that meet this condition, print any of them. It is guaranteed that the permutation with the sought parameters exists.
|
[
"5 2\n",
"3 0\n",
"3 2\n"
] |
[
"1 5 2 4 3\n",
"1 2 3\n",
"3 2 1\n"
] |
none
| 500
|
[
{
"input": "5 2",
"output": "1 5 2 4 3"
},
{
"input": "3 0",
"output": "1 2 3"
},
{
"input": "3 2",
"output": "3 2 1"
},
{
"input": "1 0",
"output": "1"
},
{
"input": "2 0",
"output": "1 2"
},
{
"input": "2 1",
"output": "2 1"
},
{
"input": "10 4",
"output": "10 9 8 7 1 2 3 4 5 6"
},
{
"input": "56893 5084",
"output": "56893 56892 56891 56890 56889 56888 56887 56886 56885 56884 56883 56882 56881 56880 56879 56878 56877 56876 56875 56874 56873 56872 56871 56870 56869 56868 56867 56866 56865 56864 56863 56862 56861 56860 56859 56858 56857 56856 56855 56854 56853 56852 56851 56850 56849 56848 56847 56846 56845 56844 56843 56842 56841 56840 56839 56838 56837 56836 56835 56834 56833 56832 56831 56830 56829 56828 56827 56826 56825 56824 56823 56822 56821 56820 56819 56818 56817 56816 56815 56814 56813 56812 56811 56810 56809 5..."
},
{
"input": "6 3",
"output": "6 5 4 1 2 3"
},
{
"input": "1 0",
"output": "1"
},
{
"input": "310 186",
"output": "310 309 308 307 306 305 304 303 302 301 300 299 298 297 296 295 294 293 292 291 290 289 288 287 286 285 284 283 282 281 280 279 278 277 276 275 274 273 272 271 270 269 268 267 266 265 264 263 262 261 260 259 258 257 256 255 254 253 252 251 250 249 248 247 246 245 244 243 242 241 240 239 238 237 236 235 234 233 232 231 230 229 228 227 226 225 224 223 222 221 220 219 218 217 216 215 214 213 212 211 210 209 208 207 206 205 204 203 202 201 200 199 198 197 196 195 194 193 192 191 190 189 188 187 186 185 184 183..."
},
{
"input": "726 450",
"output": "726 725 724 723 722 721 720 719 718 717 716 715 714 713 712 711 710 709 708 707 706 705 704 703 702 701 700 699 698 697 696 695 694 693 692 691 690 689 688 687 686 685 684 683 682 681 680 679 678 677 676 675 674 673 672 671 670 669 668 667 666 665 664 663 662 661 660 659 658 657 656 655 654 653 652 651 650 649 648 647 646 645 644 643 642 641 640 639 638 637 636 635 634 633 632 631 630 629 628 627 626 625 624 623 622 621 620 619 618 617 616 615 614 613 612 611 610 609 608 607 606 605 604 603 602 601 600 599..."
},
{
"input": "438 418",
"output": "438 437 436 435 434 433 432 431 430 429 428 427 426 425 424 423 422 421 420 419 418 417 416 415 414 413 412 411 410 409 408 407 406 405 404 403 402 401 400 399 398 397 396 395 394 393 392 391 390 389 388 387 386 385 384 383 382 381 380 379 378 377 376 375 374 373 372 371 370 369 368 367 366 365 364 363 362 361 360 359 358 357 356 355 354 353 352 351 350 349 348 347 346 345 344 343 342 341 340 339 338 337 336 335 334 333 332 331 330 329 328 327 326 325 324 323 322 321 320 319 318 317 316 315 314 313 312 311..."
},
{
"input": "854 829",
"output": "854 853 852 851 850 849 848 847 846 845 844 843 842 841 840 839 838 837 836 835 834 833 832 831 830 829 828 827 826 825 824 823 822 821 820 819 818 817 816 815 814 813 812 811 810 809 808 807 806 805 804 803 802 801 800 799 798 797 796 795 794 793 792 791 790 789 788 787 786 785 784 783 782 781 780 779 778 777 776 775 774 773 772 771 770 769 768 767 766 765 764 763 762 761 760 759 758 757 756 755 754 753 752 751 750 749 748 747 746 745 744 743 742 741 740 739 738 737 736 735 734 733 732 731 730 729 728 727..."
},
{
"input": "214 167",
"output": "214 213 212 211 210 209 208 207 206 205 204 203 202 201 200 199 198 197 196 195 194 193 192 191 190 189 188 187 186 185 184 183 182 181 180 179 178 177 176 175 174 173 172 171 170 169 168 167 166 165 164 163 162 161 160 159 158 157 156 155 154 153 152 151 150 149 148 147 146 145 144 143 142 141 140 139 138 137 136 135 134 133 132 131 130 129 128 127 126 125 124 123 122 121 120 119 118 117 116 115 114 113 112 111 110 109 108 107 106 105 104 103 102 101 100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 ..."
},
{
"input": "85705 56268",
"output": "85705 85704 85703 85702 85701 85700 85699 85698 85697 85696 85695 85694 85693 85692 85691 85690 85689 85688 85687 85686 85685 85684 85683 85682 85681 85680 85679 85678 85677 85676 85675 85674 85673 85672 85671 85670 85669 85668 85667 85666 85665 85664 85663 85662 85661 85660 85659 85658 85657 85656 85655 85654 85653 85652 85651 85650 85649 85648 85647 85646 85645 85644 85643 85642 85641 85640 85639 85638 85637 85636 85635 85634 85633 85632 85631 85630 85629 85628 85627 85626 85625 85624 85623 85622 85621 8..."
},
{
"input": "11417 4583",
"output": "11417 11416 11415 11414 11413 11412 11411 11410 11409 11408 11407 11406 11405 11404 11403 11402 11401 11400 11399 11398 11397 11396 11395 11394 11393 11392 11391 11390 11389 11388 11387 11386 11385 11384 11383 11382 11381 11380 11379 11378 11377 11376 11375 11374 11373 11372 11371 11370 11369 11368 11367 11366 11365 11364 11363 11362 11361 11360 11359 11358 11357 11356 11355 11354 11353 11352 11351 11350 11349 11348 11347 11346 11345 11344 11343 11342 11341 11340 11339 11338 11337 11336 11335 11334 11333 1..."
},
{
"input": "53481 20593",
"output": "53481 53480 53479 53478 53477 53476 53475 53474 53473 53472 53471 53470 53469 53468 53467 53466 53465 53464 53463 53462 53461 53460 53459 53458 53457 53456 53455 53454 53453 53452 53451 53450 53449 53448 53447 53446 53445 53444 53443 53442 53441 53440 53439 53438 53437 53436 53435 53434 53433 53432 53431 53430 53429 53428 53427 53426 53425 53424 53423 53422 53421 53420 53419 53418 53417 53416 53415 53414 53413 53412 53411 53410 53409 53408 53407 53406 53405 53404 53403 53402 53401 53400 53399 53398 53397 5..."
},
{
"input": "79193 77281",
"output": "79193 79192 79191 79190 79189 79188 79187 79186 79185 79184 79183 79182 79181 79180 79179 79178 79177 79176 79175 79174 79173 79172 79171 79170 79169 79168 79167 79166 79165 79164 79163 79162 79161 79160 79159 79158 79157 79156 79155 79154 79153 79152 79151 79150 79149 79148 79147 79146 79145 79144 79143 79142 79141 79140 79139 79138 79137 79136 79135 79134 79133 79132 79131 79130 79129 79128 79127 79126 79125 79124 79123 79122 79121 79120 79119 79118 79117 79116 79115 79114 79113 79112 79111 79110 79109 7..."
},
{
"input": "42607 42144",
"output": "42607 42606 42605 42604 42603 42602 42601 42600 42599 42598 42597 42596 42595 42594 42593 42592 42591 42590 42589 42588 42587 42586 42585 42584 42583 42582 42581 42580 42579 42578 42577 42576 42575 42574 42573 42572 42571 42570 42569 42568 42567 42566 42565 42564 42563 42562 42561 42560 42559 42558 42557 42556 42555 42554 42553 42552 42551 42550 42549 42548 42547 42546 42545 42544 42543 42542 42541 42540 42539 42538 42537 42536 42535 42534 42533 42532 42531 42530 42529 42528 42527 42526 42525 42524 42523 4..."
},
{
"input": "100000 0",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "100000 99999",
"output": "100000 99999 99998 99997 99996 99995 99994 99993 99992 99991 99990 99989 99988 99987 99986 99985 99984 99983 99982 99981 99980 99979 99978 99977 99976 99975 99974 99973 99972 99971 99970 99969 99968 99967 99966 99965 99964 99963 99962 99961 99960 99959 99958 99957 99956 99955 99954 99953 99952 99951 99950 99949 99948 99947 99946 99945 99944 99943 99942 99941 99940 99939 99938 99937 99936 99935 99934 99933 99932 99931 99930 99929 99928 99927 99926 99925 99924 99923 99922 99921 99920 99919 99918 99917 99916 ..."
},
{
"input": "100000 53860",
"output": "100000 99999 99998 99997 99996 99995 99994 99993 99992 99991 99990 99989 99988 99987 99986 99985 99984 99983 99982 99981 99980 99979 99978 99977 99976 99975 99974 99973 99972 99971 99970 99969 99968 99967 99966 99965 99964 99963 99962 99961 99960 99959 99958 99957 99956 99955 99954 99953 99952 99951 99950 99949 99948 99947 99946 99945 99944 99943 99942 99941 99940 99939 99938 99937 99936 99935 99934 99933 99932 99931 99930 99929 99928 99927 99926 99925 99924 99923 99922 99921 99920 99919 99918 99917 99916 ..."
},
{
"input": "4 0",
"output": "1 2 3 4"
},
{
"input": "4 1",
"output": "4 1 2 3"
},
{
"input": "4 2",
"output": "4 3 1 2"
},
{
"input": "4 3",
"output": "4 3 2 1"
},
{
"input": "3 1",
"output": "3 1 2"
}
] | 1,496,441,366
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 28
| 218
| 7,475,200
|
(n, k) = map(int, input().split(' '))
nums = []
for i in range(0, k):
nums.append(n - i)
for i in range(1, n - k + 1):
nums.append(i)
print(' '.join(map(str, nums)))
|
Title: Slightly Decreasing Permutations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*.
The decreasing coefficient of permutation *p*1,<=*p*2,<=...,<=*p**n* is the number of such *i* (1<=≤<=*i*<=<<=*n*), that *p**i*<=><=*p**i*<=+<=1.
You have numbers *n* and *k*. Your task is to print the permutation of length *n* with decreasing coefficient *k*.
Input Specification:
The single line contains two space-separated integers: *n*,<=*k* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*k*<=<<=*n*) — the permutation length and the decreasing coefficient.
Output Specification:
In a single line print *n* space-separated integers: *p*1,<=*p*2,<=...,<=*p**n* — the permutation of length *n* with decreasing coefficient *k*.
If there are several permutations that meet this condition, print any of them. It is guaranteed that the permutation with the sought parameters exists.
Demo Input:
['5 2\n', '3 0\n', '3 2\n']
Demo Output:
['1 5 2 4 3\n', '1 2 3\n', '3 2 1\n']
Note:
none
|
```python
(n, k) = map(int, input().split(' '))
nums = []
for i in range(0, k):
nums.append(n - i)
for i in range(1, n - k + 1):
nums.append(i)
print(' '.join(map(str, nums)))
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,626,171,644
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 154
| 6,758,400
|
s=input()
lc=0
uc=0
for x in s:
if x.islower():
lc=lc+1
else:
uc=uc+1
if uc>lc:
s=s.upper()
else:
s=s.lower()
print(s)
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
s=input()
lc=0
uc=0
for x in s:
if x.islower():
lc=lc+1
else:
uc=uc+1
if uc>lc:
s=s.upper()
else:
s=s.lower()
print(s)
```
| 3.948911
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,642,690,916
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 46
| 0
|
s=input()
list1=['h','e','l','l','o','#']
c=0
x=list1[c]
res=''
for i in s:
if i==x:
res+=i
c+=1
x=list1[c]
if res=='hello':
break
if res=='hello':
print('YES')
else:
print('NO')
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
s=input()
list1=['h','e','l','l','o','#']
c=0
x=list1[c]
res=''
for i in s:
if i==x:
res+=i
c+=1
x=list1[c]
if res=='hello':
break
if res=='hello':
print('YES')
else:
print('NO')
```
| 3.977
|
157
|
B
|
Trace
|
PROGRAMMING
| 1,000
|
[
"geometry",
"sortings"
] | null | null |
One day, as Sherlock Holmes was tracking down one very important criminal, he found a wonderful painting on the wall. This wall could be represented as a plane. The painting had several concentric circles that divided the wall into several parts. Some parts were painted red and all the other were painted blue. Besides, any two neighboring parts were painted different colors, that is, the red and the blue color were alternating, i. e. followed one after the other. The outer area of the wall (the area that lied outside all circles) was painted blue. Help Sherlock Holmes determine the total area of red parts of the wall.
Let us remind you that two circles are called concentric if their centers coincide. Several circles are called concentric if any two of them are concentric.
|
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=100). The second line contains *n* space-separated integers *r**i* (1<=≤<=*r**i*<=≤<=1000) — the circles' radii. It is guaranteed that all circles are different.
|
Print the single real number — total area of the part of the wall that is painted red. The answer is accepted if absolute or relative error doesn't exceed 10<=-<=4.
|
[
"1\n1\n",
"3\n1 4 2\n"
] |
[
"3.1415926536\n",
"40.8407044967\n"
] |
In the first sample the picture is just one circle of radius 1. Inner part of the circle is painted red. The area of the red part equals π × 1<sup class="upper-index">2</sup> = π.
In the second sample there are three circles of radii 1, 4 and 2. Outside part of the second circle is painted blue. Part between the second and the third circles is painted red. Part between the first and the third is painted blue. And, finally, the inner part of the first circle is painted red. Overall there are two red parts: the ring between the second and the third circles and the inner part of the first circle. Total area of the red parts is equal (π × 4<sup class="upper-index">2</sup> - π × 2<sup class="upper-index">2</sup>) + π × 1<sup class="upper-index">2</sup> = π × 12 + π = 13π
| 1,000
|
[
{
"input": "1\n1",
"output": "3.1415926536"
},
{
"input": "3\n1 4 2",
"output": "40.8407044967"
},
{
"input": "4\n4 1 3 2",
"output": "31.4159265359"
},
{
"input": "4\n100 10 2 1",
"output": "31111.1920484997"
},
{
"input": "10\n10 9 8 7 6 5 4 3 2 1",
"output": "172.7875959474"
},
{
"input": "1\n1000",
"output": "3141592.6535897931"
},
{
"input": "8\n8 1 7 2 6 3 5 4",
"output": "113.0973355292"
},
{
"input": "100\n1000 999 998 997 996 995 994 993 992 991 990 989 988 987 986 985 984 983 982 981 980 979 978 977 976 975 974 973 972 971 970 969 968 967 966 965 964 963 962 961 960 959 958 957 956 955 954 953 952 951 950 949 948 947 946 945 944 943 942 941 940 939 938 937 936 935 934 933 932 931 930 929 928 927 926 925 924 923 922 921 920 919 918 917 916 915 914 913 912 911 910 909 908 907 906 905 904 903 902 901",
"output": "298608.3817237098"
},
{
"input": "6\n109 683 214 392 678 10",
"output": "397266.9574170437"
},
{
"input": "2\n151 400",
"output": "431023.3704798660"
},
{
"input": "6\n258 877 696 425 663 934",
"output": "823521.3902487604"
},
{
"input": "9\n635 707 108 234 52 180 910 203 782",
"output": "1100144.9065826489"
},
{
"input": "8\n885 879 891 428 522 176 135 983",
"output": "895488.9947571954"
},
{
"input": "3\n269 918 721",
"output": "1241695.6467754442"
},
{
"input": "7\n920 570 681 428 866 935 795",
"output": "1469640.1849419588"
},
{
"input": "2\n517 331",
"output": "495517.1260654109"
},
{
"input": "2\n457 898",
"output": "1877274.3981158488"
},
{
"input": "8\n872 704 973 612 183 274 739 253",
"output": "1780774.0965755312"
},
{
"input": "74\n652 446 173 457 760 847 670 25 196 775 998 279 656 809 883 148 969 884 792 502 641 800 663 938 362 339 545 608 107 184 834 666 149 458 864 72 199 658 618 987 126 723 806 643 689 958 626 904 944 415 427 498 628 331 636 261 281 276 478 220 513 595 510 384 354 561 469 462 799 449 747 109 903 456",
"output": "1510006.5089479341"
},
{
"input": "76\n986 504 673 158 87 332 124 218 714 235 212 122 878 370 938 81 686 323 386 348 410 468 875 107 50 960 82 834 234 663 651 422 794 633 294 771 945 607 146 913 950 858 297 88 882 725 247 872 645 749 799 987 115 394 380 382 971 429 593 426 652 353 351 233 868 598 889 116 71 376 916 464 414 976 138 903",
"output": "1528494.7817143100"
},
{
"input": "70\n12 347 748 962 514 686 192 159 990 4 10 788 602 542 946 215 523 727 799 717 955 796 529 465 897 103 181 515 495 153 710 179 747 145 16 585 943 998 923 708 156 399 770 547 775 285 9 68 713 722 570 143 913 416 663 624 925 218 64 237 797 138 942 213 188 818 780 840 480 758",
"output": "1741821.4892636713"
},
{
"input": "26\n656 508 45 189 561 366 96 486 547 386 703 570 780 689 264 26 11 74 466 76 421 48 982 886 215 650",
"output": "1818821.9252031571"
},
{
"input": "52\n270 658 808 249 293 707 700 78 791 167 92 772 807 502 830 991 945 102 968 376 556 578 326 980 688 368 280 853 646 256 666 638 424 737 321 996 925 405 199 680 953 541 716 481 727 143 577 919 892 355 346 298",
"output": "1272941.9273080483"
},
{
"input": "77\n482 532 200 748 692 697 171 863 586 547 301 149 326 812 147 698 303 691 527 805 681 387 619 947 598 453 167 799 840 508 893 688 643 974 998 341 804 230 538 669 271 404 477 759 943 596 949 235 880 160 151 660 832 82 969 539 708 889 258 81 224 655 790 144 462 582 646 256 445 52 456 920 67 819 631 484 534",
"output": "2045673.1891262225"
},
{
"input": "27\n167 464 924 575 775 97 944 390 297 315 668 296 533 829 851 406 702 366 848 512 71 197 321 900 544 529 116",
"output": "1573959.9105970615"
},
{
"input": "38\n488 830 887 566 720 267 583 102 65 200 884 220 263 858 510 481 316 804 754 568 412 166 374 869 356 977 145 421 500 58 664 252 745 70 381 927 670 772",
"output": "1479184.3434235646"
},
{
"input": "64\n591 387 732 260 840 397 563 136 571 876 831 953 799 493 579 13 559 872 53 678 256 232 969 993 847 14 837 365 547 997 604 199 834 529 306 443 739 49 19 276 343 835 904 588 900 870 439 576 975 955 518 117 131 347 800 83 432 882 869 709 32 950 314 450",
"output": "1258248.6984672088"
},
{
"input": "37\n280 281 169 68 249 389 977 101 360 43 448 447 368 496 125 507 747 392 338 270 916 150 929 428 118 266 589 470 774 852 263 644 187 817 808 58 637",
"output": "1495219.0323274869"
},
{
"input": "97\n768 569 306 968 437 779 227 561 412 60 44 807 234 645 169 858 580 396 343 145 842 723 416 80 456 247 81 150 297 116 760 964 312 558 101 850 549 650 299 868 121 435 579 705 118 424 302 812 970 397 659 565 916 183 933 459 6 593 518 717 326 305 744 470 75 981 824 221 294 324 194 293 251 446 481 215 338 861 528 829 921 945 540 89 450 178 24 460 990 392 148 219 934 615 932 340 937",
"output": "1577239.7333274092"
},
{
"input": "94\n145 703 874 425 277 652 239 496 458 658 339 842 564 699 893 352 625 980 432 121 798 872 499 859 850 721 414 825 543 843 304 111 342 45 219 311 50 748 465 902 781 822 504 985 919 656 280 310 917 438 464 527 491 713 906 329 635 777 223 810 501 535 156 252 806 112 971 719 103 443 165 98 579 554 244 996 221 560 301 51 977 422 314 858 528 772 448 626 185 194 536 66 577 677",
"output": "1624269.3753516484"
},
{
"input": "97\n976 166 649 81 611 927 480 231 998 711 874 91 969 521 531 414 993 790 317 981 9 261 437 332 173 573 904 777 882 990 658 878 965 64 870 896 271 732 431 53 761 943 418 602 708 949 930 130 512 240 363 458 673 319 131 784 224 48 919 126 208 212 911 59 677 535 450 273 479 423 79 807 336 18 72 290 724 28 123 605 287 228 350 897 250 392 885 655 746 417 643 114 813 378 355 635 905",
"output": "1615601.7212203942"
},
{
"input": "91\n493 996 842 9 748 178 1 807 841 519 796 998 84 670 778 143 707 208 165 893 154 943 336 150 761 881 434 112 833 55 412 682 552 945 758 189 209 600 354 325 440 844 410 20 136 665 88 791 688 17 539 821 133 236 94 606 483 446 429 60 960 476 915 134 137 852 754 908 276 482 117 252 297 903 981 203 829 811 471 135 188 667 710 393 370 302 874 872 551 457 692",
"output": "1806742.5014501044"
},
{
"input": "95\n936 736 17 967 229 607 589 291 242 244 29 698 800 566 630 667 90 416 11 94 812 838 668 520 678 111 490 823 199 973 681 676 683 721 262 896 682 713 402 691 874 44 95 704 56 322 822 887 639 433 406 35 988 61 176 496 501 947 440 384 372 959 577 370 754 802 1 945 427 116 746 408 308 391 397 730 493 183 203 871 831 862 461 565 310 344 504 378 785 137 279 123 475 138 415",
"output": "1611115.5269110680"
},
{
"input": "90\n643 197 42 218 582 27 66 704 195 445 641 675 285 639 503 686 242 327 57 955 848 287 819 992 756 749 363 48 648 736 580 117 752 921 923 372 114 313 202 337 64 497 399 25 883 331 24 871 917 8 517 486 323 529 325 92 891 406 864 402 263 773 931 253 625 31 17 271 140 131 232 586 893 525 846 54 294 562 600 801 214 55 768 683 389 738 314 284 328 804",
"output": "1569819.2914796301"
},
{
"input": "98\n29 211 984 75 333 96 840 21 352 168 332 433 130 944 215 210 620 442 363 877 91 491 513 955 53 82 351 19 998 706 702 738 770 453 344 117 893 590 723 662 757 16 87 546 312 669 568 931 224 374 927 225 751 962 651 587 361 250 256 240 282 600 95 64 384 589 813 783 39 918 412 648 506 283 886 926 443 173 946 241 310 33 622 565 261 360 547 339 943 367 354 25 479 743 385 485 896 741",
"output": "2042921.1539616778"
},
{
"input": "93\n957 395 826 67 185 4 455 880 683 654 463 84 258 878 553 592 124 585 9 133 20 609 43 452 725 125 801 537 700 685 771 155 566 376 19 690 383 352 174 208 177 416 304 1000 533 481 87 509 358 233 681 22 507 659 36 859 952 259 138 271 594 779 576 782 119 69 608 758 283 616 640 523 710 751 34 106 774 92 874 568 864 660 998 992 474 679 180 409 15 297 990 689 501",
"output": "1310703.8710041976"
},
{
"input": "97\n70 611 20 30 904 636 583 262 255 501 604 660 212 128 199 138 545 576 506 528 12 410 77 888 783 972 431 188 338 485 148 793 907 678 281 922 976 680 252 724 253 920 177 361 721 798 960 572 99 622 712 466 608 49 612 345 266 751 63 594 40 695 532 789 520 930 825 929 48 59 405 135 109 735 508 186 495 772 375 587 201 324 447 610 230 947 855 318 856 956 313 810 931 175 668 183 688",
"output": "1686117.9099228707"
},
{
"input": "96\n292 235 391 180 840 172 218 997 166 287 329 20 886 325 400 471 182 356 448 337 417 319 58 106 366 764 393 614 90 831 924 314 667 532 64 874 3 434 350 352 733 795 78 640 967 63 47 879 635 272 145 569 468 792 153 761 770 878 281 467 209 208 298 37 700 18 334 93 5 750 412 779 523 517 360 649 447 328 311 653 57 578 767 460 647 663 50 670 151 13 511 580 625 907 227 89",
"output": "1419726.5608617242"
},
{
"input": "100\n469 399 735 925 62 153 707 723 819 529 200 624 57 708 245 384 889 11 639 638 260 419 8 142 403 298 204 169 887 388 241 983 885 267 643 943 417 237 452 562 6 839 149 742 832 896 100 831 712 754 679 743 135 222 445 680 210 955 220 63 960 487 514 824 481 584 441 997 795 290 10 45 510 678 844 503 407 945 850 84 858 934 500 320 936 663 736 592 161 670 606 465 864 969 293 863 868 393 899 744",
"output": "1556458.0979239127"
},
{
"input": "100\n321 200 758 415 190 710 920 992 873 898 814 259 359 66 971 210 838 545 663 652 684 277 36 756 963 459 335 484 462 982 532 423 131 703 307 229 391 938 253 847 542 975 635 928 220 980 222 567 557 181 366 824 900 180 107 979 112 564 525 413 300 422 876 615 737 343 902 8 654 628 469 913 967 785 893 314 909 215 912 262 20 709 363 915 997 954 986 454 596 124 74 159 660 550 787 418 895 786 293 50",
"output": "1775109.8050211088"
},
{
"input": "100\n859 113 290 762 701 63 188 431 810 485 671 673 99 658 194 227 511 435 941 212 551 124 89 222 42 321 657 815 898 171 216 482 707 567 724 491 414 942 820 351 48 653 685 312 586 24 20 627 602 498 533 173 463 262 621 466 119 299 580 964 510 987 40 698 521 998 847 651 746 215 808 563 785 837 631 772 404 923 682 244 232 214 390 350 968 771 517 900 70 543 934 554 681 368 642 575 891 728 478 317",
"output": "1447969.4788174964"
},
{
"input": "100\n941 283 349 457 52 837 299 284 796 305 893 624 101 972 738 204 121 70 17 704 836 791 95 111 162 952 472 724 733 580 878 177 705 804 11 211 463 417 288 409 410 485 896 755 921 267 164 656 505 765 539 439 535 19 991 689 220 474 114 944 884 144 926 849 486 566 117 35 749 499 797 303 362 905 690 890 976 66 590 183 234 683 39 297 769 787 376 541 571 759 495 200 261 352 73 493 831 442 273 339",
"output": "1597889.4218394549"
},
{
"input": "100\n110 868 147 888 291 282 916 542 917 337 235 595 498 621 814 249 261 713 445 666 142 275 319 49 900 543 333 606 487 670 620 769 852 258 230 867 603 491 714 839 879 37 21 74 590 190 397 506 499 967 152 862 200 107 145 23 614 167 857 475 79 598 270 906 626 116 89 59 651 846 723 201 50 699 522 408 634 132 226 414 824 764 513 586 526 238 556 162 667 173 684 415 527 743 10 442 552 274 350 822",
"output": "1567230.6191330721"
},
{
"input": "100\n901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000",
"output": "298608.3817237098"
}
] | 1,617,397,308
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 44
| 218
| 0
|
import math
n = int(input())
a = sorted(list(map(int, input().split())))
ans = 0
for i in range(n):
if i % 2 != n % 2:
if i == 0:
ans += math.pi * a[i] ** 2
else:
ans += math.pi * (a[i] ** 2 - a[i - 1] ** 2)
print(ans)
|
Title: Trace
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day, as Sherlock Holmes was tracking down one very important criminal, he found a wonderful painting on the wall. This wall could be represented as a plane. The painting had several concentric circles that divided the wall into several parts. Some parts were painted red and all the other were painted blue. Besides, any two neighboring parts were painted different colors, that is, the red and the blue color were alternating, i. e. followed one after the other. The outer area of the wall (the area that lied outside all circles) was painted blue. Help Sherlock Holmes determine the total area of red parts of the wall.
Let us remind you that two circles are called concentric if their centers coincide. Several circles are called concentric if any two of them are concentric.
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=100). The second line contains *n* space-separated integers *r**i* (1<=≤<=*r**i*<=≤<=1000) — the circles' radii. It is guaranteed that all circles are different.
Output Specification:
Print the single real number — total area of the part of the wall that is painted red. The answer is accepted if absolute or relative error doesn't exceed 10<=-<=4.
Demo Input:
['1\n1\n', '3\n1 4 2\n']
Demo Output:
['3.1415926536\n', '40.8407044967\n']
Note:
In the first sample the picture is just one circle of radius 1. Inner part of the circle is painted red. The area of the red part equals π × 1<sup class="upper-index">2</sup> = π.
In the second sample there are three circles of radii 1, 4 and 2. Outside part of the second circle is painted blue. Part between the second and the third circles is painted red. Part between the first and the third is painted blue. And, finally, the inner part of the first circle is painted red. Overall there are two red parts: the ring between the second and the third circles and the inner part of the first circle. Total area of the red parts is equal (π × 4<sup class="upper-index">2</sup> - π × 2<sup class="upper-index">2</sup>) + π × 1<sup class="upper-index">2</sup> = π × 12 + π = 13π
|
```python
import math
n = int(input())
a = sorted(list(map(int, input().split())))
ans = 0
for i in range(n):
if i % 2 != n % 2:
if i == 0:
ans += math.pi * a[i] ** 2
else:
ans += math.pi * (a[i] ** 2 - a[i - 1] ** 2)
print(ans)
```
| 3
|
|
454
|
A
|
Little Pony and Crystal Mine
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
|
The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd).
|
Output a crystal of size *n*.
|
[
"3\n",
"5\n",
"7\n"
] |
[
"*D*\nDDD\n*D*\n",
"**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n",
"***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n"
] |
none
| 500
|
[
{
"input": "3",
"output": "*D*\nDDD\n*D*"
},
{
"input": "5",
"output": "**D**\n*DDD*\nDDDDD\n*DDD*\n**D**"
},
{
"input": "7",
"output": "***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***"
},
{
"input": "11",
"output": "*****D*****\n****DDD****\n***DDDDD***\n**DDDDDDD**\n*DDDDDDDDD*\nDDDDDDDDDDD\n*DDDDDDDDD*\n**DDDDDDD**\n***DDDDD***\n****DDD****\n*****D*****"
},
{
"input": "15",
"output": "*******D*******\n******DDD******\n*****DDDDD*****\n****DDDDDDD****\n***DDDDDDDDD***\n**DDDDDDDDDDD**\n*DDDDDDDDDDDDD*\nDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDD*\n**DDDDDDDDDDD**\n***DDDDDDDDD***\n****DDDDDDD****\n*****DDDDD*****\n******DDD******\n*******D*******"
},
{
"input": "21",
"output": "**********D**********\n*********DDD*********\n********DDDDD********\n*******DDDDDDD*******\n******DDDDDDDDD******\n*****DDDDDDDDDDD*****\n****DDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDD**\n*DDDDDDDDDDDDDDDDDDD*\nDDDDDDDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDDDDDDDD*\n**DDDDDDDDDDDDDDDDD**\n***DDDDDDDDDDDDDDD***\n****DDDDDDDDDDDDD****\n*****DDDDDDDDDDD*****\n******DDDDDDDDD******\n*******DDDDDDD*******\n********DDDDD********\n*********DDD*********\n**********D**********"
},
{
"input": "33",
"output": "****************D****************\n***************DDD***************\n**************DDDDD**************\n*************DDDDDDD*************\n************DDDDDDDDD************\n***********DDDDDDDDDDD***********\n**********DDDDDDDDDDDDD**********\n*********DDDDDDDDDDDDDDD*********\n********DDDDDDDDDDDDDDDDD********\n*******DDDDDDDDDDDDDDDDDDD*******\n******DDDDDDDDDDDDDDDDDDDDD******\n*****DDDDDDDDDDDDDDDDDDDDDDD*****\n****DDDDDDDDDDDDDDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDDDD..."
},
{
"input": "57",
"output": "****************************D****************************\n***************************DDD***************************\n**************************DDDDD**************************\n*************************DDDDDDD*************************\n************************DDDDDDDDD************************\n***********************DDDDDDDDDDD***********************\n**********************DDDDDDDDDDDDD**********************\n*********************DDDDDDDDDDDDDDD*********************\n********************DDDDDDDDDDDDDDDDD**..."
},
{
"input": "69",
"output": "**********************************D**********************************\n*********************************DDD*********************************\n********************************DDDDD********************************\n*******************************DDDDDDD*******************************\n******************************DDDDDDDDD******************************\n*****************************DDDDDDDDDDD*****************************\n****************************DDDDDDDDDDDDD****************************\n**************..."
},
{
"input": "81",
"output": "****************************************D****************************************\n***************************************DDD***************************************\n**************************************DDDDD**************************************\n*************************************DDDDDDD*************************************\n************************************DDDDDDDDD************************************\n***********************************DDDDDDDDDDD***********************************\n*************..."
},
{
"input": "91",
"output": "*********************************************D*********************************************\n********************************************DDD********************************************\n*******************************************DDDDD*******************************************\n******************************************DDDDDDD******************************************\n*****************************************DDDDDDDDD*****************************************\n****************************************DDDDDD..."
},
{
"input": "101",
"output": "**************************************************D**************************************************\n*************************************************DDD*************************************************\n************************************************DDDDD************************************************\n***********************************************DDDDDDD***********************************************\n**********************************************DDDDDDDDD********************************************..."
}
] | 1,584,882,056
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 12
| 108
| 0
|
q=lambda:map(int,input().split())
qi=lambda:int(input())
qs=lambda:input().split()
n=qi()
star=n//2
d=1
for i in range(n//2):
print('*'*star+'D'*d+'*'*star)
star-=1
d+=2
print('D'*n)
for i in range(n//2):
star+=1
d-=2
print('*'*star+'D'*d+'*'*star)
|
Title: Little Pony and Crystal Mine
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
Input Specification:
The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd).
Output Specification:
Output a crystal of size *n*.
Demo Input:
['3\n', '5\n', '7\n']
Demo Output:
['*D*\nDDD\n*D*\n', '**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n', '***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n']
Note:
none
|
```python
q=lambda:map(int,input().split())
qi=lambda:int(input())
qs=lambda:input().split()
n=qi()
star=n//2
d=1
for i in range(n//2):
print('*'*star+'D'*d+'*'*star)
star-=1
d+=2
print('D'*n)
for i in range(n//2):
star+=1
d-=2
print('*'*star+'D'*d+'*'*star)
```
| 3
|
|
653
|
A
|
Bear and Three Balls
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"sortings"
] | null | null |
Limak is a little polar bear. He has *n* balls, the *i*-th ball has size *t**i*.
Limak wants to give one ball to each of his three friends. Giving gifts isn't easy — there are two rules Limak must obey to make friends happy:
- No two friends can get balls of the same size. - No two friends can get balls of sizes that differ by more than 2.
For example, Limak can choose balls with sizes 4, 5 and 3, or balls with sizes 90, 91 and 92. But he can't choose balls with sizes 5, 5 and 6 (two friends would get balls of the same size), and he can't choose balls with sizes 30, 31 and 33 (because sizes 30 and 33 differ by more than 2).
Your task is to check whether Limak can choose three balls that satisfy conditions above.
|
The first line of the input contains one integer *n* (3<=≤<=*n*<=≤<=50) — the number of balls Limak has.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000) where *t**i* denotes the size of the *i*-th ball.
|
Print "YES" (without quotes) if Limak can choose three balls of distinct sizes, such that any two of them differ by no more than 2. Otherwise, print "NO" (without quotes).
|
[
"4\n18 55 16 17\n",
"6\n40 41 43 44 44 44\n",
"8\n5 972 3 4 1 4 970 971\n"
] |
[
"YES\n",
"NO\n",
"YES\n"
] |
In the first sample, there are 4 balls and Limak is able to choose three of them to satisfy the rules. He must must choose balls with sizes 18, 16 and 17.
In the second sample, there is no way to give gifts to three friends without breaking the rules.
In the third sample, there is even more than one way to choose balls:
1. Choose balls with sizes 3, 4 and 5. 1. Choose balls with sizes 972, 970, 971.
| 500
|
[
{
"input": "4\n18 55 16 17",
"output": "YES"
},
{
"input": "6\n40 41 43 44 44 44",
"output": "NO"
},
{
"input": "8\n5 972 3 4 1 4 970 971",
"output": "YES"
},
{
"input": "3\n959 747 656",
"output": "NO"
},
{
"input": "4\n1 2 2 3",
"output": "YES"
},
{
"input": "50\n998 30 384 289 505 340 872 223 663 31 929 625 864 699 735 589 676 399 745 635 963 381 75 97 324 612 597 797 103 382 25 894 219 458 337 572 201 355 294 275 278 311 586 573 965 704 936 237 715 543",
"output": "NO"
},
{
"input": "50\n941 877 987 982 966 979 984 810 811 909 872 980 957 897 845 995 924 905 984 914 824 840 868 910 815 808 872 858 883 952 823 835 860 874 959 972 931 867 866 987 982 837 800 921 887 910 982 980 828 869",
"output": "YES"
},
{
"input": "3\n408 410 409",
"output": "YES"
},
{
"input": "3\n903 902 904",
"output": "YES"
},
{
"input": "3\n399 400 398",
"output": "YES"
},
{
"input": "3\n450 448 449",
"output": "YES"
},
{
"input": "3\n390 389 388",
"output": "YES"
},
{
"input": "3\n438 439 440",
"output": "YES"
},
{
"input": "11\n488 688 490 94 564 615 641 170 489 517 669",
"output": "YES"
},
{
"input": "24\n102 672 983 82 720 501 81 721 982 312 207 897 159 964 611 956 118 984 37 271 596 403 772 954",
"output": "YES"
},
{
"input": "36\n175 551 70 479 875 480 979 32 465 402 640 116 76 687 874 678 359 785 753 401 978 629 162 963 886 641 39 845 132 930 2 372 478 947 407 318",
"output": "YES"
},
{
"input": "6\n10 79 306 334 304 305",
"output": "YES"
},
{
"input": "34\n787 62 26 683 486 364 684 891 846 801 969 837 359 800 836 359 471 637 732 91 841 836 7 799 959 405 416 841 737 803 615 483 323 365",
"output": "YES"
},
{
"input": "30\n860 238 14 543 669 100 428 789 576 484 754 274 849 850 586 377 711 386 510 408 520 693 23 477 266 851 728 711 964 73",
"output": "YES"
},
{
"input": "11\n325 325 324 324 324 325 325 324 324 324 324",
"output": "NO"
},
{
"input": "7\n517 517 518 517 518 518 518",
"output": "NO"
},
{
"input": "20\n710 710 711 711 711 711 710 710 710 710 711 710 710 710 710 710 710 711 711 710",
"output": "NO"
},
{
"input": "48\n29 30 29 29 29 30 29 30 30 30 30 29 30 30 30 29 29 30 30 29 30 29 29 30 29 30 29 30 30 29 30 29 29 30 30 29 29 30 30 29 29 30 30 30 29 29 30 29",
"output": "NO"
},
{
"input": "7\n880 880 514 536 881 881 879",
"output": "YES"
},
{
"input": "15\n377 432 262 376 261 375 377 262 263 263 261 376 262 262 375",
"output": "YES"
},
{
"input": "32\n305 426 404 961 426 425 614 304 404 425 615 403 303 304 615 303 305 405 427 614 403 303 425 615 404 304 427 403 206 616 405 404",
"output": "YES"
},
{
"input": "41\n115 686 988 744 762 519 745 519 518 83 85 115 520 44 687 686 685 596 988 687 989 988 114 745 84 519 519 746 988 84 745 744 115 114 85 115 520 746 745 116 987",
"output": "YES"
},
{
"input": "47\n1 2 483 28 7 109 270 651 464 162 353 521 224 989 721 499 56 69 197 716 313 446 580 645 828 197 100 138 789 499 147 677 384 711 783 937 300 543 540 93 669 604 739 122 632 822 116",
"output": "NO"
},
{
"input": "31\n1 2 1 373 355 692 750 920 578 666 615 232 141 129 663 929 414 704 422 559 568 731 354 811 532 618 39 879 292 602 995",
"output": "NO"
},
{
"input": "50\n5 38 41 4 15 40 27 39 20 3 44 47 30 6 36 29 35 12 19 26 10 2 21 50 11 46 48 49 17 16 33 13 32 28 31 18 23 34 7 14 24 45 9 37 1 8 42 25 43 22",
"output": "YES"
},
{
"input": "50\n967 999 972 990 969 978 963 987 954 955 973 970 959 981 995 983 986 994 979 957 965 982 992 977 953 975 956 961 993 997 998 958 980 962 960 951 996 991 1000 966 971 988 976 968 989 984 974 964 985 952",
"output": "YES"
},
{
"input": "50\n850 536 761 506 842 898 857 723 583 637 536 943 895 929 890 612 832 633 696 731 553 880 710 812 665 877 915 636 711 540 748 600 554 521 813 796 568 513 543 809 798 820 928 504 999 646 907 639 550 911",
"output": "NO"
},
{
"input": "3\n3 1 2",
"output": "YES"
},
{
"input": "3\n500 999 1000",
"output": "NO"
},
{
"input": "10\n101 102 104 105 107 109 110 112 113 115",
"output": "NO"
},
{
"input": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "NO"
},
{
"input": "50\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000",
"output": "NO"
},
{
"input": "3\n1000 999 998",
"output": "YES"
},
{
"input": "49\n343 322 248 477 53 156 245 493 209 141 370 66 229 184 434 137 276 472 216 456 147 180 140 114 493 323 393 262 380 314 222 124 98 441 129 346 48 401 347 460 122 125 114 106 189 260 374 165 456",
"output": "NO"
},
{
"input": "20\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 3 3 3 3 3",
"output": "YES"
},
{
"input": "3\n999 999 1000",
"output": "NO"
},
{
"input": "9\n2 4 5 13 25 100 200 300 400",
"output": "NO"
},
{
"input": "9\n1 1 1 2 2 2 3 3 3",
"output": "YES"
},
{
"input": "3\n1 1 2",
"output": "NO"
},
{
"input": "3\n998 999 1000",
"output": "YES"
},
{
"input": "12\n1 1 1 1 1 1 1 1 1 2 2 4",
"output": "NO"
},
{
"input": "4\n4 3 4 5",
"output": "YES"
},
{
"input": "6\n1 1 1 2 2 2",
"output": "NO"
},
{
"input": "3\n2 3 2",
"output": "NO"
},
{
"input": "5\n10 5 6 3 2",
"output": "NO"
},
{
"input": "3\n1 2 1",
"output": "NO"
},
{
"input": "3\n1 2 3",
"output": "YES"
},
{
"input": "4\n998 999 1000 1000",
"output": "YES"
},
{
"input": "5\n2 3 9 9 4",
"output": "YES"
},
{
"input": "4\n1 2 4 4",
"output": "NO"
},
{
"input": "3\n1 1 1",
"output": "NO"
},
{
"input": "3\n2 2 3",
"output": "NO"
},
{
"input": "7\n1 2 2 2 4 5 6",
"output": "YES"
},
{
"input": "5\n1 3 10 3 10",
"output": "NO"
},
{
"input": "3\n1 2 2",
"output": "NO"
},
{
"input": "4\n1000 1000 999 998",
"output": "YES"
},
{
"input": "3\n5 3 7",
"output": "NO"
},
{
"input": "6\n1 1 2 2 3 3",
"output": "YES"
},
{
"input": "9\n6 6 6 5 5 5 4 4 4",
"output": "YES"
},
{
"input": "7\n5 6 6 6 7 7 7",
"output": "YES"
},
{
"input": "5\n2 3 3 3 4",
"output": "YES"
},
{
"input": "5\n2 1 2 1 3",
"output": "YES"
},
{
"input": "3\n1 2 7",
"output": "NO"
},
{
"input": "3\n1000 1000 1000",
"output": "NO"
},
{
"input": "5\n1 100 2 100 3",
"output": "YES"
},
{
"input": "5\n5 4 6 5 5",
"output": "YES"
},
{
"input": "12\n1 1 1 1 2 2 2 2 3 3 3 3",
"output": "YES"
},
{
"input": "5\n9 9 1 2 3",
"output": "YES"
},
{
"input": "6\n1 2 3 1 2 3",
"output": "YES"
},
{
"input": "7\n1 1 1 1 2 3 3",
"output": "YES"
},
{
"input": "3\n13 13 13",
"output": "NO"
},
{
"input": "3\n42 42 42",
"output": "NO"
},
{
"input": "8\n1 1 1 1 2 2 2 2",
"output": "NO"
},
{
"input": "6\n1 1 1 1 2 3",
"output": "YES"
},
{
"input": "6\n1 1 2 2 6 6",
"output": "NO"
},
{
"input": "6\n1 2 5 5 5 5",
"output": "NO"
},
{
"input": "9\n1 2 3 1 2 3 1 2 3",
"output": "YES"
},
{
"input": "4\n1 2 1 100",
"output": "NO"
},
{
"input": "5\n1 1 2 2 3",
"output": "YES"
}
] | 1,595,919,390
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 84
| 109
| 6,963,200
|
def optimal_size (t):
if len(t) <= 2:
return "NO"
for x in range(len(t)-2):
if abs(t[x+1] - t[x]) <= 2 and abs(t[x+2] - t[x]) <= 2 and abs(t[x+2] - t[x+1]) <= 2:
return "YES"
return "NO"
n = int(input())
t = list(map(int,input().split()))
t = list(set(t))
t = sorted(t)
print (optimal_size(t))
|
Title: Bear and Three Balls
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Limak is a little polar bear. He has *n* balls, the *i*-th ball has size *t**i*.
Limak wants to give one ball to each of his three friends. Giving gifts isn't easy — there are two rules Limak must obey to make friends happy:
- No two friends can get balls of the same size. - No two friends can get balls of sizes that differ by more than 2.
For example, Limak can choose balls with sizes 4, 5 and 3, or balls with sizes 90, 91 and 92. But he can't choose balls with sizes 5, 5 and 6 (two friends would get balls of the same size), and he can't choose balls with sizes 30, 31 and 33 (because sizes 30 and 33 differ by more than 2).
Your task is to check whether Limak can choose three balls that satisfy conditions above.
Input Specification:
The first line of the input contains one integer *n* (3<=≤<=*n*<=≤<=50) — the number of balls Limak has.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000) where *t**i* denotes the size of the *i*-th ball.
Output Specification:
Print "YES" (without quotes) if Limak can choose three balls of distinct sizes, such that any two of them differ by no more than 2. Otherwise, print "NO" (without quotes).
Demo Input:
['4\n18 55 16 17\n', '6\n40 41 43 44 44 44\n', '8\n5 972 3 4 1 4 970 971\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
In the first sample, there are 4 balls and Limak is able to choose three of them to satisfy the rules. He must must choose balls with sizes 18, 16 and 17.
In the second sample, there is no way to give gifts to three friends without breaking the rules.
In the third sample, there is even more than one way to choose balls:
1. Choose balls with sizes 3, 4 and 5. 1. Choose balls with sizes 972, 970, 971.
|
```python
def optimal_size (t):
if len(t) <= 2:
return "NO"
for x in range(len(t)-2):
if abs(t[x+1] - t[x]) <= 2 and abs(t[x+2] - t[x]) <= 2 and abs(t[x+2] - t[x+1]) <= 2:
return "YES"
return "NO"
n = int(input())
t = list(map(int,input().split()))
t = list(set(t))
t = sorted(t)
print (optimal_size(t))
```
| 3
|
|
785
|
A
|
Anton and Polyhedrons
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons:
- Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces.
All five kinds of polyhedrons are shown on the picture below:
Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number!
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of polyhedrons in Anton's collection.
Each of the following *n* lines of the input contains a string *s**i* — the name of the *i*-th polyhedron in Anton's collection. The string can look like this:
- "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron.
|
Output one number — the total number of faces in all the polyhedrons in Anton's collection.
|
[
"4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n",
"3\nDodecahedron\nOctahedron\nOctahedron\n"
] |
[
"42\n",
"28\n"
] |
In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces.
| 500
|
[
{
"input": "4\nIcosahedron\nCube\nTetrahedron\nDodecahedron",
"output": "42"
},
{
"input": "3\nDodecahedron\nOctahedron\nOctahedron",
"output": "28"
},
{
"input": "25\nIcosahedron\nOctahedron\nTetrahedron\nDodecahedron\nCube\nIcosahedron\nOctahedron\nCube\nTetrahedron\nIcosahedron\nIcosahedron\nTetrahedron\nOctahedron\nDodecahedron\nIcosahedron\nOctahedron\nIcosahedron\nTetrahedron\nDodecahedron\nTetrahedron\nOctahedron\nCube\nCube\nDodecahedron\nTetrahedron",
"output": "256"
},
{
"input": "1\nTetrahedron",
"output": "4"
},
{
"input": "1\nCube",
"output": "6"
},
{
"input": "1\nOctahedron",
"output": "8"
},
{
"input": "1\nDodecahedron",
"output": "12"
},
{
"input": "1\nIcosahedron",
"output": "20"
},
{
"input": "28\nOctahedron\nDodecahedron\nOctahedron\nOctahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nDodecahedron\nDodecahedron\nCube\nDodecahedron\nCube\nTetrahedron\nCube\nCube\nTetrahedron\nDodecahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nIcosahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron",
"output": "340"
}
] | 1,689,403,515
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 202
| 0
|
n = int(input())
p = {
"Tetrahedron": 4,
"Cube": 6,
"Octahedron": 8,
"Dodecahedron": 12,
"Icosahedron": 20
}
t = 0
for i in range(n):
a = input()
t += p[a]
print(t)
|
Title: Anton and Polyhedrons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons:
- Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces.
All five kinds of polyhedrons are shown on the picture below:
Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number!
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of polyhedrons in Anton's collection.
Each of the following *n* lines of the input contains a string *s**i* — the name of the *i*-th polyhedron in Anton's collection. The string can look like this:
- "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron.
Output Specification:
Output one number — the total number of faces in all the polyhedrons in Anton's collection.
Demo Input:
['4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n', '3\nDodecahedron\nOctahedron\nOctahedron\n']
Demo Output:
['42\n', '28\n']
Note:
In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces.
|
```python
n = int(input())
p = {
"Tetrahedron": 4,
"Cube": 6,
"Octahedron": 8,
"Dodecahedron": 12,
"Icosahedron": 20
}
t = 0
for i in range(n):
a = input()
t += p[a]
print(t)
```
| 3
|
|
867
|
A
|
Between the Offices
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
|
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
|
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower).
|
[
"4\nFSSF\n",
"2\nSF\n",
"10\nFFFFFFFFFF\n",
"10\nSSFFSFFSFF\n"
] |
[
"NO\n",
"YES\n",
"NO\n",
"YES\n"
] |
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though.
| 500
|
[
{
"input": "4\nFSSF",
"output": "NO"
},
{
"input": "2\nSF",
"output": "YES"
},
{
"input": "10\nFFFFFFFFFF",
"output": "NO"
},
{
"input": "10\nSSFFSFFSFF",
"output": "YES"
},
{
"input": "20\nSFSFFFFSSFFFFSSSSFSS",
"output": "NO"
},
{
"input": "20\nSSFFFFFSFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "20\nSSFSFSFSFSFSFSFSSFSF",
"output": "YES"
},
{
"input": "20\nSSSSFSFSSFSFSSSSSSFS",
"output": "NO"
},
{
"input": "100\nFFFSFSFSFSSFSFFSSFFFFFSSSSFSSFFFFSFFFFFSFFFSSFSSSFFFFSSFFSSFSFFSSFSSSFSFFSFSFFSFSFFSSFFSFSSSSFSFSFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFSFFFFFFFFFSFSSFFFFFFFFFFFFFFFFFFFFFFSFFSFFFFFSFFFFFFFFSFFFFFFFFFFFFFSFFFFFFFFSFFFFFFFSF",
"output": "NO"
},
{
"input": "100\nSFFSSFFFFFFSSFFFSSFSFFFFFSSFFFSFFFFFFSFSSSFSFSFFFFSFSSFFFFFFFFSFFFFFSFFFFFSSFFFSFFSFSFFFFSFFSFFFFFFF",
"output": "YES"
},
{
"input": "100\nFFFFSSSSSFFSSSFFFSFFFFFSFSSFSFFSFFSSFFSSFSFFFFFSFSFSFSFFFFFFFFFSFSFFSFFFFSFSFFFFFFFFFFFFSFSSFFSSSSFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFSSFFFFSFSFFFSFSSSFSSSSSFSSSSFFSSFFFSFSFSSFFFSSSFFSFSFSSFSFSSFSFFFSFFFFFSSFSFFFSSSFSSSFFS",
"output": "NO"
},
{
"input": "100\nFFFSSSFSFSSSSFSSFSFFSSSFFSSFSSFFSSFFSFSSSSFFFSFFFSFSFSSSFSSFSFSFSFFSSSSSFSSSFSFSFFSSFSFSSFFSSFSFFSFS",
"output": "NO"
},
{
"input": "100\nFFSSSSFSSSFSSSSFSSSFFSFSSFFSSFSSSFSSSFFSFFSSSSSSSSSSSSFSSFSSSSFSFFFSSFFFFFFSFSFSSSSSSFSSSFSFSSFSSFSS",
"output": "NO"
},
{
"input": "100\nSSSFFFSSSSFFSSSSSFSSSSFSSSFSSSSSFSSSSSSSSFSFFSSSFFSSFSSSSFFSSSSSSFFSSSSFSSSSSSFSSSFSSSSSSSFSSSSFSSSS",
"output": "NO"
},
{
"input": "100\nFSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSSSSSSFSSSSSSSSSSSSSFSSFSSSSSFSSFSSSSSSSSSFFSSSSSFSFSSSFFSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSFSSSSSSSSSSSSFSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSFS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFSFFFFFFFFFFFSFSFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFSSFFFFSFFFFFFFFFFFFFFFFFFFSFFFSSFFFFSFSFFFSFFFFFFFFFFFFFFFSSFFFFFFFFSSFFFFFFFFFFFFFFSFF",
"output": "YES"
},
{
"input": "100\nSFFSSSFFSFSFSFFFFSSFFFFSFFFFFFFFSFSFFFSFFFSFFFSFFFFSFSFFFFFFFSFFFFFFFFFFSFFSSSFFSSFFFFSFFFFSFFFFSFFF",
"output": "YES"
},
{
"input": "100\nSFFFSFFFFSFFFSSFFFSFSFFFSFFFSSFSFFFFFSFFFFFFFFSFSFSFFSFFFSFSSFSFFFSFSFFSSFSFSSSFFFFFFSSFSFFSFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSSSSFFFFSFFFFFFFSFFFFSFSFFFFSSFFFFFFFFFSFFSSFFFFFFSFSFSSFSSSFFFFFFFSFSFFFSSSFFFFFFFSFFFSSFFFFSSFFFSF",
"output": "YES"
},
{
"input": "100\nSSSFSSFFFSFSSSSFSSFSSSSFSSFFFFFSFFSSSSFFSSSFSSSFSSSSFSSSSFSSSSSSSFSFSSFFFSSFFSFFSSSSFSSFFSFSSFSFFFSF",
"output": "YES"
},
{
"input": "100\nSFFSFSSSSSSSFFSSSFSSSSFSFSSFFFSSSSSSFSSSSFSSFSSSFSSSSSSSFSSFSFFFSSFSSFSFSFSSSSSSSSSSSSFFFFSSSSSFSFFF",
"output": "YES"
},
{
"input": "100\nSSSFSFFSFSFFSSSSSFSSSFSSSFFFSSSSSSSSSFSFSFSSSSFSFSSFFFFFSSSSSSSSSSSSSSSSSSSFFSSSSSFSFSSSSFFSSSSFSSSF",
"output": "YES"
},
{
"input": "100\nSSSFSSSSSSSSSSFSSSSFSSSSSSFSSSSSSFSSSSSSSSSSSSSSFSSSFSSSFSSSSSSSSSSSFSSSSSSFSFSSSSFSSSSSSFSSSSSSSSFF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFFSSSSSSSSSFSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "2\nSS",
"output": "NO"
}
] | 1,679,732,548
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 46
| 0
|
k = int(input())
a = input()
sf = a.count('SF')
fs = a.count('FS')
if sf>fs:
print('YES')
else:
print('NO')
|
Title: Between the Offices
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
Input Specification:
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
Output Specification:
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower).
Demo Input:
['4\nFSSF\n', '2\nSF\n', '10\nFFFFFFFFFF\n', '10\nSSFFSFFSFF\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n', 'YES\n']
Note:
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though.
|
```python
k = int(input())
a = input()
sf = a.count('SF')
fs = a.count('FS')
if sf>fs:
print('YES')
else:
print('NO')
```
| 3
|
|
439
|
A
|
Devu, the Singer and Churu, the Joker
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation"
] | null | null |
Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited.
Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly.
The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly.
People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest.
You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions:
- The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible.
If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event.
|
The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100).
|
If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event.
|
[
"3 30\n2 2 1\n",
"3 20\n2 1 1\n"
] |
[
"5\n",
"-1\n"
] |
Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way:
- First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes.
Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes.
Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.
| 500
|
[
{
"input": "3 30\n2 2 1",
"output": "5"
},
{
"input": "3 20\n2 1 1",
"output": "-1"
},
{
"input": "50 10000\n5 4 10 9 9 6 7 7 7 3 3 7 7 4 7 4 10 10 1 7 10 3 1 4 5 7 2 10 10 10 2 3 4 7 6 1 8 4 7 3 8 8 4 10 1 1 9 2 6 1",
"output": "1943"
},
{
"input": "50 10000\n4 7 15 9 11 12 20 9 14 14 10 13 6 13 14 17 6 8 20 12 10 15 13 17 5 12 13 11 7 5 5 2 3 15 13 7 14 14 19 2 13 14 5 15 3 19 15 16 4 1",
"output": "1891"
},
{
"input": "100 9000\n5 2 3 1 1 3 4 9 9 6 7 10 10 10 2 10 6 8 8 6 7 9 9 5 6 2 1 10 10 9 4 5 9 2 4 3 8 5 6 1 1 5 3 6 2 6 6 6 5 8 3 6 7 3 1 10 9 1 8 3 10 9 5 6 3 4 1 1 10 10 2 3 4 8 10 10 5 1 5 3 6 8 10 6 10 2 1 8 10 1 7 6 9 10 5 2 3 5 3 2",
"output": "1688"
},
{
"input": "100 8007\n5 19 14 18 9 6 15 8 1 14 11 20 3 17 7 12 2 6 3 17 7 20 1 14 20 17 2 10 13 7 18 18 9 10 16 8 1 11 11 9 13 18 9 20 12 12 7 15 12 17 11 5 11 15 9 2 15 1 18 3 18 16 15 4 10 5 18 13 13 12 3 8 17 2 12 2 13 3 1 13 2 4 9 10 18 10 14 4 4 17 12 19 2 9 6 5 5 20 18 12",
"output": "1391"
},
{
"input": "39 2412\n1 1 1 1 1 1 26 1 1 1 99 1 1 1 1 1 1 1 1 1 1 88 7 1 1 1 1 76 1 1 1 93 40 1 13 1 68 1 32",
"output": "368"
},
{
"input": "39 2617\n47 1 1 1 63 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 70 1 99 63 1 1 1 1 1 1 1 1 64 1 1",
"output": "435"
},
{
"input": "39 3681\n83 77 1 94 85 47 1 98 29 16 1 1 1 71 96 85 31 97 96 93 40 50 98 1 60 51 1 96 100 72 1 1 1 89 1 93 1 92 100",
"output": "326"
},
{
"input": "45 894\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 28 28 1 1 1 1 1 1 1 1 1 1 1 1 1 1 99 3 1 1",
"output": "139"
},
{
"input": "45 4534\n1 99 65 99 4 46 54 80 51 30 96 1 28 30 44 70 78 1 1 100 1 62 1 1 1 85 1 1 1 61 1 46 75 1 61 77 97 26 67 1 1 63 81 85 86",
"output": "514"
},
{
"input": "72 3538\n52 1 8 1 1 1 7 1 1 1 1 48 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 40 1 1 38 1 1 1 1 1 1 1 1 1 1 1 35 1 93 79 1 1 1 1 1 1 1 1 1 51 1 1 1 1 1 1 1 1 1 1 1 1 96 1",
"output": "586"
},
{
"input": "81 2200\n1 59 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 93 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 50 1 1 1 1 1 1 1 1 1 1 1",
"output": "384"
},
{
"input": "81 2577\n85 91 1 1 2 1 1 100 1 80 1 1 17 86 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 37 1 66 24 1 1 96 49 1 66 1 44 1 1 1 1 98 1 1 1 1 35 1 37 3 35 1 1 87 64 1 24 1 58 1 1 42 83 5 1 1 1 1 1 95 1 94 1 50 1 1",
"output": "174"
},
{
"input": "81 4131\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 16 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "807"
},
{
"input": "81 6315\n1 1 67 100 1 99 36 1 92 5 1 96 42 12 1 57 91 1 1 66 41 30 74 95 1 37 1 39 91 69 1 52 77 47 65 1 1 93 96 74 90 35 85 76 71 92 92 1 1 67 92 74 1 1 86 76 35 1 56 16 27 57 37 95 1 40 20 100 51 1 80 60 45 79 95 1 46 1 25 100 96",
"output": "490"
},
{
"input": "96 1688\n1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 25 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 71 1 1 1 30 1 1 1",
"output": "284"
},
{
"input": "96 8889\n1 1 18 1 1 1 1 1 1 1 1 1 99 1 1 1 1 88 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 96 1 1 1 1 21 1 1 1 1 1 1 1 73 1 1 1 1 1 10 1 1 1 1 1 1 1 46 43 1 1 1 1 1 98 1 1 1 1 1 1 6 1 1 1 1 1 74 1 25 1 55 1 1 1 13 1 1 54 1 1 1",
"output": "1589"
},
{
"input": "10 100\n1 1 1 1 1 1 1 1 1 1",
"output": "18"
},
{
"input": "100 10000\n54 46 72 94 79 83 91 54 73 3 24 55 54 31 28 20 19 6 25 19 47 23 1 70 15 87 51 39 54 77 55 5 60 3 15 99 56 88 22 78 79 21 38 27 28 86 7 88 12 59 55 70 25 1 70 49 1 45 69 72 50 17 4 56 8 100 90 34 35 20 61 76 88 79 4 74 65 68 75 26 40 72 59 94 10 67 96 85 29 90 47 24 44 1 66 93 55 36 1 99",
"output": "1017"
},
{
"input": "100 6000\n41 31 23 17 24 78 26 96 93 48 46 2 49 33 35 9 73 100 34 48 83 36 33 69 43 24 3 74 8 81 27 33 94 38 77 9 76 90 62 90 21 67 22 22 12 2 17 27 61 18 72 85 59 65 71 38 90 75 74 66 60 47 58 50 90 95 75 10 5 100 97 29 83 88 65 26 93 90 22 98 36 55 70 38 50 92 88 72 99 96 25 14 74 16 25 92 67 94 77 96",
"output": "-1"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 6\n1",
"output": "1"
},
{
"input": "1 5\n1",
"output": "0"
},
{
"input": "1 3\n4",
"output": "-1"
},
{
"input": "3 24\n2 1 2",
"output": "-1"
}
] | 1,539,037,403
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 26
| 109
| 0
|
n,d=map(int, input().split())
a=list(map(int, input().split()))
songst=sum(a)
mint=songst+(n-1)*10
if d>=mint:
print((d-songst)//5)
else:
print(-1)
|
Title: Devu, the Singer and Churu, the Joker
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited.
Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly.
The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly.
People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest.
You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions:
- The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible.
If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event.
Input Specification:
The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100).
Output Specification:
If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event.
Demo Input:
['3 30\n2 2 1\n', '3 20\n2 1 1\n']
Demo Output:
['5\n', '-1\n']
Note:
Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way:
- First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes.
Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes.
Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.
|
```python
n,d=map(int, input().split())
a=list(map(int, input().split()))
songst=sum(a)
mint=songst+(n-1)*10
if d>=mint:
print((d-songst)//5)
else:
print(-1)
```
| 3
|
|
595
|
A
|
Vitaly and Night
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment.
Vitaly sees a building of *n* floors and 2·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2·*j*<=-<=1 and 2·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on.
Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping.
|
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of floors in the house and the number of flats on each floor respectively.
Next *n* lines describe the floors from top to bottom and contain 2·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'.
|
Print a single integer — the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping.
|
[
"2 2\n0 0 0 1\n1 0 1 1\n",
"1 3\n1 1 0 1 0 0\n"
] |
[
"3\n",
"2\n"
] |
In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off.
In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off.
| 500
|
[
{
"input": "2 2\n0 0 0 1\n1 0 1 1",
"output": "3"
},
{
"input": "1 3\n1 1 0 1 0 0",
"output": "2"
},
{
"input": "3 3\n1 1 1 1 1 1\n1 1 0 1 1 0\n1 0 0 0 1 1",
"output": "8"
},
{
"input": "1 5\n1 0 1 1 1 0 1 1 1 1",
"output": "5"
},
{
"input": "1 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 0 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "99"
},
{
"input": "1 100\n0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "6"
},
{
"input": "1 100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "100"
},
{
"input": "100 1\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0",
"output": "8"
},
{
"input": "100 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "1 1\n0 0",
"output": "0"
},
{
"input": "1 1\n0 1",
"output": "1"
},
{
"input": "1 1\n1 0",
"output": "1"
},
{
"input": "1 1\n1 1",
"output": "1"
}
] | 1,591,389,404
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 124
| 0
|
n, m = input().split()
n, m = int(n), int(m)
result = 0
for each_n in range(n):
windows = [int(i) for i in input().split()]
i = 0
while i < 2*m:
if (windows[i] | windows[i + 1]) == 1:
result += 1
i = i + 2
print(result)
|
Title: Vitaly and Night
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment.
Vitaly sees a building of *n* floors and 2·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2·*j*<=-<=1 and 2·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on.
Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of floors in the house and the number of flats on each floor respectively.
Next *n* lines describe the floors from top to bottom and contain 2·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'.
Output Specification:
Print a single integer — the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping.
Demo Input:
['2 2\n0 0 0 1\n1 0 1 1\n', '1 3\n1 1 0 1 0 0\n']
Demo Output:
['3\n', '2\n']
Note:
In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off.
In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off.
|
```python
n, m = input().split()
n, m = int(n), int(m)
result = 0
for each_n in range(n):
windows = [int(i) for i in input().split()]
i = 0
while i < 2*m:
if (windows[i] | windows[i + 1]) == 1:
result += 1
i = i + 2
print(result)
```
| 3
|
|
606
|
A
|
Magic Spheres
|
PROGRAMMING
| 1,200
|
[
"implementation"
] | null | null |
Carl is a beginner magician. He has *a* blue, *b* violet and *c* orange magic spheres. In one move he can transform two spheres of the same color into one sphere of any other color. To make a spell that has never been seen before, he needs at least *x* blue, *y* violet and *z* orange spheres. Can he get them (possible, in multiple actions)?
|
The first line of the input contains three integers *a*, *b* and *c* (0<=≤<=*a*,<=*b*,<=*c*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that are in the magician's disposal.
The second line of the input contains three integers, *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that he needs to get.
|
If the wizard is able to obtain the required numbers of spheres, print "Yes". Otherwise, print "No".
|
[
"4 4 0\n2 1 2\n",
"5 6 1\n2 7 2\n",
"3 3 3\n2 2 2\n"
] |
[
"Yes\n",
"No\n",
"Yes\n"
] |
In the first sample the wizard has 4 blue and 4 violet spheres. In his first action he can turn two blue spheres into one violet one. After that he will have 2 blue and 5 violet spheres. Then he turns 4 violet spheres into 2 orange spheres and he ends up with 2 blue, 1 violet and 2 orange spheres, which is exactly what he needs.
| 500
|
[
{
"input": "4 4 0\n2 1 2",
"output": "Yes"
},
{
"input": "5 6 1\n2 7 2",
"output": "No"
},
{
"input": "3 3 3\n2 2 2",
"output": "Yes"
},
{
"input": "0 0 0\n0 0 0",
"output": "Yes"
},
{
"input": "0 0 0\n0 0 1",
"output": "No"
},
{
"input": "0 1 0\n0 0 0",
"output": "Yes"
},
{
"input": "1 0 0\n1 0 0",
"output": "Yes"
},
{
"input": "2 2 1\n1 1 2",
"output": "No"
},
{
"input": "1 3 1\n2 1 1",
"output": "Yes"
},
{
"input": "1000000 1000000 1000000\n1000000 1000000 1000000",
"output": "Yes"
},
{
"input": "1000000 500000 500000\n0 750000 750000",
"output": "Yes"
},
{
"input": "500000 1000000 500000\n750001 0 750000",
"output": "No"
},
{
"input": "499999 500000 1000000\n750000 750000 0",
"output": "No"
},
{
"input": "500000 500000 0\n0 0 500000",
"output": "Yes"
},
{
"input": "0 500001 499999\n500000 0 0",
"output": "No"
},
{
"input": "1000000 500000 1000000\n500000 1000000 500000",
"output": "Yes"
},
{
"input": "1000000 1000000 499999\n500000 500000 1000000",
"output": "No"
},
{
"input": "500000 1000000 1000000\n1000000 500001 500000",
"output": "No"
},
{
"input": "1000000 500000 500000\n0 1000000 500000",
"output": "Yes"
},
{
"input": "500000 500000 1000000\n500001 1000000 0",
"output": "No"
},
{
"input": "500000 999999 500000\n1000000 0 500000",
"output": "No"
},
{
"input": "4 0 3\n2 2 1",
"output": "Yes"
},
{
"input": "0 2 4\n2 0 2",
"output": "Yes"
},
{
"input": "3 1 0\n1 1 1",
"output": "Yes"
},
{
"input": "4 4 1\n1 3 2",
"output": "Yes"
},
{
"input": "1 2 4\n2 1 3",
"output": "No"
},
{
"input": "1 1 0\n0 0 1",
"output": "No"
},
{
"input": "4 0 0\n0 1 1",
"output": "Yes"
},
{
"input": "0 3 0\n1 0 1",
"output": "No"
},
{
"input": "0 0 3\n1 0 1",
"output": "Yes"
},
{
"input": "1 12 1\n4 0 4",
"output": "Yes"
},
{
"input": "4 0 4\n1 2 1",
"output": "Yes"
},
{
"input": "4 4 0\n1 1 3",
"output": "No"
},
{
"input": "0 9 0\n2 2 2",
"output": "No"
},
{
"input": "0 10 0\n2 2 2",
"output": "Yes"
},
{
"input": "9 0 9\n0 8 0",
"output": "Yes"
},
{
"input": "0 9 9\n9 0 0",
"output": "No"
},
{
"input": "9 10 0\n0 0 9",
"output": "Yes"
},
{
"input": "10 0 9\n0 10 0",
"output": "No"
},
{
"input": "0 10 10\n10 0 0",
"output": "Yes"
},
{
"input": "10 10 0\n0 0 11",
"output": "No"
},
{
"input": "307075 152060 414033\n381653 222949 123101",
"output": "No"
},
{
"input": "569950 228830 153718\n162186 357079 229352",
"output": "No"
},
{
"input": "149416 303568 749016\n238307 493997 190377",
"output": "No"
},
{
"input": "438332 298094 225324\n194220 400244 245231",
"output": "No"
},
{
"input": "293792 300060 511272\n400687 382150 133304",
"output": "No"
},
{
"input": "295449 518151 368838\n382897 137148 471892",
"output": "No"
},
{
"input": "191789 291147 691092\n324321 416045 176232",
"output": "Yes"
},
{
"input": "286845 704749 266526\n392296 104421 461239",
"output": "Yes"
},
{
"input": "135522 188282 377041\n245719 212473 108265",
"output": "Yes"
},
{
"input": "404239 359124 133292\n180069 184791 332544",
"output": "No"
},
{
"input": "191906 624432 244408\n340002 367217 205432",
"output": "No"
},
{
"input": "275980 429361 101824\n274288 302579 166062",
"output": "No"
},
{
"input": "136092 364927 395302\n149173 343146 390922",
"output": "No"
},
{
"input": "613852 334661 146012\n363786 326286 275233",
"output": "No"
},
{
"input": "348369 104625 525203\n285621 215396 366411",
"output": "No"
},
{
"input": "225307 153572 114545\n154753 153282 149967",
"output": "Yes"
},
{
"input": "438576 124465 629784\n375118 276028 390116",
"output": "Yes"
},
{
"input": "447521 327510 158732\n395759 178458 259139",
"output": "Yes"
},
{
"input": "8 5 5\n5 5 5",
"output": "Yes"
},
{
"input": "100 100 100\n1 1 1",
"output": "Yes"
},
{
"input": "100 100 100\n0 0 0",
"output": "Yes"
},
{
"input": "3 2 3\n2 3 2",
"output": "No"
},
{
"input": "5 4 3\n2 2 2",
"output": "Yes"
},
{
"input": "14 9 8\n12 5 10",
"output": "Yes"
},
{
"input": "10 10 10\n1 1 1",
"output": "Yes"
},
{
"input": "6 3 3\n3 3 3",
"output": "Yes"
},
{
"input": "10 0 4\n2 4 2",
"output": "Yes"
},
{
"input": "100 100 100\n2 2 2",
"output": "Yes"
},
{
"input": "4 6 0\n2 1 2",
"output": "Yes"
},
{
"input": "4 6 3\n4 2 3",
"output": "Yes"
},
{
"input": "5 5 5\n1 1 1",
"output": "Yes"
},
{
"input": "41 17 34\n0 19 24",
"output": "Yes"
},
{
"input": "8 8 8\n3 3 3",
"output": "Yes"
},
{
"input": "7 7 1\n1 1 2",
"output": "Yes"
},
{
"input": "6 6 0\n2 2 2",
"output": "Yes"
},
{
"input": "5 5 5\n2 2 2",
"output": "Yes"
},
{
"input": "400 400 400\n1 1 1",
"output": "Yes"
},
{
"input": "4 4 4\n2 2 2",
"output": "Yes"
}
] | 1,624,367,619
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 79
| 109
| 0
|
a=list(map(int,input().split()))
b=list(map(int,input().split()))
p=0
k=0
for i,j in zip(a,b):
if i>j:
p+=(i-j)//2
if i<j:
k+=j-i
if p>=k:
print('YES')
else:
print('NO')
|
Title: Magic Spheres
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Carl is a beginner magician. He has *a* blue, *b* violet and *c* orange magic spheres. In one move he can transform two spheres of the same color into one sphere of any other color. To make a spell that has never been seen before, he needs at least *x* blue, *y* violet and *z* orange spheres. Can he get them (possible, in multiple actions)?
Input Specification:
The first line of the input contains three integers *a*, *b* and *c* (0<=≤<=*a*,<=*b*,<=*c*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that are in the magician's disposal.
The second line of the input contains three integers, *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that he needs to get.
Output Specification:
If the wizard is able to obtain the required numbers of spheres, print "Yes". Otherwise, print "No".
Demo Input:
['4 4 0\n2 1 2\n', '5 6 1\n2 7 2\n', '3 3 3\n2 2 2\n']
Demo Output:
['Yes\n', 'No\n', 'Yes\n']
Note:
In the first sample the wizard has 4 blue and 4 violet spheres. In his first action he can turn two blue spheres into one violet one. After that he will have 2 blue and 5 violet spheres. Then he turns 4 violet spheres into 2 orange spheres and he ends up with 2 blue, 1 violet and 2 orange spheres, which is exactly what he needs.
|
```python
a=list(map(int,input().split()))
b=list(map(int,input().split()))
p=0
k=0
for i,j in zip(a,b):
if i>j:
p+=(i-j)//2
if i<j:
k+=j-i
if p>=k:
print('YES')
else:
print('NO')
```
| 3
|
|
432
|
A
|
Choosing Teams
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
|
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
|
Print a single number — the answer to the problem.
|
[
"5 2\n0 4 5 1 0\n",
"6 4\n0 1 2 3 4 5\n",
"6 5\n0 0 0 0 0 0\n"
] |
[
"1\n",
"0\n",
"2\n"
] |
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
| 500
|
[
{
"input": "5 2\n0 4 5 1 0",
"output": "1"
},
{
"input": "6 4\n0 1 2 3 4 5",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "3 4\n0 1 0",
"output": "1"
},
{
"input": "3 4\n0 2 0",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "12 2\n0 1 2 3 4 0 1 2 3 4 0 1",
"output": "3"
},
{
"input": "15 2\n0 1 2 3 4 0 1 2 3 4 0 1 2 3 4",
"output": "4"
},
{
"input": "13 1\n5 0 5 0 1 5 0 4 1 1 1 4 1",
"output": "3"
},
{
"input": "20 1\n5 0 4 2 2 3 2 1 2 4 1 3 5 5 5 4 4 1 3 0",
"output": "5"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "6 3\n4 4 4 4 4 4",
"output": "0"
},
{
"input": "1 4\n1",
"output": "0"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "2 3\n0 0",
"output": "0"
}
] | 1,696,945,367
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 35
| 62
| 1,740,800
|
n, k = map(int, input().split())
ans = 0
for el in input().split():
if 5 - int(el) >= k:
ans += 1
print(ans // 3)
|
Title: Choosing Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
Input Specification:
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['5 2\n0 4 5 1 0\n', '6 4\n0 1 2 3 4 5\n', '6 5\n0 0 0 0 0 0\n']
Demo Output:
['1\n', '0\n', '2\n']
Note:
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits.
|
```python
n, k = map(int, input().split())
ans = 0
for el in input().split():
if 5 - int(el) >= k:
ans += 1
print(ans // 3)
```
| 3
|
|
466
|
C
|
Number of Ways
|
PROGRAMMING
| 1,700
|
[
"binary search",
"brute force",
"data structures",
"dp",
"two pointers"
] | null | null |
You've got array *a*[1],<=*a*[2],<=...,<=*a*[*n*], consisting of *n* integers. Count the number of ways to split all the elements of the array into three contiguous parts so that the sum of elements in each part is the same.
More formally, you need to find the number of such pairs of indices *i*,<=*j* (2<=≤<=*i*<=≤<=*j*<=≤<=*n*<=-<=1), that .
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=5·105), showing how many numbers are in the array. The second line contains *n* integers *a*[1], *a*[2], ..., *a*[*n*] (|*a*[*i*]|<=≤<=<=109) — the elements of array *a*.
|
Print a single integer — the number of ways to split the array into three parts with the same sum.
|
[
"5\n1 2 3 0 3\n",
"4\n0 1 -1 0\n",
"2\n4 1\n"
] |
[
"2\n",
"1\n",
"0\n"
] |
none
| 1,500
|
[
{
"input": "5\n1 2 3 0 3",
"output": "2"
},
{
"input": "4\n0 1 -1 0",
"output": "1"
},
{
"input": "2\n4 1",
"output": "0"
},
{
"input": "9\n0 0 0 0 0 0 0 0 0",
"output": "28"
},
{
"input": "10\n2 5 -2 2 -3 -2 3 5 -5 -2",
"output": "0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "3\n1 2 3",
"output": "0"
},
{
"input": "100\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "2030"
},
{
"input": "6\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "10\n1 0 0 0 1 1 1 0 1 1",
"output": "2"
},
{
"input": "10\n-2 2 -2 0 -2 -1 1 -1 2 0",
"output": "0"
},
{
"input": "4\n0 2 -1 2",
"output": "0"
},
{
"input": "5\n3 3 -3 3 3",
"output": "3"
},
{
"input": "5\n1 1 1 1 1",
"output": "0"
},
{
"input": "8\n-1 -1 -1 -1 -1 -1 -1 -1",
"output": "0"
},
{
"input": "2\n0 0",
"output": "0"
},
{
"input": "4\n1 -1 0 0",
"output": "1"
},
{
"input": "3\n6 -3 6",
"output": "0"
}
] | 1,699,352,910
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 577
| 62,464,000
|
n=int(input())
a=[int(i) for i in input().split()]
s=sum(a)
s1=0
ai=[0]*500001
for i in range(n-1):
s1+=a[i]
if s1==s/3:
ai[i]=1
s2=0
aj=[]
for j in range(n-1):
s2+=a[n-j-1]
if s2==s/3:
aj.append(n-j-2)
for i in range(1,n):
ai[i]+=ai[i-1]
num=0
for j in range(len(aj)):
num+=ai[aj[j]-1]
print(num)
|
Title: Number of Ways
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got array *a*[1],<=*a*[2],<=...,<=*a*[*n*], consisting of *n* integers. Count the number of ways to split all the elements of the array into three contiguous parts so that the sum of elements in each part is the same.
More formally, you need to find the number of such pairs of indices *i*,<=*j* (2<=≤<=*i*<=≤<=*j*<=≤<=*n*<=-<=1), that .
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=5·105), showing how many numbers are in the array. The second line contains *n* integers *a*[1], *a*[2], ..., *a*[*n*] (|*a*[*i*]|<=≤<=<=109) — the elements of array *a*.
Output Specification:
Print a single integer — the number of ways to split the array into three parts with the same sum.
Demo Input:
['5\n1 2 3 0 3\n', '4\n0 1 -1 0\n', '2\n4 1\n']
Demo Output:
['2\n', '1\n', '0\n']
Note:
none
|
```python
n=int(input())
a=[int(i) for i in input().split()]
s=sum(a)
s1=0
ai=[0]*500001
for i in range(n-1):
s1+=a[i]
if s1==s/3:
ai[i]=1
s2=0
aj=[]
for j in range(n-1):
s2+=a[n-j-1]
if s2==s/3:
aj.append(n-j-2)
for i in range(1,n):
ai[i]+=ai[i-1]
num=0
for j in range(len(aj)):
num+=ai[aj[j]-1]
print(num)
```
| 3
|
|
208
|
A
|
Dubstep
|
PROGRAMMING
| 900
|
[
"strings"
] | null | null |
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
|
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
|
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
|
[
"WUBWUBABCWUB\n",
"WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n"
] |
[
"ABC ",
"WE ARE THE CHAMPIONS MY FRIEND "
] |
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
| 500
|
[
{
"input": "WUBWUBABCWUB",
"output": "ABC "
},
{
"input": "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB",
"output": "WE ARE THE CHAMPIONS MY FRIEND "
},
{
"input": "WUBWUBWUBSR",
"output": "SR "
},
{
"input": "RWUBWUBWUBLWUB",
"output": "R L "
},
{
"input": "ZJWUBWUBWUBJWUBWUBWUBL",
"output": "ZJ J L "
},
{
"input": "CWUBBWUBWUBWUBEWUBWUBWUBQWUBWUBWUB",
"output": "C B E Q "
},
{
"input": "WUBJKDWUBWUBWBIRAQKFWUBWUBYEWUBWUBWUBWVWUBWUB",
"output": "JKD WBIRAQKF YE WV "
},
{
"input": "WUBKSDHEMIXUJWUBWUBRWUBWUBWUBSWUBWUBWUBHWUBWUBWUB",
"output": "KSDHEMIXUJ R S H "
},
{
"input": "OGWUBWUBWUBXWUBWUBWUBIWUBWUBWUBKOWUBWUB",
"output": "OG X I KO "
},
{
"input": "QWUBQQWUBWUBWUBIWUBWUBWWWUBWUBWUBJOPJPBRH",
"output": "Q QQ I WW JOPJPBRH "
},
{
"input": "VSRNVEATZTLGQRFEGBFPWUBWUBWUBAJWUBWUBWUBPQCHNWUBCWUB",
"output": "VSRNVEATZTLGQRFEGBFP AJ PQCHN C "
},
{
"input": "WUBWUBEWUBWUBWUBIQMJNIQWUBWUBWUBGZZBQZAUHYPWUBWUBWUBPMRWUBWUBWUBDCV",
"output": "E IQMJNIQ GZZBQZAUHYP PMR DCV "
},
{
"input": "WUBWUBWUBFVWUBWUBWUBBPSWUBWUBWUBRXNETCJWUBWUBWUBJDMBHWUBWUBWUBBWUBWUBVWUBWUBB",
"output": "FV BPS RXNETCJ JDMBH B V B "
},
{
"input": "WUBWUBWUBFBQWUBWUBWUBIDFSYWUBWUBWUBCTWDMWUBWUBWUBSXOWUBWUBWUBQIWUBWUBWUBL",
"output": "FBQ IDFSY CTWDM SXO QI L "
},
{
"input": "IWUBWUBQLHDWUBYIIKZDFQWUBWUBWUBCXWUBWUBUWUBWUBWUBKWUBWUBWUBNL",
"output": "I QLHD YIIKZDFQ CX U K NL "
},
{
"input": "KWUBUPDYXGOKUWUBWUBWUBAGOAHWUBIZDWUBWUBWUBIYWUBWUBWUBVWUBWUBWUBPWUBWUBWUBE",
"output": "K UPDYXGOKU AGOAH IZD IY V P E "
},
{
"input": "WUBWUBOWUBWUBWUBIPVCQAFWYWUBWUBWUBQWUBWUBWUBXHDKCPYKCTWWYWUBWUBWUBVWUBWUBWUBFZWUBWUB",
"output": "O IPVCQAFWY Q XHDKCPYKCTWWY V FZ "
},
{
"input": "PAMJGYWUBWUBWUBXGPQMWUBWUBWUBTKGSXUYWUBWUBWUBEWUBWUBWUBNWUBWUBWUBHWUBWUBWUBEWUBWUB",
"output": "PAMJGY XGPQM TKGSXUY E N H E "
},
{
"input": "WUBYYRTSMNWUWUBWUBWUBCWUBWUBWUBCWUBWUBWUBFSYUINDWOBVWUBWUBWUBFWUBWUBWUBAUWUBWUBWUBVWUBWUBWUBJB",
"output": "YYRTSMNWU C C FSYUINDWOBV F AU V JB "
},
{
"input": "WUBWUBYGPYEYBNRTFKOQCWUBWUBWUBUYGRTQEGWLFYWUBWUBWUBFVWUBHPWUBWUBWUBXZQWUBWUBWUBZDWUBWUBWUBM",
"output": "YGPYEYBNRTFKOQC UYGRTQEGWLFY FV HP XZQ ZD M "
},
{
"input": "WUBZVMJWUBWUBWUBFOIMJQWKNZUBOFOFYCCWUBWUBWUBAUWWUBRDRADWUBWUBWUBCHQVWUBWUBWUBKFTWUBWUBWUBW",
"output": "ZVMJ FOIMJQWKNZUBOFOFYCC AUW RDRAD CHQV KFT W "
},
{
"input": "WUBWUBZBKOKHQLGKRVIMZQMQNRWUBWUBWUBDACWUBWUBNZHFJMPEYKRVSWUBWUBWUBPPHGAVVPRZWUBWUBWUBQWUBWUBAWUBG",
"output": "ZBKOKHQLGKRVIMZQMQNR DAC NZHFJMPEYKRVS PPHGAVVPRZ Q A G "
},
{
"input": "WUBWUBJWUBWUBWUBNFLWUBWUBWUBGECAWUBYFKBYJWTGBYHVSSNTINKWSINWSMAWUBWUBWUBFWUBWUBWUBOVWUBWUBLPWUBWUBWUBN",
"output": "J NFL GECA YFKBYJWTGBYHVSSNTINKWSINWSMA F OV LP N "
},
{
"input": "WUBWUBLCWUBWUBWUBZGEQUEATJVIXETVTWUBWUBWUBEXMGWUBWUBWUBRSWUBWUBWUBVWUBWUBWUBTAWUBWUBWUBCWUBWUBWUBQG",
"output": "LC ZGEQUEATJVIXETVT EXMG RS V TA C QG "
},
{
"input": "WUBMPWUBWUBWUBORWUBWUBDLGKWUBWUBWUBVVZQCAAKVJTIKWUBWUBWUBTJLUBZJCILQDIFVZWUBWUBYXWUBWUBWUBQWUBWUBWUBLWUB",
"output": "MP OR DLGK VVZQCAAKVJTIK TJLUBZJCILQDIFVZ YX Q L "
},
{
"input": "WUBNXOLIBKEGXNWUBWUBWUBUWUBGITCNMDQFUAOVLWUBWUBWUBAIJDJZJHFMPVTPOXHPWUBWUBWUBISCIOWUBWUBWUBGWUBWUBWUBUWUB",
"output": "NXOLIBKEGXN U GITCNMDQFUAOVL AIJDJZJHFMPVTPOXHP ISCIO G U "
},
{
"input": "WUBWUBNMMWCZOLYPNBELIYVDNHJUNINWUBWUBWUBDXLHYOWUBWUBWUBOJXUWUBWUBWUBRFHTGJCEFHCGWARGWUBWUBWUBJKWUBWUBSJWUBWUB",
"output": "NMMWCZOLYPNBELIYVDNHJUNIN DXLHYO OJXU RFHTGJCEFHCGWARG JK SJ "
},
{
"input": "SGWLYSAUJOJBNOXNWUBWUBWUBBOSSFWKXPDPDCQEWUBWUBWUBDIRZINODWUBWUBWUBWWUBWUBWUBPPHWUBWUBWUBRWUBWUBWUBQWUBWUBWUBJWUB",
"output": "SGWLYSAUJOJBNOXN BOSSFWKXPDPDCQE DIRZINOD W PPH R Q J "
},
{
"input": "TOWUBWUBWUBGBTBNWUBWUBWUBJVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSAWUBWUBWUBSWUBWUBWUBTOLVXWUBWUBWUBNHWUBWUBWUBO",
"output": "TO GBTBN JVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSA S TOLVX NH O "
},
{
"input": "WUBWUBWSPLAYSZSAUDSWUBWUBWUBUWUBWUBWUBKRWUBWUBWUBRSOKQMZFIYZQUWUBWUBWUBELSHUWUBWUBWUBUKHWUBWUBWUBQXEUHQWUBWUBWUBBWUBWUBWUBR",
"output": "WSPLAYSZSAUDS U KR RSOKQMZFIYZQU ELSHU UKH QXEUHQ B R "
},
{
"input": "WUBXEMWWVUHLSUUGRWUBWUBWUBAWUBXEGILZUNKWUBWUBWUBJDHHKSWUBWUBWUBDTSUYSJHWUBWUBWUBPXFWUBMOHNJWUBWUBWUBZFXVMDWUBWUBWUBZMWUBWUB",
"output": "XEMWWVUHLSUUGR A XEGILZUNK JDHHKS DTSUYSJH PXF MOHNJ ZFXVMD ZM "
},
{
"input": "BMBWUBWUBWUBOQKWUBWUBWUBPITCIHXHCKLRQRUGXJWUBWUBWUBVWUBWUBWUBJCWUBWUBWUBQJPWUBWUBWUBBWUBWUBWUBBMYGIZOOXWUBWUBWUBTAGWUBWUBHWUB",
"output": "BMB OQK PITCIHXHCKLRQRUGXJ V JC QJP B BMYGIZOOX TAG H "
},
{
"input": "CBZNWUBWUBWUBNHWUBWUBWUBYQSYWUBWUBWUBMWUBWUBWUBXRHBTMWUBWUBWUBPCRCWUBWUBWUBTZUYLYOWUBWUBWUBCYGCWUBWUBWUBCLJWUBWUBWUBSWUBWUBWUB",
"output": "CBZN NH YQSY M XRHBTM PCRC TZUYLYO CYGC CLJ S "
},
{
"input": "DPDWUBWUBWUBEUQKWPUHLTLNXHAEKGWUBRRFYCAYZFJDCJLXBAWUBWUBWUBHJWUBOJWUBWUBWUBNHBJEYFWUBWUBWUBRWUBWUBWUBSWUBWWUBWUBWUBXDWUBWUBWUBJWUB",
"output": "DPD EUQKWPUHLTLNXHAEKG RRFYCAYZFJDCJLXBA HJ OJ NHBJEYF R S W XD J "
},
{
"input": "WUBWUBWUBISERPQITVIYERSCNWUBWUBWUBQWUBWUBWUBDGSDIPWUBWUBWUBCAHKDZWEXBIBJVVSKKVQJWUBWUBWUBKIWUBWUBWUBCWUBWUBWUBAWUBWUBWUBPWUBWUBWUBHWUBWUBWUBF",
"output": "ISERPQITVIYERSCN Q DGSDIP CAHKDZWEXBIBJVVSKKVQJ KI C A P H F "
},
{
"input": "WUBWUBWUBIWUBWUBLIKNQVWUBWUBWUBPWUBWUBWUBHWUBWUBWUBMWUBWUBWUBDPRSWUBWUBWUBBSAGYLQEENWXXVWUBWUBWUBXMHOWUBWUBWUBUWUBWUBWUBYRYWUBWUBWUBCWUBWUBWUBY",
"output": "I LIKNQV P H M DPRS BSAGYLQEENWXXV XMHO U YRY C Y "
},
{
"input": "WUBWUBWUBMWUBWUBWUBQWUBWUBWUBITCFEYEWUBWUBWUBHEUWGNDFNZGWKLJWUBWUBWUBMZPWUBWUBWUBUWUBWUBWUBBWUBWUBWUBDTJWUBHZVIWUBWUBWUBPWUBFNHHWUBWUBWUBVTOWUB",
"output": "M Q ITCFEYE HEUWGNDFNZGWKLJ MZP U B DTJ HZVI P FNHH VTO "
},
{
"input": "WUBWUBNDNRFHYJAAUULLHRRDEDHYFSRXJWUBWUBWUBMUJVDTIRSGYZAVWKRGIFWUBWUBWUBHMZWUBWUBWUBVAIWUBWUBWUBDDKJXPZRGWUBWUBWUBSGXWUBWUBWUBIFKWUBWUBWUBUWUBWUBWUBW",
"output": "NDNRFHYJAAUULLHRRDEDHYFSRXJ MUJVDTIRSGYZAVWKRGIF HMZ VAI DDKJXPZRG SGX IFK U W "
},
{
"input": "WUBOJMWRSLAXXHQRTPMJNCMPGWUBWUBWUBNYGMZIXNLAKSQYWDWUBWUBWUBXNIWUBWUBWUBFWUBWUBWUBXMBWUBWUBWUBIWUBWUBWUBINWUBWUBWUBWDWUBWUBWUBDDWUBWUBWUBD",
"output": "OJMWRSLAXXHQRTPMJNCMPG NYGMZIXNLAKSQYWD XNI F XMB I IN WD DD D "
},
{
"input": "WUBWUBWUBREHMWUBWUBWUBXWUBWUBWUBQASNWUBWUBWUBNLSMHLCMTICWUBWUBWUBVAWUBWUBWUBHNWUBWUBWUBNWUBWUBWUBUEXLSFOEULBWUBWUBWUBXWUBWUBWUBJWUBWUBWUBQWUBWUBWUBAWUBWUB",
"output": "REHM X QASN NLSMHLCMTIC VA HN N UEXLSFOEULB X J Q A "
},
{
"input": "WUBWUBWUBSTEZTZEFFIWUBWUBWUBSWUBWUBWUBCWUBFWUBHRJPVWUBWUBWUBDYJUWUBWUBWUBPWYDKCWUBWUBWUBCWUBWUBWUBUUEOGCVHHBWUBWUBWUBEXLWUBWUBWUBVCYWUBWUBWUBMWUBWUBWUBYWUB",
"output": "STEZTZEFFI S C F HRJPV DYJU PWYDKC C UUEOGCVHHB EXL VCY M Y "
},
{
"input": "WPPNMSQOQIWUBWUBWUBPNQXWUBWUBWUBHWUBWUBWUBNFLWUBWUBWUBGWSGAHVJFNUWUBWUBWUBFWUBWUBWUBWCMLRICFSCQQQTNBWUBWUBWUBSWUBWUBWUBKGWUBWUBWUBCWUBWUBWUBBMWUBWUBWUBRWUBWUB",
"output": "WPPNMSQOQI PNQX H NFL GWSGAHVJFNU F WCMLRICFSCQQQTNB S KG C BM R "
},
{
"input": "YZJOOYITZRARKVFYWUBWUBRZQGWUBWUBWUBUOQWUBWUBWUBIWUBWUBWUBNKVDTBOLETKZISTWUBWUBWUBWLWUBQQFMMGSONZMAWUBZWUBWUBWUBQZUXGCWUBWUBWUBIRZWUBWUBWUBLTTVTLCWUBWUBWUBY",
"output": "YZJOOYITZRARKVFY RZQG UOQ I NKVDTBOLETKZIST WL QQFMMGSONZMA Z QZUXGC IRZ LTTVTLC Y "
},
{
"input": "WUBCAXNCKFBVZLGCBWCOAWVWOFKZVQYLVTWUBWUBWUBNLGWUBWUBWUBAMGDZBDHZMRMQMDLIRMIWUBWUBWUBGAJSHTBSWUBWUBWUBCXWUBWUBWUBYWUBZLXAWWUBWUBWUBOHWUBWUBWUBZWUBWUBWUBGBWUBWUBWUBE",
"output": "CAXNCKFBVZLGCBWCOAWVWOFKZVQYLVT NLG AMGDZBDHZMRMQMDLIRMI GAJSHTBS CX Y ZLXAW OH Z GB E "
},
{
"input": "WUBWUBCHXSOWTSQWUBWUBWUBCYUZBPBWUBWUBWUBSGWUBWUBWKWORLRRLQYUUFDNWUBWUBWUBYYGOJNEVEMWUBWUBWUBRWUBWUBWUBQWUBWUBWUBIHCKWUBWUBWUBKTWUBWUBWUBRGSNTGGWUBWUBWUBXCXWUBWUBWUBS",
"output": "CHXSOWTSQ CYUZBPB SG WKWORLRRLQYUUFDN YYGOJNEVEM R Q IHCK KT RGSNTGG XCX S "
},
{
"input": "WUBWUBWUBHJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQWUBWUBWUBXTZKGIITWUBWUBWUBAWUBWUBWUBVNCXPUBCQWUBWUBWUBIDPNAWUBWUBWUBOWUBWUBWUBYGFWUBWUBWUBMQOWUBWUBWUBKWUBWUBWUBAZVWUBWUBWUBEP",
"output": "HJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQ XTZKGIIT A VNCXPUBCQ IDPNA O YGF MQO K AZV EP "
},
{
"input": "WUBKYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTVWUBWUBWUBLRMIIWUBWUBWUBGWUBWUBWUBADPSWUBWUBWUBANBWUBWUBPCWUBWUBWUBPWUBWUBWUBGPVNLSWIRFORYGAABUXMWUBWUBWUBOWUBWUBWUBNWUBWUBWUBYWUBWUB",
"output": "KYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTV LRMII G ADPS ANB PC P GPVNLSWIRFORYGAABUXM O N Y "
},
{
"input": "REWUBWUBWUBJDWUBWUBWUBNWUBWUBWUBTWWUBWUBWUBWZDOCKKWUBWUBWUBLDPOVBFRCFWUBWUBAKZIBQKEUAZEEWUBWUBWUBLQYPNPFWUBYEWUBWUBWUBFWUBWUBWUBBPWUBWUBWUBAWWUBWUBWUBQWUBWUBWUBBRWUBWUBWUBXJL",
"output": "RE JD N TW WZDOCKK LDPOVBFRCF AKZIBQKEUAZEE LQYPNPF YE F BP AW Q BR XJL "
},
{
"input": "CUFGJDXGMWUBWUBWUBOMWUBWUBWUBSIEWUBWUBWUBJJWKNOWUBWUBWUBYBHVNRNORGYWUBWUBWUBOAGCAWUBWUBWUBSBLBKTPFKPBIWUBWUBWUBJBWUBWUBWUBRMFCJPGWUBWUBWUBDWUBWUBWUBOJOWUBWUBWUBZPWUBWUBWUBMWUBRWUBWUBWUBFXWWUBWUBWUBO",
"output": "CUFGJDXGM OM SIE JJWKNO YBHVNRNORGY OAGCA SBLBKTPFKPBI JB RMFCJPG D OJO ZP M R FXW O "
},
{
"input": "WUBJZGAEXFMFEWMAKGQLUWUBWUBWUBICYTPQWGENELVYWANKUOJYWUBWUBWUBGWUBWUBWUBHYCJVLPHTUPNEGKCDGQWUBWUBWUBOFWUBWUBWUBCPGSOGZBRPRPVJJEWUBWUBWUBDQBCWUBWUBWUBHWUBWUBWUBMHOHYBMATWUBWUBWUBVWUBWUBWUBSWUBWUBWUBKOWU",
"output": "JZGAEXFMFEWMAKGQLU ICYTPQWGENELVYWANKUOJY G HYCJVLPHTUPNEGKCDGQ OF CPGSOGZBRPRPVJJE DQBC H MHOHYBMAT V S KOWU "
},
{
"input": "A",
"output": "A "
},
{
"input": "WUBA",
"output": "A "
},
{
"input": "WUBWUBA",
"output": "A "
},
{
"input": "AWUBWUBWUB",
"output": "A "
},
{
"input": "AWUBBWUBCWUBD",
"output": "A B C D "
},
{
"input": "WUBWWUBWUBWUBUWUBWUBBWUB",
"output": "W U B "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAWUBAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "WUWUBBWWUBUB",
"output": "WU BW UB "
},
{
"input": "WUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUABWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUB",
"output": "WUAB "
},
{
"input": "ZWUB",
"output": "Z "
},
{
"input": "WU",
"output": "WU "
},
{
"input": "UB",
"output": "UB "
},
{
"input": "U",
"output": "U "
},
{
"input": "WUBW",
"output": "W "
},
{
"input": "WUBWU",
"output": "WU "
},
{
"input": "WUWUB",
"output": "WU "
},
{
"input": "UBWUB",
"output": "UB "
},
{
"input": "WUWUBUBWUBUWUB",
"output": "WU UB U "
},
{
"input": "WUBWWUBAWUB",
"output": "W A "
},
{
"input": "WUUUUU",
"output": "WUUUUU "
}
] | 1,689,066,052
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 71
| 92
| 0
|
s=input()
s=s.replace("WUB"," ")
ans=""
for i in s.split():
if(i!=" "):
ans=ans+i+" "
print(ans)
|
Title: Dubstep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
Input Specification:
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
Output Specification:
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
Demo Input:
['WUBWUBABCWUB\n', 'WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n']
Demo Output:
['ABC ', 'WE ARE THE CHAMPIONS MY FRIEND ']
Note:
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
|
```python
s=input()
s=s.replace("WUB"," ")
ans=""
for i in s.split():
if(i!=" "):
ans=ans+i+" "
print(ans)
```
| 3
|
|
312
|
B
|
Archer
|
PROGRAMMING
| 1,300
|
[
"math",
"probabilities"
] | null | null |
SmallR is an archer. SmallR is taking a match of archer with Zanoes. They try to shoot in the target in turns, and SmallR shoots first. The probability of shooting the target each time is for SmallR while for Zanoes. The one who shoots in the target first should be the winner.
Output the probability that SmallR will win the match.
|
A single line contains four integers .
|
Print a single real number, the probability that SmallR will win the match.
The answer will be considered correct if the absolute or relative error doesn't exceed 10<=-<=6.
|
[
"1 2 1 2\n"
] |
[
"0.666666666667"
] |
none
| 1,000
|
[
{
"input": "1 2 1 2",
"output": "0.666666666667"
},
{
"input": "1 3 1 3",
"output": "0.600000000000"
},
{
"input": "1 3 2 3",
"output": "0.428571428571"
},
{
"input": "3 4 3 4",
"output": "0.800000000000"
},
{
"input": "1 2 10 11",
"output": "0.523809523810"
},
{
"input": "4 5 4 5",
"output": "0.833333333333"
},
{
"input": "466 701 95 721",
"output": "0.937693791148"
},
{
"input": "268 470 444 885",
"output": "0.725614009325"
},
{
"input": "632 916 713 821",
"output": "0.719292895126"
},
{
"input": "269 656 918 992",
"output": "0.428937461623"
},
{
"input": "71 657 187 695",
"output": "0.310488463257"
},
{
"input": "435 852 973 978",
"output": "0.511844133157"
},
{
"input": "518 816 243 359",
"output": "0.719734031025"
},
{
"input": "882 962 311 811",
"output": "0.966386645447"
},
{
"input": "684 774 580 736",
"output": "0.906051574446"
},
{
"input": "486 868 929 999",
"output": "0.577723252958"
},
{
"input": "132 359 996 998",
"output": "0.368154532345"
},
{
"input": "933 977 266 450",
"output": "0.972879407907"
},
{
"input": "298 833 615 872",
"output": "0.441270817024"
},
{
"input": "34 554 14 958",
"output": "0.817324099167"
},
{
"input": "836 934 800 905",
"output": "0.906105535462"
},
{
"input": "482 815 69 509",
"output": "0.914365577772"
},
{
"input": "284 423 137 521",
"output": "0.885974839378"
},
{
"input": "648 881 486 703",
"output": "0.800911421248"
},
{
"input": "450 885 755 836",
"output": "0.533901011176"
},
{
"input": "533 773 823 998",
"output": "0.729222130525"
},
{
"input": "897 957 92 898",
"output": "0.993193806364"
},
{
"input": "699 925 441 928",
"output": "0.866816866175"
},
{
"input": "64 704 148 603",
"output": "0.289486317811"
},
{
"input": "719 735 626 990",
"output": "0.986124079764"
},
{
"input": "1 1000 1 1000",
"output": "0.500250125063"
}
] | 1,612,695,630
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 31
| 171
| 3,993,600
|
import sys
input=sys.stdin.readline
from collections import defaultdict as dc
from collections import Counter
from bisect import bisect_right, bisect_left
import math
from operator import itemgetter
from heapq import heapify, heappop, heappush
from queue import PriorityQueue as pq
a,b,c,d=map(int,input().split())
x,y=a/b,c/d
z=(1-x)*(1-y)
s=1/(1-z)
print(x*s)
|
Title: Archer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
SmallR is an archer. SmallR is taking a match of archer with Zanoes. They try to shoot in the target in turns, and SmallR shoots first. The probability of shooting the target each time is for SmallR while for Zanoes. The one who shoots in the target first should be the winner.
Output the probability that SmallR will win the match.
Input Specification:
A single line contains four integers .
Output Specification:
Print a single real number, the probability that SmallR will win the match.
The answer will be considered correct if the absolute or relative error doesn't exceed 10<=-<=6.
Demo Input:
['1 2 1 2\n']
Demo Output:
['0.666666666667']
Note:
none
|
```python
import sys
input=sys.stdin.readline
from collections import defaultdict as dc
from collections import Counter
from bisect import bisect_right, bisect_left
import math
from operator import itemgetter
from heapq import heapify, heappop, heappush
from queue import PriorityQueue as pq
a,b,c,d=map(int,input().split())
x,y=a/b,c/d
z=(1-x)*(1-y)
s=1/(1-z)
print(x*s)
```
| 3
|
|
660
|
A
|
Co-prime Array
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation",
"math",
"number theory"
] | null | null |
You are given an array of *n* elements, you must make it a co-prime array in as few moves as possible.
In each move you can insert any positive integral number you want not greater than 109 in any place in the array.
An array is co-prime if any two adjacent numbers of it are co-prime.
In the number theory, two integers *a* and *b* are said to be co-prime if the only positive integer that divides both of them is 1.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of elements in the given array.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the elements of the array *a*.
|
Print integer *k* on the first line — the least number of elements needed to add to the array *a* to make it co-prime.
The second line should contain *n*<=+<=*k* integers *a**j* — the elements of the array *a* after adding *k* elements to it. Note that the new array should be co-prime, so any two adjacent values should be co-prime. Also the new array should be got from the original array *a* by adding *k* elements to it.
If there are multiple answers you can print any one of them.
|
[
"3\n2 7 28\n"
] |
[
"1\n2 7 9 28\n"
] |
none
| 0
|
[
{
"input": "3\n2 7 28",
"output": "1\n2 7 1 28"
},
{
"input": "1\n1",
"output": "0\n1"
},
{
"input": "1\n548",
"output": "0\n548"
},
{
"input": "1\n963837006",
"output": "0\n963837006"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "0\n1 1 1 1 1 1 1 1 1 1"
},
{
"input": "10\n26 723 970 13 422 968 875 329 234 983",
"output": "2\n26 723 970 13 422 1 968 875 1 329 234 983"
},
{
"input": "10\n319645572 758298525 812547177 459359946 355467212 304450522 807957797 916787906 239781206 242840396",
"output": "7\n319645572 1 758298525 1 812547177 1 459359946 1 355467212 1 304450522 807957797 916787906 1 239781206 1 242840396"
},
{
"input": "100\n1 1 1 1 2 1 1 1 1 1 2 2 1 1 2 1 2 1 1 1 2 1 1 2 1 2 1 1 2 2 2 1 1 2 1 1 1 2 2 2 1 1 1 2 1 2 2 1 2 1 1 2 2 1 2 1 2 1 2 2 1 1 1 2 1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 1 1 1 1 2 2 2 2 2 2 2 1 1 1 2 1 2 1",
"output": "19\n1 1 1 1 2 1 1 1 1 1 2 1 2 1 1 2 1 2 1 1 1 2 1 1 2 1 2 1 1 2 1 2 1 2 1 1 2 1 1 1 2 1 2 1 2 1 1 1 2 1 2 1 2 1 2 1 1 2 1 2 1 2 1 2 1 2 1 2 1 1 1 2 1 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 1 1 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 1 1 2 1 2 1"
},
{
"input": "100\n591 417 888 251 792 847 685 3 182 461 102 348 555 956 771 901 712 878 580 631 342 333 285 899 525 725 537 718 929 653 84 788 104 355 624 803 253 853 201 995 536 184 65 205 540 652 549 777 248 405 677 950 431 580 600 846 328 429 134 983 526 103 500 963 400 23 276 704 570 757 410 658 507 620 984 244 486 454 802 411 985 303 635 283 96 597 855 775 139 839 839 61 219 986 776 72 729 69 20 917",
"output": "38\n591 1 417 1 888 251 792 1 847 685 3 182 461 102 1 348 1 555 956 771 901 712 1 878 1 580 631 342 1 333 1 285 899 525 1 725 537 718 929 653 84 1 788 1 104 355 624 803 1 253 853 201 995 536 1 184 65 1 205 1 540 1 652 549 1 777 248 405 677 950 431 580 1 600 1 846 1 328 429 134 983 526 103 500 963 400 23 1 276 1 704 1 570 757 410 1 658 507 620 1 984 1 244 1 486 1 454 1 802 411 985 303 635 283 96 1 597 1 855 1 775 139 839 1 839 61 219 986 1 776 1 72 1 729 1 69 20 917"
},
{
"input": "5\n472882027 472882027 472882027 472882027 472882027",
"output": "4\n472882027 1 472882027 1 472882027 1 472882027 1 472882027"
},
{
"input": "2\n1000000000 1000000000",
"output": "1\n1000000000 1 1000000000"
},
{
"input": "2\n8 6",
"output": "1\n8 1 6"
},
{
"input": "3\n100000000 1000000000 1000000000",
"output": "2\n100000000 1 1000000000 1 1000000000"
},
{
"input": "5\n1 2 3 4 5",
"output": "0\n1 2 3 4 5"
},
{
"input": "20\n2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000",
"output": "19\n2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000"
},
{
"input": "2\n223092870 23",
"output": "1\n223092870 1 23"
},
{
"input": "2\n100000003 100000003",
"output": "1\n100000003 1 100000003"
},
{
"input": "2\n999999937 999999937",
"output": "1\n999999937 1 999999937"
},
{
"input": "4\n999 999999937 999999937 999",
"output": "1\n999 999999937 1 999999937 999"
},
{
"input": "2\n999999929 999999929",
"output": "1\n999999929 1 999999929"
},
{
"input": "2\n1049459 2098918",
"output": "1\n1049459 1 2098918"
},
{
"input": "2\n352229 704458",
"output": "1\n352229 1 704458"
},
{
"input": "2\n7293 4011",
"output": "1\n7293 1 4011"
},
{
"input": "2\n5565651 3999930",
"output": "1\n5565651 1 3999930"
},
{
"input": "2\n997 997",
"output": "1\n997 1 997"
},
{
"input": "3\n9994223 9994223 9994223",
"output": "2\n9994223 1 9994223 1 9994223"
},
{
"input": "2\n99999998 1000000000",
"output": "1\n99999998 1 1000000000"
},
{
"input": "3\n1000000000 1000000000 1000000000",
"output": "2\n1000000000 1 1000000000 1 1000000000"
},
{
"input": "2\n130471 130471",
"output": "1\n130471 1 130471"
},
{
"input": "3\n1000000000 2 2",
"output": "2\n1000000000 1 2 1 2"
},
{
"input": "2\n223092870 66526",
"output": "1\n223092870 1 66526"
},
{
"input": "14\n1000000000 1000000000 223092870 223092870 6 105 2 2 510510 510510 999999491 999999491 436077930 570018449",
"output": "10\n1000000000 1 1000000000 1 223092870 1 223092870 1 6 1 105 2 1 2 1 510510 1 510510 999999491 1 999999491 436077930 1 570018449"
},
{
"input": "2\n3996017 3996017",
"output": "1\n3996017 1 3996017"
},
{
"input": "2\n999983 999983",
"output": "1\n999983 1 999983"
},
{
"input": "2\n618575685 773990454",
"output": "1\n618575685 1 773990454"
},
{
"input": "3\n9699690 3 7",
"output": "1\n9699690 1 3 7"
},
{
"input": "2\n999999999 999999996",
"output": "1\n999999999 1 999999996"
},
{
"input": "2\n99999910 99999910",
"output": "1\n99999910 1 99999910"
},
{
"input": "12\n1000000000 1000000000 223092870 223092870 6 105 2 2 510510 510510 999999491 999999491",
"output": "9\n1000000000 1 1000000000 1 223092870 1 223092870 1 6 1 105 2 1 2 1 510510 1 510510 999999491 1 999999491"
},
{
"input": "3\n999999937 999999937 999999937",
"output": "2\n999999937 1 999999937 1 999999937"
},
{
"input": "2\n99839 99839",
"output": "1\n99839 1 99839"
},
{
"input": "3\n19999909 19999909 19999909",
"output": "2\n19999909 1 19999909 1 19999909"
},
{
"input": "4\n1 1000000000 1 1000000000",
"output": "0\n1 1000000000 1 1000000000"
},
{
"input": "2\n64006 64006",
"output": "1\n64006 1 64006"
},
{
"input": "2\n1956955 1956955",
"output": "1\n1956955 1 1956955"
},
{
"input": "3\n1 1000000000 1000000000",
"output": "1\n1 1000000000 1 1000000000"
},
{
"input": "2\n982451707 982451707",
"output": "1\n982451707 1 982451707"
},
{
"input": "2\n999999733 999999733",
"output": "1\n999999733 1 999999733"
},
{
"input": "3\n999999733 999999733 999999733",
"output": "2\n999999733 1 999999733 1 999999733"
},
{
"input": "2\n3257 3257",
"output": "1\n3257 1 3257"
},
{
"input": "2\n223092870 181598",
"output": "1\n223092870 1 181598"
},
{
"input": "3\n959919409 105935 105935",
"output": "2\n959919409 1 105935 1 105935"
},
{
"input": "2\n510510 510510",
"output": "1\n510510 1 510510"
},
{
"input": "3\n223092870 1000000000 1000000000",
"output": "2\n223092870 1 1000000000 1 1000000000"
},
{
"input": "14\n1000000000 2 1000000000 3 1000000000 6 1000000000 1000000000 15 1000000000 1000000000 1000000000 100000000 1000",
"output": "11\n1000000000 1 2 1 1000000000 3 1000000000 1 6 1 1000000000 1 1000000000 1 15 1 1000000000 1 1000000000 1 1000000000 1 100000000 1 1000"
},
{
"input": "7\n1 982451653 982451653 1 982451653 982451653 982451653",
"output": "3\n1 982451653 1 982451653 1 982451653 1 982451653 1 982451653"
},
{
"input": "2\n100000007 100000007",
"output": "1\n100000007 1 100000007"
},
{
"input": "3\n999999757 999999757 999999757",
"output": "2\n999999757 1 999999757 1 999999757"
},
{
"input": "3\n99999989 99999989 99999989",
"output": "2\n99999989 1 99999989 1 99999989"
},
{
"input": "5\n2 4 982451707 982451707 3",
"output": "2\n2 1 4 982451707 1 982451707 3"
},
{
"input": "2\n20000014 20000014",
"output": "1\n20000014 1 20000014"
},
{
"input": "2\n99999989 99999989",
"output": "1\n99999989 1 99999989"
},
{
"input": "2\n111546435 111546435",
"output": "1\n111546435 1 111546435"
},
{
"input": "2\n55288874 33538046",
"output": "1\n55288874 1 33538046"
},
{
"input": "5\n179424673 179424673 179424673 179424673 179424673",
"output": "4\n179424673 1 179424673 1 179424673 1 179424673 1 179424673"
},
{
"input": "2\n199999978 199999978",
"output": "1\n199999978 1 199999978"
},
{
"input": "2\n1000000000 2",
"output": "1\n1000000000 1 2"
},
{
"input": "3\n19999897 19999897 19999897",
"output": "2\n19999897 1 19999897 1 19999897"
},
{
"input": "2\n19999982 19999982",
"output": "1\n19999982 1 19999982"
},
{
"input": "2\n10000007 10000007",
"output": "1\n10000007 1 10000007"
},
{
"input": "3\n999999937 999999937 2",
"output": "1\n999999937 1 999999937 2"
},
{
"input": "5\n2017 2017 2017 2017 2017",
"output": "4\n2017 1 2017 1 2017 1 2017 1 2017"
},
{
"input": "2\n19999909 39999818",
"output": "1\n19999909 1 39999818"
},
{
"input": "2\n62615533 7919",
"output": "1\n62615533 1 7919"
},
{
"input": "5\n39989 39989 33 31 29",
"output": "1\n39989 1 39989 33 31 29"
},
{
"input": "2\n1000000000 100000",
"output": "1\n1000000000 1 100000"
},
{
"input": "2\n1938 10010",
"output": "1\n1938 1 10010"
},
{
"input": "2\n199999 199999",
"output": "1\n199999 1 199999"
},
{
"input": "2\n107273 107273",
"output": "1\n107273 1 107273"
},
{
"input": "3\n49999 49999 49999",
"output": "2\n49999 1 49999 1 49999"
},
{
"input": "2\n1999966 1999958",
"output": "1\n1999966 1 1999958"
},
{
"input": "2\n86020 300846",
"output": "1\n86020 1 300846"
},
{
"input": "2\n999999997 213",
"output": "1\n999999997 1 213"
},
{
"input": "2\n200000014 200000434",
"output": "1\n200000014 1 200000434"
}
] | 1,463,573,892
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 93
| 77
| 5,222,400
|
n = int(input())
numbers = iter(map(int, input().split()))
from math import gcd
insert_counter = 0
b = next(numbers)
result = [b]
for _ in range(n - 1):
a = b
b = next(numbers)
if gcd(a, b) != 1:
insert_counter += 1
result.append(1)
result.append(b)
print(insert_counter)
[print(number, end=' ') for number in result]
|
Title: Co-prime Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an array of *n* elements, you must make it a co-prime array in as few moves as possible.
In each move you can insert any positive integral number you want not greater than 109 in any place in the array.
An array is co-prime if any two adjacent numbers of it are co-prime.
In the number theory, two integers *a* and *b* are said to be co-prime if the only positive integer that divides both of them is 1.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of elements in the given array.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the elements of the array *a*.
Output Specification:
Print integer *k* on the first line — the least number of elements needed to add to the array *a* to make it co-prime.
The second line should contain *n*<=+<=*k* integers *a**j* — the elements of the array *a* after adding *k* elements to it. Note that the new array should be co-prime, so any two adjacent values should be co-prime. Also the new array should be got from the original array *a* by adding *k* elements to it.
If there are multiple answers you can print any one of them.
Demo Input:
['3\n2 7 28\n']
Demo Output:
['1\n2 7 9 28\n']
Note:
none
|
```python
n = int(input())
numbers = iter(map(int, input().split()))
from math import gcd
insert_counter = 0
b = next(numbers)
result = [b]
for _ in range(n - 1):
a = b
b = next(numbers)
if gcd(a, b) != 1:
insert_counter += 1
result.append(1)
result.append(b)
print(insert_counter)
[print(number, end=' ') for number in result]
```
| 3
|
|
527
|
A
|
Playing with Paper
|
PROGRAMMING
| 1,100
|
[
"implementation",
"math"
] | null | null |
One day Vasya was sitting on a not so interesting Maths lesson and making an origami from a rectangular *a* mm <=×<= *b* mm sheet of paper (*a*<=><=*b*). Usually the first step in making an origami is making a square piece of paper from the rectangular sheet by folding the sheet along the bisector of the right angle, and cutting the excess part.
After making a paper ship from the square piece, Vasya looked on the remaining (*a*<=-<=*b*) mm <=×<= *b* mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop.
Can you determine how many ships Vasya will make during the lesson?
|
The first line of the input contains two integers *a*, *b* (1<=≤<=*b*<=<<=*a*<=≤<=1012) — the sizes of the original sheet of paper.
|
Print a single integer — the number of ships that Vasya will make.
|
[
"2 1\n",
"10 7\n",
"1000000000000 1\n"
] |
[
"2\n",
"6\n",
"1000000000000\n"
] |
Pictures to the first and second sample test.
| 500
|
[
{
"input": "2 1",
"output": "2"
},
{
"input": "10 7",
"output": "6"
},
{
"input": "1000000000000 1",
"output": "1000000000000"
},
{
"input": "3 1",
"output": "3"
},
{
"input": "4 1",
"output": "4"
},
{
"input": "3 2",
"output": "3"
},
{
"input": "4 2",
"output": "2"
},
{
"input": "1000 700",
"output": "6"
},
{
"input": "959986566087 524054155168",
"output": "90"
},
{
"input": "4 3",
"output": "4"
},
{
"input": "7 6",
"output": "7"
},
{
"input": "1000 999",
"output": "1000"
},
{
"input": "1000 998",
"output": "500"
},
{
"input": "1000 997",
"output": "336"
},
{
"input": "42 1",
"output": "42"
},
{
"input": "1000 1",
"output": "1000"
},
{
"input": "8 5",
"output": "5"
},
{
"input": "13 8",
"output": "6"
},
{
"input": "987 610",
"output": "15"
},
{
"input": "442 42",
"output": "22"
},
{
"input": "754 466",
"output": "13"
},
{
"input": "1000000000000 999999999999",
"output": "1000000000000"
},
{
"input": "1000000000000 999999999998",
"output": "500000000000"
},
{
"input": "941 14",
"output": "74"
},
{
"input": "998 2",
"output": "499"
},
{
"input": "1000 42",
"output": "32"
},
{
"input": "1000 17",
"output": "66"
},
{
"input": "5 1",
"output": "5"
},
{
"input": "5 2",
"output": "4"
},
{
"input": "5 3",
"output": "4"
},
{
"input": "5 4",
"output": "5"
},
{
"input": "293 210",
"output": "17"
},
{
"input": "787878787878 424242424242",
"output": "8"
},
{
"input": "956722026041 591286729879",
"output": "58"
},
{
"input": "956722026041 365435296162",
"output": "58"
},
{
"input": "628625247282 464807889701",
"output": "102"
},
{
"input": "695928431619 424778620208",
"output": "167"
},
{
"input": "1000000000000 42",
"output": "23809523821"
},
{
"input": "987654345678 23",
"output": "42941493300"
},
{
"input": "10000000001 2",
"output": "5000000002"
},
{
"input": "1000000000000 2",
"output": "500000000000"
},
{
"input": "1000000000000 3",
"output": "333333333336"
},
{
"input": "100000000000 3",
"output": "33333333336"
},
{
"input": "100000000000 23",
"output": "4347826109"
},
{
"input": "999999999997 7",
"output": "142857142861"
},
{
"input": "8589934592 4294967296",
"output": "2"
}
] | 1,589,656,709
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 46
| 140
| 20,172,800
|
a, b = [int(i) for i in input().split()]
q = a//b
ans = q
while (a - q*b != 0):
x = a - q*b
a = b
b = x
q = a//b
ans += q
print(ans)
|
Title: Playing with Paper
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya was sitting on a not so interesting Maths lesson and making an origami from a rectangular *a* mm <=×<= *b* mm sheet of paper (*a*<=><=*b*). Usually the first step in making an origami is making a square piece of paper from the rectangular sheet by folding the sheet along the bisector of the right angle, and cutting the excess part.
After making a paper ship from the square piece, Vasya looked on the remaining (*a*<=-<=*b*) mm <=×<= *b* mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop.
Can you determine how many ships Vasya will make during the lesson?
Input Specification:
The first line of the input contains two integers *a*, *b* (1<=≤<=*b*<=<<=*a*<=≤<=1012) — the sizes of the original sheet of paper.
Output Specification:
Print a single integer — the number of ships that Vasya will make.
Demo Input:
['2 1\n', '10 7\n', '1000000000000 1\n']
Demo Output:
['2\n', '6\n', '1000000000000\n']
Note:
Pictures to the first and second sample test.
|
```python
a, b = [int(i) for i in input().split()]
q = a//b
ans = q
while (a - q*b != 0):
x = a - q*b
a = b
b = x
q = a//b
ans += q
print(ans)
```
| 3
|
|
385
|
B
|
Bear and Strings
|
PROGRAMMING
| 1,200
|
[
"brute force",
"greedy",
"implementation",
"math",
"strings"
] | null | null |
The bear has a string *s*<==<=*s*1*s*2... *s*|*s*| (record |*s*| is the string's length), consisting of lowercase English letters. The bear wants to count the number of such pairs of indices *i*,<=*j* (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|), that string *x*(*i*,<=*j*)<==<=*s**i**s**i*<=+<=1... *s**j* contains at least one string "bear" as a substring.
String *x*(*i*,<=*j*) contains string "bear", if there is such index *k* (*i*<=≤<=*k*<=≤<=*j*<=-<=3), that *s**k*<==<=*b*, *s**k*<=+<=1<==<=*e*, *s**k*<=+<=2<==<=*a*, *s**k*<=+<=3<==<=*r*.
Help the bear cope with the given problem.
|
The first line contains a non-empty string *s* (1<=≤<=|*s*|<=≤<=5000). It is guaranteed that the string only consists of lowercase English letters.
|
Print a single number — the answer to the problem.
|
[
"bearbtear\n",
"bearaabearc\n"
] |
[
"6\n",
"20\n"
] |
In the first sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9).
In the second sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9), (1, 10), (1, 11), (2, 10), (2, 11), (3, 10), (3, 11), (4, 10), (4, 11), (5, 10), (5, 11), (6, 10), (6, 11), (7, 10), (7, 11).
| 1,000
|
[
{
"input": "bearbtear",
"output": "6"
},
{
"input": "bearaabearc",
"output": "20"
},
{
"input": "pbearbearhbearzqbearjkterasjhy",
"output": "291"
},
{
"input": "pbearjbearbebearnbabcffbearbearwubearjezpiorrbearbearjbdlbearbearqbearjbearwipmsbearoaftrsebearzsnqb",
"output": "4419"
},
{
"input": "bear",
"output": "1"
},
{
"input": "a",
"output": "0"
},
{
"input": "be",
"output": "0"
}
] | 1,662,430,962
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 43
| 46
| 0
|
word = "bear"
my_word = input()
ans = 0
last_b = 0
for i in range(len(my_word) - 3):
if my_word[i:i + 4] == word:
before = i - last_b
after = len(my_word) - (i + 4)
ans += (before + 1) * (after + 1)
last_b = i + 1
print(ans)
|
Title: Bear and Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The bear has a string *s*<==<=*s*1*s*2... *s*|*s*| (record |*s*| is the string's length), consisting of lowercase English letters. The bear wants to count the number of such pairs of indices *i*,<=*j* (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|), that string *x*(*i*,<=*j*)<==<=*s**i**s**i*<=+<=1... *s**j* contains at least one string "bear" as a substring.
String *x*(*i*,<=*j*) contains string "bear", if there is such index *k* (*i*<=≤<=*k*<=≤<=*j*<=-<=3), that *s**k*<==<=*b*, *s**k*<=+<=1<==<=*e*, *s**k*<=+<=2<==<=*a*, *s**k*<=+<=3<==<=*r*.
Help the bear cope with the given problem.
Input Specification:
The first line contains a non-empty string *s* (1<=≤<=|*s*|<=≤<=5000). It is guaranteed that the string only consists of lowercase English letters.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['bearbtear\n', 'bearaabearc\n']
Demo Output:
['6\n', '20\n']
Note:
In the first sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9).
In the second sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9), (1, 10), (1, 11), (2, 10), (2, 11), (3, 10), (3, 11), (4, 10), (4, 11), (5, 10), (5, 11), (6, 10), (6, 11), (7, 10), (7, 11).
|
```python
word = "bear"
my_word = input()
ans = 0
last_b = 0
for i in range(len(my_word) - 3):
if my_word[i:i + 4] == word:
before = i - last_b
after = len(my_word) - (i + 4)
ans += (before + 1) * (after + 1)
last_b = i + 1
print(ans)
```
| 3
|
|
161
|
A
|
Dress'em in Vests!
|
PROGRAMMING
| 1,300
|
[
"binary search",
"brute force",
"greedy",
"two pointers"
] | null | null |
The Two-dimensional kingdom is going through hard times... This morning the Three-Dimensional kingdom declared war on the Two-dimensional one. This (possibly armed) conflict will determine the ultimate owner of the straight line.
The Two-dimensional kingdom has a regular army of *n* people. Each soldier registered himself and indicated the desired size of the bulletproof vest: the *i*-th soldier indicated size *a**i*. The soldiers are known to be unpretentious, so the command staff assumes that the soldiers are comfortable in any vests with sizes from *a**i*<=-<=*x* to *a**i*<=+<=*y*, inclusive (numbers *x*,<=*y*<=≥<=0 are specified).
The Two-dimensional kingdom has *m* vests at its disposal, the *j*-th vest's size equals *b**j*. Help mobilize the Two-dimensional kingdom's army: equip with vests as many soldiers as possible. Each vest can be used only once. The *i*-th soldier can put on the *j*-th vest, if *a**i*<=-<=*x*<=≤<=*b**j*<=≤<=*a**i*<=+<=*y*.
|
The first input line contains four integers *n*, *m*, *x* and *y* (1<=≤<=*n*,<=*m*<=≤<=105, 0<=≤<=*x*,<=*y*<=≤<=109) — the number of soldiers, the number of vests and two numbers that specify the soldiers' unpretentiousness, correspondingly.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) in non-decreasing order, separated by single spaces — the desired sizes of vests.
The third line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**j*<=≤<=109) in non-decreasing order, separated by single spaces — the sizes of the available vests.
|
In the first line print a single integer *k* — the maximum number of soldiers equipped with bulletproof vests.
In the next *k* lines print *k* pairs, one pair per line, as "*u**i* *v**i*" (without the quotes). Pair (*u**i*, *v**i*) means that soldier number *u**i* must wear vest number *v**i*. Soldiers and vests are numbered starting from one in the order in which they are specified in the input. All numbers of soldiers in the pairs should be pairwise different, all numbers of vests in the pairs also should be pairwise different. You can print the pairs in any order.
If there are multiple optimal answers, you are allowed to print any of them.
|
[
"5 3 0 0\n1 2 3 3 4\n1 3 5\n",
"3 3 2 2\n1 5 9\n3 5 7\n"
] |
[
"2\n1 1\n3 2\n",
"3\n1 1\n2 2\n3 3\n"
] |
In the first sample you need the vests' sizes to match perfectly: the first soldier gets the first vest (size 1), the third soldier gets the second vest (size 3). This sample allows another answer, which gives the second vest to the fourth soldier instead of the third one.
In the second sample the vest size can differ from the desired size by at most 2 sizes, so all soldiers can be equipped.
| 1,000
|
[
{
"input": "5 3 0 0\n1 2 3 3 4\n1 3 5",
"output": "2\n1 1\n3 2"
},
{
"input": "3 3 2 2\n1 5 9\n3 5 7",
"output": "3\n1 1\n2 2\n3 3"
},
{
"input": "1 1 0 0\n1\n1",
"output": "1\n1 1"
},
{
"input": "1 1 0 0\n1\n2",
"output": "0"
},
{
"input": "2 3 1 4\n1 5\n1 2 2",
"output": "1\n1 1"
},
{
"input": "20 30 1 4\n1 1 1 1 2 2 2 2 3 3 3 3 4 4 4 4 4 4 4 5\n1 1 1 1 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 4 4 4 4 4 4 4 4 5 5",
"output": "20\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 15\n14 16\n15 17\n16 18\n17 19\n18 20\n19 21\n20 22"
},
{
"input": "33 23 17 2\n1 1 2 2 2 3 3 3 3 3 3 4 4 4 4 4 5 5 5 6 6 7 7 7 8 8 8 8 8 9 9 10 10\n1 1 3 3 4 4 4 5 5 6 6 6 7 8 8 8 8 8 8 9 9 10 10",
"output": "23\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n12 10\n13 11\n14 12\n17 13\n20 14\n21 15\n22 16\n23 17\n24 18\n25 19\n26 20\n27 21\n28 22\n29 23"
},
{
"input": "2 2 1 4\n1 4\n3 6",
"output": "2\n1 1\n2 2"
},
{
"input": "20 20 1 4\n1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 4 4 5 5\n3 3 3 3 3 4 4 4 4 4 4 4 4 5 5 5 6 6 7 7",
"output": "20\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20"
},
{
"input": "33 23 17 2\n1 1 1 2 3 3 3 3 3 4 4 4 4 5 6 6 6 6 6 6 7 7 7 7 7 8 8 8 8 8 8 10 10\n10 10 10 11 12 12 12 12 12 13 13 13 13 14 15 15 15 15 15 15 16 16 16",
"output": "5\n26 1\n27 2\n28 3\n32 4\n33 5"
},
{
"input": "1 1 1 2\n783266931\n783266932",
"output": "1\n1 1"
},
{
"input": "2 3 1 4\n1 1\n3 3 4",
"output": "2\n1 1\n2 2"
},
{
"input": "20 30 1 4\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "20\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20"
},
{
"input": "33 23 17 2\n1 1 1 1 1 1 1 2 2 2 2 2 2 2 3 3 3 3 3 3 4 4 4 4 4 4 4 5 5 5 5 5 5\n10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 13 13 13",
"output": "0"
},
{
"input": "10 1 1 1\n1 1 1 5 5 7 7 8 8 8\n3",
"output": "0"
},
{
"input": "10 1 2 1\n1 2 5 8 9 9 9 10 10 10\n7",
"output": "1\n4 1"
},
{
"input": "1 1 2 1\n7\n8",
"output": "1\n1 1"
},
{
"input": "1 1 0 2\n9\n7",
"output": "0"
},
{
"input": "2 2 0 2\n2 8\n3 5",
"output": "1\n1 1"
},
{
"input": "2 2 1 0\n5 5\n6 7",
"output": "0"
},
{
"input": "2 2 3 0\n8 9\n1 5",
"output": "1\n1 2"
}
] | 1,502,892,238
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 84
| 1,590
| 16,486,400
|
n,m,x,y = map(int,input().split())
a = list(map(int,input().split()))
b = list(map(int,input().split()))
j = 0
V=[]
for i in range(m):
while (j<n and a[j]+y<b[i]):
j += 1
if j == n:
break
if (j<n and a[j]-x<=b[i]<=a[j]+y):
V+=[[j+1,i+1]]
j+=1
print(len(V))
for x in V:
print(x[0],x[1])
|
Title: Dress'em in Vests!
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Two-dimensional kingdom is going through hard times... This morning the Three-Dimensional kingdom declared war on the Two-dimensional one. This (possibly armed) conflict will determine the ultimate owner of the straight line.
The Two-dimensional kingdom has a regular army of *n* people. Each soldier registered himself and indicated the desired size of the bulletproof vest: the *i*-th soldier indicated size *a**i*. The soldiers are known to be unpretentious, so the command staff assumes that the soldiers are comfortable in any vests with sizes from *a**i*<=-<=*x* to *a**i*<=+<=*y*, inclusive (numbers *x*,<=*y*<=≥<=0 are specified).
The Two-dimensional kingdom has *m* vests at its disposal, the *j*-th vest's size equals *b**j*. Help mobilize the Two-dimensional kingdom's army: equip with vests as many soldiers as possible. Each vest can be used only once. The *i*-th soldier can put on the *j*-th vest, if *a**i*<=-<=*x*<=≤<=*b**j*<=≤<=*a**i*<=+<=*y*.
Input Specification:
The first input line contains four integers *n*, *m*, *x* and *y* (1<=≤<=*n*,<=*m*<=≤<=105, 0<=≤<=*x*,<=*y*<=≤<=109) — the number of soldiers, the number of vests and two numbers that specify the soldiers' unpretentiousness, correspondingly.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) in non-decreasing order, separated by single spaces — the desired sizes of vests.
The third line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**j*<=≤<=109) in non-decreasing order, separated by single spaces — the sizes of the available vests.
Output Specification:
In the first line print a single integer *k* — the maximum number of soldiers equipped with bulletproof vests.
In the next *k* lines print *k* pairs, one pair per line, as "*u**i* *v**i*" (without the quotes). Pair (*u**i*, *v**i*) means that soldier number *u**i* must wear vest number *v**i*. Soldiers and vests are numbered starting from one in the order in which they are specified in the input. All numbers of soldiers in the pairs should be pairwise different, all numbers of vests in the pairs also should be pairwise different. You can print the pairs in any order.
If there are multiple optimal answers, you are allowed to print any of them.
Demo Input:
['5 3 0 0\n1 2 3 3 4\n1 3 5\n', '3 3 2 2\n1 5 9\n3 5 7\n']
Demo Output:
['2\n1 1\n3 2\n', '3\n1 1\n2 2\n3 3\n']
Note:
In the first sample you need the vests' sizes to match perfectly: the first soldier gets the first vest (size 1), the third soldier gets the second vest (size 3). This sample allows another answer, which gives the second vest to the fourth soldier instead of the third one.
In the second sample the vest size can differ from the desired size by at most 2 sizes, so all soldiers can be equipped.
|
```python
n,m,x,y = map(int,input().split())
a = list(map(int,input().split()))
b = list(map(int,input().split()))
j = 0
V=[]
for i in range(m):
while (j<n and a[j]+y<b[i]):
j += 1
if j == n:
break
if (j<n and a[j]-x<=b[i]<=a[j]+y):
V+=[[j+1,i+1]]
j+=1
print(len(V))
for x in V:
print(x[0],x[1])
```
| 3
|
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,608,495,251
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 218
| 307,200
|
n=int(input())
output=0
a=input().split()
for i in range(n):
a[i]=int(a[i])
for i in range(1,n-1):
if a[i]%2!=a[i+1]%2 and a[i]%2!=a[i-1]%2:
print(i+1)
output=1
break
if output==0 and (a[0]%2!=a[1]%2):
print("1")
elif output==0 and (a[n-1]%2!=a[1]%2):
print(n)
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
n=int(input())
output=0
a=input().split()
for i in range(n):
a[i]=int(a[i])
for i in range(1,n-1):
if a[i]%2!=a[i+1]%2 and a[i]%2!=a[i-1]%2:
print(i+1)
output=1
break
if output==0 and (a[0]%2!=a[1]%2):
print("1")
elif output==0 and (a[n-1]%2!=a[1]%2):
print(n)
```
| 3.944928
|
731
|
A
|
Night at the Museum
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
|
The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
|
Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input.
|
[
"zeus\n",
"map\n",
"ares\n"
] |
[
"18\n",
"35\n",
"34\n"
] |
To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
| 500
|
[
{
"input": "zeus",
"output": "18"
},
{
"input": "map",
"output": "35"
},
{
"input": "ares",
"output": "34"
},
{
"input": "l",
"output": "11"
},
{
"input": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv",
"output": "99"
},
{
"input": "gngvi",
"output": "44"
},
{
"input": "aaaaa",
"output": "0"
},
{
"input": "a",
"output": "0"
},
{
"input": "z",
"output": "1"
},
{
"input": "vyadeehhikklnoqrs",
"output": "28"
},
{
"input": "jjiihhhhgggfedcccbazyxx",
"output": "21"
},
{
"input": "fyyptqqxuciqvwdewyppjdzur",
"output": "117"
},
{
"input": "fqcnzmzmbobmancqcoalzmanaobpdse",
"output": "368"
},
{
"input": "zzzzzaaaaaaazzzzzzaaaaaaazzzzzzaaaazzzza",
"output": "8"
},
{
"input": "aucnwhfixuruefkypvrvnvznwtjgwlghoqtisbkhuwxmgzuljvqhmnwzisnsgjhivnjmbknptxatdkelhzkhsuxzrmlcpeoyukiy",
"output": "644"
},
{
"input": "sssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss",
"output": "8"
},
{
"input": "nypjygrdtpzpigzyrisqeqfriwgwlengnezppgttgtndbrryjdl",
"output": "421"
},
{
"input": "pnllnnmmmmoqqqqqrrtssssuuvtsrpopqoonllmonnnpppopnonoopooqpnopppqppqstuuuwwwwvxzxzzaa",
"output": "84"
},
{
"input": "btaoahqgxnfsdmzsjxgvdwjukcvereqeskrdufqfqgzqfsftdqcthtkcnaipftcnco",
"output": "666"
},
{
"input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeerrrrrrrrrrrrrrrrwwwwwwwwww",
"output": "22"
},
{
"input": "uyknzcrwjyzmscqucclvacmorepdgmnyhmakmmnygqwglrxkxhkpansbmruwxdeoprxzmpsvwackopujxbbkpwyeggsvjykpxh",
"output": "643"
},
{
"input": "gzwpooohffcxwtpjgfzwtooiccxsrrokezutoojdzwsrmmhecaxwrojcbyrqlfdwwrliiib",
"output": "245"
},
{
"input": "dbvnkktasjdwqsrzfwwtmjgbcxggdxsoeilecihduypktkkbwfbruxzzhlttrssicgdwqruddwrlbtxgmhdbatzvdxbbro",
"output": "468"
},
{
"input": "mdtvowlktxzzbuaeiuebfeorgbdczauxsovbucactkvyvemsknsjfhifqgycqredzchipmkvzbxdjkcbyukomjlzvxzoswumned",
"output": "523"
},
{
"input": "kkkkkkkaaaaxxaaaaaaaxxxxxxxxaaaaaaxaaaaaaaaaakkkkkkkkkaaaaaaannnnnxxxxkkkkkkkkaannnnnnna",
"output": "130"
},
{
"input": "dffiknqqrsvwzcdgjkmpqtuwxadfhkkkmpqrtwxyadfggjmpppsuuwyyzcdgghhknnpsvvvwwwyabccffiloqruwwyyzabeeehh",
"output": "163"
},
{
"input": "qpppmmkjihgecbyvvsppnnnkjiffeebaaywutrrqpmkjhgddbzzzywtssssqnmmljheddbbaxvusrqonmlifedbbzyywwtqnkheb",
"output": "155"
},
{
"input": "wvvwwwvvwxxxyyyxxwwvwwvuttttttuvvwxxwxxyxxwwwwwvvuttssrssstsssssrqpqqppqrssrsrrssrssssrrsrqqrrqpppqp",
"output": "57"
},
{
"input": "dqcpcobpcobnznamznamzlykxkxlxlylzmaobnaobpbnanbpcoaobnboaoboanzlymzmykylymylzlylymanboanaocqdqesfrfs",
"output": "1236"
},
{
"input": "nnnnnnnnnnnnnnnnnnnnaaaaaaaaaaaaaaaaaaaakkkkkkkkkkkkkkkkkkkkkkaaaaaaaaaaaaaaaaaaaaxxxxxxxxxxxxxxxxxx",
"output": "49"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "cgilqsuwzaffilptwwbgmnttyyejkorxzflqvzbddhmnrvxchijpuwaeiimosxyycejlpquuwbfkpvbgijkqvxybdjjjptxcfkqt",
"output": "331"
},
{
"input": "ufsepwgtzgtgjssxaitgpailuvgqweoppszjwhoxdhhhpwwdorwfrdjwcdekxiktwziqwbkvbknrtvajpyeqbjvhiikxxaejjpte",
"output": "692"
},
{
"input": "uhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuh",
"output": "1293"
},
{
"input": "vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvgggggggggggggggggggggggggggggggggggggggggggggggggg",
"output": "16"
},
{
"input": "lyidmjyzbszgiwkxhhpnnthfwcvvstueionspfrvqgkvngmwyhezlosrpdnbvtcjjxxsykixwnepbumaacdzadlqhnjlcejovple",
"output": "616"
},
{
"input": "etzqqbaveffalkdguunfmyyrzkccnxmlluxeasqmopxzfvlkbhipqdwjgrttoemruohgwukfisdhznqyvhswbbypoxgtxyappcrl",
"output": "605"
},
{
"input": "lizussgedcbdjhrbeskhgatyozvwwekanlggcstijrniivupmcoofbaxfqrxddyzzptwxcftlhajsmmkkriarrqtkoauhcqefyud",
"output": "549"
},
{
"input": "dvjuvgfdogpknmbowlsfjzcimnygbtjiucyeeroqwhmzwpjqxlbjkqawrdtmvxbiqufllfuqibxvmtdrwaqkjblxqjpwzmhwqore",
"output": "688"
},
{
"input": "eeycuijtbgynmiczjfslwobmnkpgodfgvujvduyfeqchuaoktqrrairkkmmsjahltfcxwtpzzyddxrqfxabfoocmpuviinrjitsc",
"output": "604"
},
{
"input": "cgglnakewwvzoytaghksebrhjdbcdegssuzilrcppayxtgxopybbwshvyqnzhdsifkuwghourmeottrgjwdqpihbklvfzxpomqsa",
"output": "572"
},
{
"input": "aexullmxncckzryymfnuugdklaffevabqqztelpvojecljnhqldazdcaamubpenwxikysxxjjctvbndprsolzehywmgnvkgqvrfp",
"output": "609"
},
{
"input": "psnoieutsvvcwfhtnnphhxkwigzsbzyjmdiyl",
"output": "223"
},
{
"input": "aa",
"output": "0"
}
] | 1,627,222,955
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 44
| 77
| 6,758,400
|
word = input()
sum = 0
table = 'abcdefghijklmnopqrstuvwxyz'
bias = 0
for step in word:
num = abs(bias - table.find(step))
bias = table.find(step)
if num <= (26-num):
sum += num
else:
sum += 26-num
print(sum)
|
Title: Night at the Museum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
Input Specification:
The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
Output Specification:
Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input.
Demo Input:
['zeus\n', 'map\n', 'ares\n']
Demo Output:
['18\n', '35\n', '34\n']
Note:
To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
|
```python
word = input()
sum = 0
table = 'abcdefghijklmnopqrstuvwxyz'
bias = 0
for step in word:
num = abs(bias - table.find(step))
bias = table.find(step)
if num <= (26-num):
sum += num
else:
sum += 26-num
print(sum)
```
| 3
|
|
384
|
A
|
Coder
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Iahub likes chess very much. He even invented a new chess piece named Coder. A Coder can move (and attack) one square horizontally or vertically. More precisely, if the Coder is located at position (*x*,<=*y*), he can move to (or attack) positions (*x*<=+<=1,<=*y*), (*x*–1,<=*y*), (*x*,<=*y*<=+<=1) and (*x*,<=*y*–1).
Iahub wants to know how many Coders can be placed on an *n*<=×<=*n* chessboard, so that no Coder attacks any other Coder.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000).
|
On the first line print an integer, the maximum number of Coders that can be placed on the chessboard.
On each of the next *n* lines print *n* characters, describing the configuration of the Coders. For an empty cell print an '.', and for a Coder print a 'C'.
If there are multiple correct answers, you can print any.
|
[
"2\n"
] |
[
"2\nC.\n.C\n"
] |
none
| 500
|
[
{
"input": "2",
"output": "2\nC.\n.C"
},
{
"input": "3",
"output": "5\nC.C\n.C.\nC.C"
},
{
"input": "4",
"output": "8\nC.C.\n.C.C\nC.C.\n.C.C"
},
{
"input": "10",
"output": "50\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C"
},
{
"input": "15",
"output": "113\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C"
},
{
"input": "100",
"output": "5000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "101",
"output": "5101\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "500",
"output": "125000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n...."
},
{
"input": "501",
"output": "125501\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n..."
},
{
"input": "755",
"output": "285013\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "888",
"output": "394272\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "998",
"output": "498002\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "999",
"output": "499001\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "1000",
"output": "500000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "1",
"output": "1\nC"
}
] | 1,551,345,481
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 15
| 108
| 0
|
k=0
c=0
s=''
ss=''
n=int(input())
for i in range(n):
if k%2==0:
s+='C'
ss+='.'
else:
s+='.'
ss+='C'
k+=1
k=0
for i in range(n):
if k%2==0:
c+=s.count('C')
else:
c+=ss.count('C')
k+=1
k=0
print(c)
for i in range(n):
if k%2==0:
print(s)
else:
print(ss)
k+=1
|
Title: Coder
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Iahub likes chess very much. He even invented a new chess piece named Coder. A Coder can move (and attack) one square horizontally or vertically. More precisely, if the Coder is located at position (*x*,<=*y*), he can move to (or attack) positions (*x*<=+<=1,<=*y*), (*x*–1,<=*y*), (*x*,<=*y*<=+<=1) and (*x*,<=*y*–1).
Iahub wants to know how many Coders can be placed on an *n*<=×<=*n* chessboard, so that no Coder attacks any other Coder.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000).
Output Specification:
On the first line print an integer, the maximum number of Coders that can be placed on the chessboard.
On each of the next *n* lines print *n* characters, describing the configuration of the Coders. For an empty cell print an '.', and for a Coder print a 'C'.
If there are multiple correct answers, you can print any.
Demo Input:
['2\n']
Demo Output:
['2\nC.\n.C\n']
Note:
none
|
```python
k=0
c=0
s=''
ss=''
n=int(input())
for i in range(n):
if k%2==0:
s+='C'
ss+='.'
else:
s+='.'
ss+='C'
k+=1
k=0
for i in range(n):
if k%2==0:
c+=s.count('C')
else:
c+=ss.count('C')
k+=1
k=0
print(c)
for i in range(n):
if k%2==0:
print(s)
else:
print(ss)
k+=1
```
| 3
|
|
746
|
B
|
Decoding
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] | null | null |
Polycarp is mad about coding, that is why he writes Sveta encoded messages. He calls the median letter in a word the letter which is in the middle of the word. If the word's length is even, the median letter is the left of the two middle letters. In the following examples, the median letter is highlighted: contest, info. If the word consists of single letter, then according to above definition this letter is the median letter.
Polycarp encodes each word in the following way: he writes down the median letter of the word, then deletes it and repeats the process until there are no letters left. For example, he encodes the word volga as logva.
You are given an encoding *s* of some word, your task is to decode it.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=2000) — the length of the encoded word.
The second line contains the string *s* of length *n* consisting of lowercase English letters — the encoding.
|
Print the word that Polycarp encoded.
|
[
"5\nlogva\n",
"2\nno\n",
"4\nabba\n"
] |
[
"volga\n",
"no\n",
"baba\n"
] |
In the first example Polycarp encoded the word volga. At first, he wrote down the letter l from the position 3, after that his word looked like voga. After that Polycarp wrote down the letter o from the position 2, his word became vga. Then Polycarp wrote down the letter g which was at the second position, the word became va. Then he wrote down the letter v, then the letter a. Thus, the encoding looked like logva.
In the second example Polycarp encoded the word no. He wrote down the letter n, the word became o, and he wrote down the letter o. Thus, in this example, the word and its encoding are the same.
In the third example Polycarp encoded the word baba. At first, he wrote down the letter a, which was at the position 2, after that the word looked like bba. Then he wrote down the letter b, which was at the position 2, his word looked like ba. After that he wrote down the letter b, which was at the position 1, the word looked like a, and he wrote down that letter a. Thus, the encoding is abba.
| 1,000
|
[
{
"input": "5\nlogva",
"output": "volga"
},
{
"input": "2\nno",
"output": "no"
},
{
"input": "4\nabba",
"output": "baba"
},
{
"input": "51\nkfsmpaeviowvkdbuhdagquxxqniselafnfbrgbhmsugcbbnlrvv",
"output": "vlbcumbrfflsnxugdudvovamfkspeiwkbhaqxqieanbghsgbnrv"
},
{
"input": "1\nw",
"output": "w"
},
{
"input": "2\ncb",
"output": "cb"
},
{
"input": "3\nqok",
"output": "oqk"
},
{
"input": "4\naegi",
"output": "gaei"
},
{
"input": "5\noqquy",
"output": "uqoqy"
},
{
"input": "6\nulhpnm",
"output": "nhulpm"
},
{
"input": "7\nijvxljt",
"output": "jxjivlt"
},
{
"input": "8\nwwmiwkeo",
"output": "ewmwwiko"
},
{
"input": "9\ngmwqmpfow",
"output": "opqmgwmfw"
},
{
"input": "10\nhncmexsslh",
"output": "lsechnmxsh"
},
{
"input": "20\nrtcjbjlbtjfmvzdqutuw",
"output": "uudvftlbcrtjjbjmzqtw"
},
{
"input": "21\ngjyiqoebcnpsdegxnsauh",
"output": "usxesnboijgyqecpdgnah"
},
{
"input": "30\nudotcwvcwxajkadxqvxvwgmwmnqrby",
"output": "bqmmwxqdkawvcoudtwcxjaxvvgwnry"
},
{
"input": "31\nipgfrxxcgckksfgexlicjvtnhvrfbmb",
"output": "mfvnvclefkccxfpigrxgksgxijthrbb"
},
{
"input": "50\nwobervhvvkihcuyjtmqhaaigvahheoqleromusrartldojsjvy",
"output": "vsolrruoeqehviaqtycivhrbwoevvkhujmhagaholrmsatdjjy"
},
{
"input": "200\nhvayscqiwpcfykibwyudkzuzdkgqqvbnrfeupjefevlvojngmlcjwzijrkzbsaovabkvvwmjgoonyhuiphwmqdoiuueuyqtychbsklflnvghipdgaxhuhiiqlqocpvhldgvnsrtcwxpidrjffwvwcirluyyxzxrglheczeuouklzkvnyubsvgvmdbrylimztotdbmjph",
"output": "pmdoziybmgsunkluuzelrzyurcvfjdpwtsvdhpolihhadignfkbctyeuoqwpuyogmvkaoszriwcmnoleeperbqgdukuwiycwqsahvycipfkbydzzkqvnfujfvvjgljzjkbavbvwjonhihmdiuuqyhsllvhpgxuiqqcvlgnrcxirfwwilyxxghceokzvybvvdrlmttbjh"
},
{
"input": "201\nrpkghhfibtmlkpdiklegblbuyshfirheatjkfoqkfayfbxeeqijwqdwkkrkbdxlhzkhyiifemsghwovorlqedngldskfbhmwrnzmtjuckxoqdszmsdnbuqnlqzswdfhagasmfswanifrjjcuwdsplytvmnfarchgqteedgfpumkssindxndliozojzlpznwedodzwrrus",
"output": "urzoenpzoolndismpgetgcanvypdujriasmaafwzlqbdmsqxcjmnwhfslneloohseiykhxbrkdwiexfakokterfsulglipltihgprkhfbmkdkebbyhihajfqfybeqjqwkkdlzhifmgwvrqdgdkbmrztukodzsnunqsdhgsfwnfjcwsltmfrhqedfuksnxdizjlzwddwrs"
},
{
"input": "500\naopxumqciwxewxvlxzebsztskjvjzwyewjztqrsuvamtvklhqrbodtncqdchjrlpywvmtgnkkwtvpggktewdgvnhydkexwoxkgltaesrtifbwpciqsvrgjtqrdnyqkgqwrryacluaqmgdwxinqieiblolyekcbzahlhxdwqcgieyfgmicvgbbitbzhejkshjunzjteyyfngigjwyqqndtjrdykzrnrpinkwtrlchhxvycrhstpecadszilicrqdeyyidohqvzfnsqfyuemigacysxvtrgxyjcvejkjstsnatfqlkeytxgsksgpcooypsmqgcluzwofaupegxppbupvtumjerohdteuenwcmqaoazohkilgpkjavcrjcslhzkyjcgfzxxzjfufichxcodcawonkxhbqgfimmlycswdzwbnmjwhbwihfoftpcqplncavmbxuwnsabiyvpcrhfgtqyaguoaigknushbqjwqmmyvsxwabrub",
"output": "ubwsymwqhukiogytfrpybswxmanpctohwhjnwdsymigbxnwcoxcffzxfcyzlcrvjplkoaamweedoemtpbpgpaozlgmpocgkgtelfasskecygtxyaieyqnzqoiydriisaethcvhcrwnpnzyrtnqwggfytzuhkeztbgcmfegqdhhzcelliinxdmalarwgqnrtgvqcwftsalkoxkyngwtgptkntvyljcqndbqlvmvsqzwyzvktsexvwxiqupaoxmcwexlzbzsjjwejtruatkhrotcdhrpwmgkwvgkedvhdewxgteribpisrjqdykqrycuqgwiqeboykbalxwciygivbibhjsjnjeynijyqdjdkrriktlhxyrspcdzlcqeydhvfsfumgcsvrxjvjjtntqkyxsspoysqcuwfuexpuvujrhtuncqozhigkacjshkjgzxjuihcdaokhqfmlcwzbmwbiffpqlcvbunaivchgqauagnsbjqmvxarb"
},
{
"input": "501\noilesjbgowlnayckhpoaitijewsyhgavnthycaecwnvzpxgjqfjyxnjcjknvvsmjbjwtcoyfbegmnnheeamvtfjkigqoanhvgdfrjchdqgowrstlmrjmcsuuwvvoeucfyhnxivosrxblfoqwikfxjnnyejdiihpenfcahtjwcnzwvxxseicvdfgqhtvefswznuyohmmljlnxubhevywpmnitnkhecsgccpstxkmdzabsnwxkokdfsogzbpnfvgudvqlstxojzfzugxbfrozveaiofrzksegdelxsdhcjlqwqlgjcqiujptoenxozhkqhcpkarretqzfkwuvbmfdcdoqliyzmlfrfhzrnkbhofuctkpeacqejwvdrlyvepudrlzncbhwrgmxrczphsoymvtuzqjscvbtqpymogupgzctepccravjcrfsadueyraqvwasravkubebojqspdntewnjohvccamvoxdauyakvehjhabpdyzyme",
"output": "mzdbhhvaudomcvonenpqoeuvravayuafcvrcecguoyqbcjztmohzrmrhczrueyrvjqaptuobnzffmylocfbukztraphkzxetjicgqqjhsldekroavofxufjxsqdgfpzofkkwsadktpcsektnpyebxllmouzsetqfvisxwnwtafehijynxkwolxsvxhfuovusmrlswgdcrdvnogkfvaenmefotjjsvkcnyfjxzncaytvgywjtapkynwgjeiolsbolachoiieshanhcewvpgqjxjjnvmbwcybgnhemtjiqahgfjhqortmjcuwvecyniorbfqifjnedipnchjczvxecdghvfwnyhmjnuhvwminhcgcsxmzbnxodsgbnvuvltozzgbrzeifzsgexdclwljquponohqckreqfwvmddqizlrhrkhfckecewdlvpdlnbwgxcpsyvuqsvtpmgpztpcajrsderqwsakbbjsdtwjhcavxaykejapyye"
}
] | 1,631,547,948
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 93
| 6,963,200
|
# decoding.py
def main():
# Read input length
length = int(input())
# Read in encrypted string
source = input()
direction = 'r' if (length % 2 == 0) else 'l'
out = []
out.append(source[0])
source = source[1:]
for c in source:
if direction == 'l':
out.insert(0, c)
else:
out.append(c)
direction = 'l' if direction == 'r' else 'r'
for p in out:
print(p, end='')
if __name__ == '__main__':
main()
|
Title: Decoding
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is mad about coding, that is why he writes Sveta encoded messages. He calls the median letter in a word the letter which is in the middle of the word. If the word's length is even, the median letter is the left of the two middle letters. In the following examples, the median letter is highlighted: contest, info. If the word consists of single letter, then according to above definition this letter is the median letter.
Polycarp encodes each word in the following way: he writes down the median letter of the word, then deletes it and repeats the process until there are no letters left. For example, he encodes the word volga as logva.
You are given an encoding *s* of some word, your task is to decode it.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=2000) — the length of the encoded word.
The second line contains the string *s* of length *n* consisting of lowercase English letters — the encoding.
Output Specification:
Print the word that Polycarp encoded.
Demo Input:
['5\nlogva\n', '2\nno\n', '4\nabba\n']
Demo Output:
['volga\n', 'no\n', 'baba\n']
Note:
In the first example Polycarp encoded the word volga. At first, he wrote down the letter l from the position 3, after that his word looked like voga. After that Polycarp wrote down the letter o from the position 2, his word became vga. Then Polycarp wrote down the letter g which was at the second position, the word became va. Then he wrote down the letter v, then the letter a. Thus, the encoding looked like logva.
In the second example Polycarp encoded the word no. He wrote down the letter n, the word became o, and he wrote down the letter o. Thus, in this example, the word and its encoding are the same.
In the third example Polycarp encoded the word baba. At first, he wrote down the letter a, which was at the position 2, after that the word looked like bba. Then he wrote down the letter b, which was at the position 2, his word looked like ba. After that he wrote down the letter b, which was at the position 1, the word looked like a, and he wrote down that letter a. Thus, the encoding is abba.
|
```python
# decoding.py
def main():
# Read input length
length = int(input())
# Read in encrypted string
source = input()
direction = 'r' if (length % 2 == 0) else 'l'
out = []
out.append(source[0])
source = source[1:]
for c in source:
if direction == 'l':
out.insert(0, c)
else:
out.append(c)
direction = 'l' if direction == 'r' else 'r'
for p in out:
print(p, end='')
if __name__ == '__main__':
main()
```
| 3
|
|
270
|
A
|
Fancy Fence
|
PROGRAMMING
| 1,100
|
[
"geometry",
"implementation",
"math"
] | null | null |
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
|
The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees.
|
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
|
[
"3\n30\n60\n90\n"
] |
[
"NO\nYES\nYES\n"
] |
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square.
| 500
|
[
{
"input": "3\n30\n60\n90",
"output": "NO\nYES\nYES"
},
{
"input": "6\n1\n2\n3\n170\n179\n25",
"output": "NO\nNO\nNO\nYES\nYES\nNO"
}
] | 1,697,192,027
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 3
| 60
| 0
|
#王铭健，工学院 2300011118
t = int(input())
result_list = []
for i in range(t):
angle = int(input())
if 360 % (180 - angle) == 0:
result_list.append('YES')
else:
result_list.append('NO')
for j in result_list:
print(j)
|
Title: Fancy Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
Input Specification:
The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees.
Output Specification:
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
Demo Input:
['3\n30\n60\n90\n']
Demo Output:
['NO\nYES\nYES\n']
Note:
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square.
|
```python
#王铭健，工学院 2300011118
t = int(input())
result_list = []
for i in range(t):
angle = int(input())
if 360 % (180 - angle) == 0:
result_list.append('YES')
else:
result_list.append('NO')
for j in result_list:
print(j)
```
| 3
|
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,653,331,081
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 92
| 0
|
m, n= map(int,input().split())
total = int(m*n / 2)
print(total)
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
m, n= map(int,input().split())
total = int(m*n / 2)
print(total)
```
| 3.977
|
90
|
A
|
Cableway
|
PROGRAMMING
| 1,000
|
[
"greedy",
"math"
] |
A. Cableway
|
2
|
256
|
A group of university students wants to get to the top of a mountain to have a picnic there. For that they decided to use a cableway.
A cableway is represented by some cablecars, hanged onto some cable stations by a cable. A cable is scrolled cyclically between the first and the last cable stations (the first of them is located at the bottom of the mountain and the last one is located at the top). As the cable moves, the cablecar attached to it move as well.
The number of cablecars is divisible by three and they are painted three colors: red, green and blue, in such manner that after each red cablecar goes a green one, after each green cablecar goes a blue one and after each blue cablecar goes a red one. Each cablecar can transport no more than two people, the cablecars arrive with the periodicity of one minute (i. e. every minute) and it takes exactly 30 minutes for a cablecar to get to the top.
All students are divided into three groups: *r* of them like to ascend only in the red cablecars, *g* of them prefer only the green ones and *b* of them prefer only the blue ones. A student never gets on a cablecar painted a color that he doesn't like,
The first cablecar to arrive (at the moment of time 0) is painted red. Determine the least time it will take all students to ascend to the mountain top.
|
The first line contains three integers *r*, *g* and *b* (0<=≤<=*r*,<=*g*,<=*b*<=≤<=100). It is guaranteed that *r*<=+<=*g*<=+<=*b*<=><=0, it means that the group consists of at least one student.
|
Print a single number — the minimal time the students need for the whole group to ascend to the top of the mountain.
|
[
"1 3 2\n",
"3 2 1\n"
] |
[
"34",
"33"
] |
Let's analyze the first sample.
At the moment of time 0 a red cablecar comes and one student from the *r* group get on it and ascends to the top at the moment of time 30.
At the moment of time 1 a green cablecar arrives and two students from the *g* group get on it; they get to the top at the moment of time 31.
At the moment of time 2 comes the blue cablecar and two students from the *b* group get on it. They ascend to the top at the moment of time 32.
At the moment of time 3 a red cablecar arrives but the only student who is left doesn't like red and the cablecar leaves empty.
At the moment of time 4 a green cablecar arrives and one student from the *g* group gets on it. He ascends to top at the moment of time 34.
Thus, all the students are on the top, overall the ascension took exactly 34 minutes.
| 500
|
[
{
"input": "1 3 2",
"output": "34"
},
{
"input": "3 2 1",
"output": "33"
},
{
"input": "3 5 2",
"output": "37"
},
{
"input": "10 10 10",
"output": "44"
},
{
"input": "29 7 24",
"output": "72"
},
{
"input": "28 94 13",
"output": "169"
},
{
"input": "90 89 73",
"output": "163"
},
{
"input": "0 0 1",
"output": "32"
},
{
"input": "0 0 2",
"output": "32"
},
{
"input": "0 1 0",
"output": "31"
},
{
"input": "0 1 1",
"output": "32"
},
{
"input": "0 1 2",
"output": "32"
},
{
"input": "0 2 0",
"output": "31"
},
{
"input": "0 2 1",
"output": "32"
},
{
"input": "0 2 2",
"output": "32"
},
{
"input": "1 0 0",
"output": "30"
},
{
"input": "1 0 1",
"output": "32"
},
{
"input": "1 0 2",
"output": "32"
},
{
"input": "1 1 0",
"output": "31"
},
{
"input": "1 1 1",
"output": "32"
},
{
"input": "1 1 2",
"output": "32"
},
{
"input": "1 2 0",
"output": "31"
},
{
"input": "1 2 1",
"output": "32"
},
{
"input": "1 2 2",
"output": "32"
},
{
"input": "2 0 0",
"output": "30"
},
{
"input": "2 0 1",
"output": "32"
},
{
"input": "2 0 2",
"output": "32"
},
{
"input": "2 1 0",
"output": "31"
},
{
"input": "2 1 1",
"output": "32"
},
{
"input": "2 1 2",
"output": "32"
},
{
"input": "2 2 0",
"output": "31"
},
{
"input": "2 2 1",
"output": "32"
},
{
"input": "2 2 2",
"output": "32"
},
{
"input": "4 5 2",
"output": "37"
},
{
"input": "5 7 8",
"output": "41"
},
{
"input": "13 25 19",
"output": "67"
},
{
"input": "29 28 30",
"output": "74"
},
{
"input": "45 52 48",
"output": "106"
},
{
"input": "68 72 58",
"output": "136"
},
{
"input": "89 92 90",
"output": "166"
},
{
"input": "99 97 98",
"output": "177"
},
{
"input": "89 97 2",
"output": "175"
},
{
"input": "96 3 92",
"output": "171"
},
{
"input": "1 99 87",
"output": "178"
},
{
"input": "95 2 3",
"output": "171"
},
{
"input": "2 97 3",
"output": "175"
},
{
"input": "2 2 99",
"output": "179"
},
{
"input": "100 100 100",
"output": "179"
},
{
"input": "100 0 100",
"output": "179"
},
{
"input": "0 100 100",
"output": "179"
},
{
"input": "100 100 0",
"output": "178"
},
{
"input": "100 0 0",
"output": "177"
},
{
"input": "0 100 0",
"output": "178"
},
{
"input": "0 0 100",
"output": "179"
},
{
"input": "5 4 5",
"output": "38"
}
] | 1,555,107,452
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 55
| 218
| 0
|
import math
m = 0
p = 0
for pos, i in enumerate(map(int, input().split())):
if math.ceil(i/2) >= m:
m = math.ceil(i/2)
p = pos
res = 0
m -= 1
while m > 0:
res += 3
m -= 1
print(res + p + 30)
|
Title: Cableway
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A group of university students wants to get to the top of a mountain to have a picnic there. For that they decided to use a cableway.
A cableway is represented by some cablecars, hanged onto some cable stations by a cable. A cable is scrolled cyclically between the first and the last cable stations (the first of them is located at the bottom of the mountain and the last one is located at the top). As the cable moves, the cablecar attached to it move as well.
The number of cablecars is divisible by three and they are painted three colors: red, green and blue, in such manner that after each red cablecar goes a green one, after each green cablecar goes a blue one and after each blue cablecar goes a red one. Each cablecar can transport no more than two people, the cablecars arrive with the periodicity of one minute (i. e. every minute) and it takes exactly 30 minutes for a cablecar to get to the top.
All students are divided into three groups: *r* of them like to ascend only in the red cablecars, *g* of them prefer only the green ones and *b* of them prefer only the blue ones. A student never gets on a cablecar painted a color that he doesn't like,
The first cablecar to arrive (at the moment of time 0) is painted red. Determine the least time it will take all students to ascend to the mountain top.
Input Specification:
The first line contains three integers *r*, *g* and *b* (0<=≤<=*r*,<=*g*,<=*b*<=≤<=100). It is guaranteed that *r*<=+<=*g*<=+<=*b*<=><=0, it means that the group consists of at least one student.
Output Specification:
Print a single number — the minimal time the students need for the whole group to ascend to the top of the mountain.
Demo Input:
['1 3 2\n', '3 2 1\n']
Demo Output:
['34', '33']
Note:
Let's analyze the first sample.
At the moment of time 0 a red cablecar comes and one student from the *r* group get on it and ascends to the top at the moment of time 30.
At the moment of time 1 a green cablecar arrives and two students from the *g* group get on it; they get to the top at the moment of time 31.
At the moment of time 2 comes the blue cablecar and two students from the *b* group get on it. They ascend to the top at the moment of time 32.
At the moment of time 3 a red cablecar arrives but the only student who is left doesn't like red and the cablecar leaves empty.
At the moment of time 4 a green cablecar arrives and one student from the *g* group gets on it. He ascends to top at the moment of time 34.
Thus, all the students are on the top, overall the ascension took exactly 34 minutes.
|
```python
import math
m = 0
p = 0
for pos, i in enumerate(map(int, input().split())):
if math.ceil(i/2) >= m:
m = math.ceil(i/2)
p = pos
res = 0
m -= 1
while m > 0:
res += 3
m -= 1
print(res + p + 30)
```
| 3.9455
|
814
|
B
|
An express train to reveries
|
PROGRAMMING
| 1,300
|
[
"constructive algorithms"
] | null | null |
Sengoku still remembers the mysterious "colourful meteoroids" she discovered with Lala-chan when they were little. In particular, one of the nights impressed her deeply, giving her the illusion that all her fancies would be realized.
On that night, Sengoku constructed a permutation *p*1,<=*p*2,<=...,<=*p**n* of integers from 1 to *n* inclusive, with each integer representing a colour, wishing for the colours to see in the coming meteor outburst. Two incredible outbursts then arrived, each with *n* meteorids, colours of which being integer sequences *a*1,<=*a*2,<=...,<=*a**n* and *b*1,<=*b*2,<=...,<=*b**n* respectively. Meteoroids' colours were also between 1 and *n* inclusive, and the two sequences were not identical, that is, at least one *i* (1<=≤<=*i*<=≤<=*n*) exists, such that *a**i*<=≠<=*b**i* holds.
Well, she almost had it all — each of the sequences *a* and *b* matched exactly *n*<=-<=1 elements in Sengoku's permutation. In other words, there is exactly one *i* (1<=≤<=*i*<=≤<=*n*) such that *a**i*<=≠<=*p**i*, and exactly one *j* (1<=≤<=*j*<=≤<=*n*) such that *b**j*<=≠<=*p**j*.
For now, Sengoku is able to recover the actual colour sequences *a* and *b* through astronomical records, but her wishes have been long forgotten. You are to reconstruct any possible permutation Sengoku could have had on that night.
|
The first line of input contains a positive integer *n* (2<=≤<=*n*<=≤<=1<=000) — the length of Sengoku's permutation, being the length of both meteor outbursts at the same time.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the sequence of colours in the first meteor outburst.
The third line contains *n* space-separated integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=*n*) — the sequence of colours in the second meteor outburst. At least one *i* (1<=≤<=*i*<=≤<=*n*) exists, such that *a**i*<=≠<=*b**i* holds.
|
Output *n* space-separated integers *p*1,<=*p*2,<=...,<=*p**n*, denoting a possible permutation Sengoku could have had. If there are more than one possible answer, output any one of them.
Input guarantees that such permutation exists.
|
[
"5\n1 2 3 4 3\n1 2 5 4 5\n",
"5\n4 4 2 3 1\n5 4 5 3 1\n",
"4\n1 1 3 4\n1 4 3 4\n"
] |
[
"1 2 5 4 3\n",
"5 4 2 3 1\n",
"1 2 3 4\n"
] |
In the first sample, both 1, 2, 5, 4, 3 and 1, 2, 3, 4, 5 are acceptable outputs.
In the second sample, 5, 4, 2, 3, 1 is the only permutation to satisfy the constraints.
| 1,000
|
[
{
"input": "5\n1 2 3 4 3\n1 2 5 4 5",
"output": "1 2 5 4 3"
},
{
"input": "5\n4 4 2 3 1\n5 4 5 3 1",
"output": "5 4 2 3 1"
},
{
"input": "4\n1 1 3 4\n1 4 3 4",
"output": "1 2 3 4"
},
{
"input": "10\n1 2 3 4 7 6 7 8 9 10\n1 2 3 4 5 6 5 8 9 10",
"output": "1 2 3 4 5 6 7 8 9 10"
},
{
"input": "10\n1 2 3 4 5 6 7 8 7 10\n1 2 3 4 5 6 7 8 9 9",
"output": "1 2 3 4 5 6 7 8 9 10"
},
{
"input": "10\n1 2 3 4 5 6 7 8 4 10\n1 2 3 4 5 6 7 6 9 10",
"output": "1 2 3 4 5 6 7 8 9 10"
},
{
"input": "10\n8 6 1 7 9 3 5 2 10 9\n8 6 1 7 4 3 5 2 10 4",
"output": "8 6 1 7 4 3 5 2 10 9"
},
{
"input": "10\n2 9 7 7 8 5 4 10 6 1\n2 8 7 3 8 5 4 10 6 1",
"output": "2 9 7 3 8 5 4 10 6 1"
},
{
"input": "2\n2 2\n1 1",
"output": "1 2"
},
{
"input": "3\n1 2 2\n1 3 3",
"output": "1 3 2"
},
{
"input": "3\n2 2 3\n1 2 1",
"output": "1 2 3"
},
{
"input": "3\n1 3 3\n1 1 3",
"output": "1 2 3"
},
{
"input": "3\n2 1 1\n2 3 3",
"output": "2 3 1"
},
{
"input": "3\n3 3 2\n1 1 2",
"output": "1 3 2"
},
{
"input": "3\n1 3 3\n3 3 2",
"output": "1 3 2"
},
{
"input": "4\n3 2 3 4\n1 2 1 4",
"output": "1 2 3 4"
},
{
"input": "4\n2 2 3 4\n1 2 3 2",
"output": "1 2 3 4"
},
{
"input": "4\n1 2 4 4\n2 2 3 4",
"output": "1 2 3 4"
},
{
"input": "4\n4 1 3 4\n2 1 3 2",
"output": "2 1 3 4"
},
{
"input": "4\n3 2 1 3\n4 2 1 2",
"output": "4 2 1 3"
},
{
"input": "4\n1 4 1 3\n2 4 1 4",
"output": "2 4 1 3"
},
{
"input": "4\n1 3 4 4\n3 3 2 4",
"output": "1 3 2 4"
},
{
"input": "5\n5 4 5 3 1\n4 4 2 3 1",
"output": "5 4 2 3 1"
},
{
"input": "5\n4 1 2 4 5\n3 1 2 5 5",
"output": "3 1 2 4 5"
},
{
"input": "3\n2 2 3\n1 3 3",
"output": "1 2 3"
},
{
"input": "3\n1 1 3\n2 3 3",
"output": "2 1 3"
},
{
"input": "5\n5 4 5 3 1\n2 4 4 3 1",
"output": "2 4 5 3 1"
},
{
"input": "3\n3 3 1\n2 1 1",
"output": "2 3 1"
},
{
"input": "5\n5 4 3 5 2\n5 4 1 1 2",
"output": "5 4 3 1 2"
},
{
"input": "6\n1 2 3 4 2 5\n1 6 3 4 4 5",
"output": "1 6 3 4 2 5"
},
{
"input": "4\n1 3 2 1\n2 3 2 1",
"output": "4 3 2 1"
},
{
"input": "4\n1 3 3 4\n1 4 3 4",
"output": "1 2 3 4"
},
{
"input": "11\n1 2 3 4 5 6 7 8 9 10 10\n1 2 3 4 5 6 7 8 9 10 3",
"output": "1 2 3 4 5 6 7 8 9 10 11"
},
{
"input": "5\n1 2 3 2 5\n1 4 3 3 5",
"output": "1 4 3 2 5"
},
{
"input": "5\n1 2 3 4 3\n1 2 5 4 2",
"output": "1 2 5 4 3"
},
{
"input": "5\n1 2 3 4 4\n1 2 3 4 3",
"output": "1 2 3 4 5"
},
{
"input": "4\n1 3 1 4\n1 3 4 4",
"output": "1 3 2 4"
},
{
"input": "5\n2 5 3 2 1\n4 5 3 3 1",
"output": "4 5 3 2 1"
},
{
"input": "5\n1 2 3 2 5\n1 3 3 4 5",
"output": "1 2 3 4 5"
},
{
"input": "5\n5 2 3 4 5\n2 2 3 4 5",
"output": "1 2 3 4 5"
},
{
"input": "5\n5 4 1 1 2\n5 4 3 5 2",
"output": "5 4 3 1 2"
},
{
"input": "4\n1 4 3 4\n1 3 3 4",
"output": "1 2 3 4"
},
{
"input": "4\n1 2 3 1\n1 2 3 2",
"output": "1 2 3 4"
},
{
"input": "5\n4 5 3 3 1\n2 5 3 2 1",
"output": "4 5 3 2 1"
},
{
"input": "5\n1 2 3 5 5\n1 2 3 4 3",
"output": "1 2 3 4 5"
},
{
"input": "4\n2 3 3 4\n2 4 3 4",
"output": "2 1 3 4"
}
] | 1,518,530,147
| 3,947
|
Python 3
|
OK
|
TESTS
| 54
| 62
| 5,734,400
|
from sys import stdin, stdout
n = int(input())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
l = [0] * n
o = list(range(1, n+1))
for i in range(n):
if a[i] == b[i]:
l[i] = a[i]
o.pop(o.index(a[i]))
u = 0
pl = list(l)
for i in range(n):
if a[i] != b[i]:
l[i] = o[u]
u += 1
da, db = 0, 0
for f in range(n):
if a[f] != l[f]:
da+=1
if b[f] != l[f]:
db+=1
if da > 1 or db > 1:
u = len(o) - 1
for i in range(n):
if a[i] != b[i]:
pl[i] = o[u]
u -= 1
l = list(pl)
for j in l:
stdout.write(str(j) + " ")
print()
|
Title: An express train to reveries
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sengoku still remembers the mysterious "colourful meteoroids" she discovered with Lala-chan when they were little. In particular, one of the nights impressed her deeply, giving her the illusion that all her fancies would be realized.
On that night, Sengoku constructed a permutation *p*1,<=*p*2,<=...,<=*p**n* of integers from 1 to *n* inclusive, with each integer representing a colour, wishing for the colours to see in the coming meteor outburst. Two incredible outbursts then arrived, each with *n* meteorids, colours of which being integer sequences *a*1,<=*a*2,<=...,<=*a**n* and *b*1,<=*b*2,<=...,<=*b**n* respectively. Meteoroids' colours were also between 1 and *n* inclusive, and the two sequences were not identical, that is, at least one *i* (1<=≤<=*i*<=≤<=*n*) exists, such that *a**i*<=≠<=*b**i* holds.
Well, she almost had it all — each of the sequences *a* and *b* matched exactly *n*<=-<=1 elements in Sengoku's permutation. In other words, there is exactly one *i* (1<=≤<=*i*<=≤<=*n*) such that *a**i*<=≠<=*p**i*, and exactly one *j* (1<=≤<=*j*<=≤<=*n*) such that *b**j*<=≠<=*p**j*.
For now, Sengoku is able to recover the actual colour sequences *a* and *b* through astronomical records, but her wishes have been long forgotten. You are to reconstruct any possible permutation Sengoku could have had on that night.
Input Specification:
The first line of input contains a positive integer *n* (2<=≤<=*n*<=≤<=1<=000) — the length of Sengoku's permutation, being the length of both meteor outbursts at the same time.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the sequence of colours in the first meteor outburst.
The third line contains *n* space-separated integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=*n*) — the sequence of colours in the second meteor outburst. At least one *i* (1<=≤<=*i*<=≤<=*n*) exists, such that *a**i*<=≠<=*b**i* holds.
Output Specification:
Output *n* space-separated integers *p*1,<=*p*2,<=...,<=*p**n*, denoting a possible permutation Sengoku could have had. If there are more than one possible answer, output any one of them.
Input guarantees that such permutation exists.
Demo Input:
['5\n1 2 3 4 3\n1 2 5 4 5\n', '5\n4 4 2 3 1\n5 4 5 3 1\n', '4\n1 1 3 4\n1 4 3 4\n']
Demo Output:
['1 2 5 4 3\n', '5 4 2 3 1\n', '1 2 3 4\n']
Note:
In the first sample, both 1, 2, 5, 4, 3 and 1, 2, 3, 4, 5 are acceptable outputs.
In the second sample, 5, 4, 2, 3, 1 is the only permutation to satisfy the constraints.
|
```python
from sys import stdin, stdout
n = int(input())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
l = [0] * n
o = list(range(1, n+1))
for i in range(n):
if a[i] == b[i]:
l[i] = a[i]
o.pop(o.index(a[i]))
u = 0
pl = list(l)
for i in range(n):
if a[i] != b[i]:
l[i] = o[u]
u += 1
da, db = 0, 0
for f in range(n):
if a[f] != l[f]:
da+=1
if b[f] != l[f]:
db+=1
if da > 1 or db > 1:
u = len(o) - 1
for i in range(n):
if a[i] != b[i]:
pl[i] = o[u]
u -= 1
l = list(pl)
for j in l:
stdout.write(str(j) + " ")
print()
```
| 3
|
|
912
|
A
|
Tricky Alchemy
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
During the winter holidays, the demand for Christmas balls is exceptionally high. Since it's already 2018, the advances in alchemy allow easy and efficient ball creation by utilizing magic crystals.
Grisha needs to obtain some yellow, green and blue balls. It's known that to produce a yellow ball one needs two yellow crystals, green — one yellow and one blue, and for a blue ball, three blue crystals are enough.
Right now there are *A* yellow and *B* blue crystals in Grisha's disposal. Find out how many additional crystals he should acquire in order to produce the required number of balls.
|
The first line features two integers *A* and *B* (0<=≤<=*A*,<=*B*<=≤<=109), denoting the number of yellow and blue crystals respectively at Grisha's disposal.
The next line contains three integers *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=109) — the respective amounts of yellow, green and blue balls to be obtained.
|
Print a single integer — the minimum number of crystals that Grisha should acquire in addition.
|
[
"4 3\n2 1 1\n",
"3 9\n1 1 3\n",
"12345678 87654321\n43043751 1000000000 53798715\n"
] |
[
"2\n",
"1\n",
"2147483648\n"
] |
In the first sample case, Grisha needs five yellow and four blue crystals to create two yellow balls, one green ball, and one blue ball. To do that, Grisha needs to obtain two additional crystals: one yellow and one blue.
| 500
|
[
{
"input": "4 3\n2 1 1",
"output": "2"
},
{
"input": "3 9\n1 1 3",
"output": "1"
},
{
"input": "12345678 87654321\n43043751 1000000000 53798715",
"output": "2147483648"
},
{
"input": "12 12\n3 5 2",
"output": "0"
},
{
"input": "770 1390\n170 442 311",
"output": "12"
},
{
"input": "3555165 6693472\n1499112 556941 3075290",
"output": "3089339"
},
{
"input": "0 0\n1000000000 1000000000 1000000000",
"output": "7000000000"
},
{
"input": "1 1\n0 1 0",
"output": "0"
},
{
"input": "117708228 562858833\n118004008 360437130 154015822",
"output": "738362681"
},
{
"input": "999998118 700178721\n822106746 82987112 547955384",
"output": "1753877029"
},
{
"input": "566568710 765371101\n60614022 80126928 809950465",
"output": "1744607222"
},
{
"input": "448858599 829062060\n764716760 97644201 203890025",
"output": "1178219122"
},
{
"input": "626115781 966381948\n395190569 820194184 229233367",
"output": "1525971878"
},
{
"input": "803372962 103701834\n394260597 837711458 623172928",
"output": "3426388098"
},
{
"input": "980630143 241021722\n24734406 928857659 312079781",
"output": "1624075280"
},
{
"input": "862920032 378341609\n360240924 241342224 337423122",
"output": "974174021"
},
{
"input": "40177212 515661496\n64343660 963892207 731362684",
"output": "3694721078"
},
{
"input": "217434393 579352456\n694817470 981409480 756706026",
"output": "4825785129"
},
{
"input": "394691574 716672343\n398920207 72555681 150645586",
"output": "475704521"
},
{
"input": "276981463 853992230\n29394015 90072954 839552440",
"output": "1754738044"
},
{
"input": "843552056 919184611\n341530221 423649259 101547519",
"output": "263157645"
},
{
"input": "20809236 56504497\n972004030 441166533 495487081",
"output": "4235488636"
},
{
"input": "198066417 825228166\n602477839 532312735 520830423",
"output": "2808777834"
},
{
"input": "80356306 962548053\n601547868 549830008 914769984",
"output": "4004161345"
},
{
"input": "257613487 394835231\n642087093 567347282 308709545",
"output": "2692548667"
},
{
"input": "139903376 532155119\n641157122 289897263 629020178",
"output": "3077110809"
},
{
"input": "612127849 669475006\n271630930 676010757 22959739",
"output": "682559736"
},
{
"input": "0 0\n0 0 0",
"output": "0"
},
{
"input": "1000000000 1000000000\n499999998 4 333333332",
"output": "0"
},
{
"input": "1000000000 1000000000\n1000000000 1000000000 1000000000",
"output": "5000000000"
},
{
"input": "4 3\n1 0 1",
"output": "0"
},
{
"input": "4 12\n1 2 3",
"output": "0"
},
{
"input": "4 20\n1 2 1",
"output": "0"
},
{
"input": "100 10\n2 3 4",
"output": "5"
},
{
"input": "6 0\n1 1 1",
"output": "4"
},
{
"input": "25 5\n3 3 3",
"output": "7"
},
{
"input": "48 27\n22 39 20",
"output": "107"
},
{
"input": "4 0\n1 1 1",
"output": "4"
}
] | 1,579,332,610
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 38
| 170
| 0
|
import sys
import math
import bisect
import itertools
def main():
A = list(map(int, input().split()))
B = list(map(int, input().split()))
#print('A: ' + str(A))
#print('B: ' + str(B))
yellow = B[0] * 2 + B[1] * 1
blue = B[1] * 1 + B[2] * 3
ans = 0
#print('yellow: %d, blue: %d' % (yellow, blue))
if A[0] < yellow:
ans += yellow - A[0]
if A[1] < blue:
ans += blue - A[1]
print(ans)
if __name__ == "__main__":
main()
|
Title: Tricky Alchemy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
During the winter holidays, the demand for Christmas balls is exceptionally high. Since it's already 2018, the advances in alchemy allow easy and efficient ball creation by utilizing magic crystals.
Grisha needs to obtain some yellow, green and blue balls. It's known that to produce a yellow ball one needs two yellow crystals, green — one yellow and one blue, and for a blue ball, three blue crystals are enough.
Right now there are *A* yellow and *B* blue crystals in Grisha's disposal. Find out how many additional crystals he should acquire in order to produce the required number of balls.
Input Specification:
The first line features two integers *A* and *B* (0<=≤<=*A*,<=*B*<=≤<=109), denoting the number of yellow and blue crystals respectively at Grisha's disposal.
The next line contains three integers *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=109) — the respective amounts of yellow, green and blue balls to be obtained.
Output Specification:
Print a single integer — the minimum number of crystals that Grisha should acquire in addition.
Demo Input:
['4 3\n2 1 1\n', '3 9\n1 1 3\n', '12345678 87654321\n43043751 1000000000 53798715\n']
Demo Output:
['2\n', '1\n', '2147483648\n']
Note:
In the first sample case, Grisha needs five yellow and four blue crystals to create two yellow balls, one green ball, and one blue ball. To do that, Grisha needs to obtain two additional crystals: one yellow and one blue.
|
```python
import sys
import math
import bisect
import itertools
def main():
A = list(map(int, input().split()))
B = list(map(int, input().split()))
#print('A: ' + str(A))
#print('B: ' + str(B))
yellow = B[0] * 2 + B[1] * 1
blue = B[1] * 1 + B[2] * 3
ans = 0
#print('yellow: %d, blue: %d' % (yellow, blue))
if A[0] < yellow:
ans += yellow - A[0]
if A[1] < blue:
ans += blue - A[1]
print(ans)
if __name__ == "__main__":
main()
```
| 3
|
|
834
|
A
|
The Useless Toy
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Walking through the streets of Marshmallow City, Slastyona have spotted some merchants selling a kind of useless toy which is very popular nowadays – caramel spinner! Wanting to join the craze, she has immediately bought the strange contraption.
Spinners in Sweetland have the form of V-shaped pieces of caramel. Each spinner can, well, spin around an invisible magic axis. At a specific point in time, a spinner can take 4 positions shown below (each one rotated 90 degrees relative to the previous, with the fourth one followed by the first one):
After the spinner was spun, it starts its rotation, which is described by a following algorithm: the spinner maintains its position for a second then majestically switches to the next position in clockwise or counter-clockwise order, depending on the direction the spinner was spun in.
Slastyona managed to have spinner rotating for exactly *n* seconds. Being fascinated by elegance of the process, she completely forgot the direction the spinner was spun in! Lucky for her, she managed to recall the starting position, and wants to deduct the direction given the information she knows. Help her do this.
|
There are two characters in the first string – the starting and the ending position of a spinner. The position is encoded with one of the following characters: v (ASCII code 118, lowercase v), < (ASCII code 60), ^ (ASCII code 94) or > (ASCII code 62) (see the picture above for reference). Characters are separated by a single space.
In the second strings, a single number *n* is given (0<=≤<=*n*<=≤<=109) – the duration of the rotation.
It is guaranteed that the ending position of a spinner is a result of a *n* second spin in any of the directions, assuming the given starting position.
|
Output cw, if the direction is clockwise, ccw – if counter-clockwise, and undefined otherwise.
|
[
"^ >\n1\n",
"< ^\n3\n",
"^ v\n6\n"
] |
[
"cw\n",
"ccw\n",
"undefined\n"
] |
none
| 500
|
[
{
"input": "^ >\n1",
"output": "cw"
},
{
"input": "< ^\n3",
"output": "ccw"
},
{
"input": "^ v\n6",
"output": "undefined"
},
{
"input": "^ >\n999999999",
"output": "ccw"
},
{
"input": "> v\n1",
"output": "cw"
},
{
"input": "v <\n1",
"output": "cw"
},
{
"input": "< ^\n1",
"output": "cw"
},
{
"input": "v <\n422435957",
"output": "cw"
},
{
"input": "v >\n139018901",
"output": "ccw"
},
{
"input": "v ^\n571728018",
"output": "undefined"
},
{
"input": "^ ^\n0",
"output": "undefined"
},
{
"input": "< >\n2",
"output": "undefined"
},
{
"input": "> >\n1000000000",
"output": "undefined"
},
{
"input": "v v\n8",
"output": "undefined"
},
{
"input": "< <\n1568",
"output": "undefined"
},
{
"input": "^ v\n2",
"output": "undefined"
},
{
"input": "^ <\n1",
"output": "ccw"
},
{
"input": "< v\n1",
"output": "ccw"
},
{
"input": "v >\n1",
"output": "ccw"
},
{
"input": "> ^\n1",
"output": "ccw"
},
{
"input": "v <\n422435957",
"output": "cw"
},
{
"input": "v v\n927162384",
"output": "undefined"
},
{
"input": "v ^\n571728018",
"output": "undefined"
},
{
"input": "^ <\n467441155",
"output": "cw"
},
{
"input": "^ >\n822875521",
"output": "cw"
},
{
"input": "^ <\n821690113",
"output": "ccw"
},
{
"input": "^ <\n171288453",
"output": "ccw"
},
{
"input": "^ <\n110821381",
"output": "ccw"
},
{
"input": "^ ^\n539580280",
"output": "undefined"
},
{
"input": "^ >\n861895563",
"output": "ccw"
},
{
"input": "v v\n4",
"output": "undefined"
},
{
"input": "^ ^\n4",
"output": "undefined"
},
{
"input": "> >\n4",
"output": "undefined"
},
{
"input": "< <\n8",
"output": "undefined"
},
{
"input": "v v\n0",
"output": "undefined"
},
{
"input": "^ <\n11",
"output": "cw"
},
{
"input": "< <\n4",
"output": "undefined"
},
{
"input": "< <\n0",
"output": "undefined"
},
{
"input": "< v\n3",
"output": "cw"
},
{
"input": "^ <\n3",
"output": "cw"
},
{
"input": "^ <\n7",
"output": "cw"
},
{
"input": "< >\n6",
"output": "undefined"
},
{
"input": "v >\n3",
"output": "cw"
},
{
"input": "> >\n300",
"output": "undefined"
},
{
"input": "> >\n0",
"output": "undefined"
},
{
"input": "v <\n3",
"output": "ccw"
},
{
"input": "> >\n12",
"output": "undefined"
}
] | 1,501,722,209
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 47
| 77
| 4,608,000
|
# Description of the problem can be found at http://codeforces.com/problemset/problem/834/A
d = {"v": 0, "<": 1, "^": 2, ">": 3}
f1, f2 = input().split()
s = int(input())
x1 = (d[f1] + s) % 4 == d[f2]
x2 = (d[f1] - s) % 4 == d[f2]
if x1 and x2:
print("undefined")
elif x1:
print("cw")
else:
print("ccw")
|
Title: The Useless Toy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Walking through the streets of Marshmallow City, Slastyona have spotted some merchants selling a kind of useless toy which is very popular nowadays – caramel spinner! Wanting to join the craze, she has immediately bought the strange contraption.
Spinners in Sweetland have the form of V-shaped pieces of caramel. Each spinner can, well, spin around an invisible magic axis. At a specific point in time, a spinner can take 4 positions shown below (each one rotated 90 degrees relative to the previous, with the fourth one followed by the first one):
After the spinner was spun, it starts its rotation, which is described by a following algorithm: the spinner maintains its position for a second then majestically switches to the next position in clockwise or counter-clockwise order, depending on the direction the spinner was spun in.
Slastyona managed to have spinner rotating for exactly *n* seconds. Being fascinated by elegance of the process, she completely forgot the direction the spinner was spun in! Lucky for her, she managed to recall the starting position, and wants to deduct the direction given the information she knows. Help her do this.
Input Specification:
There are two characters in the first string – the starting and the ending position of a spinner. The position is encoded with one of the following characters: v (ASCII code 118, lowercase v), < (ASCII code 60), ^ (ASCII code 94) or > (ASCII code 62) (see the picture above for reference). Characters are separated by a single space.
In the second strings, a single number *n* is given (0<=≤<=*n*<=≤<=109) – the duration of the rotation.
It is guaranteed that the ending position of a spinner is a result of a *n* second spin in any of the directions, assuming the given starting position.
Output Specification:
Output cw, if the direction is clockwise, ccw – if counter-clockwise, and undefined otherwise.
Demo Input:
['^ >\n1\n', '< ^\n3\n', '^ v\n6\n']
Demo Output:
['cw\n', 'ccw\n', 'undefined\n']
Note:
none
|
```python
# Description of the problem can be found at http://codeforces.com/problemset/problem/834/A
d = {"v": 0, "<": 1, "^": 2, ">": 3}
f1, f2 = input().split()
s = int(input())
x1 = (d[f1] + s) % 4 == d[f2]
x2 = (d[f1] - s) % 4 == d[f2]
if x1 and x2:
print("undefined")
elif x1:
print("cw")
else:
print("ccw")
```
| 3
|
|
637
|
B
|
Chat Order
|
PROGRAMMING
| 1,200
|
[
"*special",
"binary search",
"constructive algorithms",
"data structures",
"sortings"
] | null | null |
Polycarp is a big lover of killing time in social networks. A page with a chatlist in his favourite network is made so that when a message is sent to some friend, his friend's chat rises to the very top of the page. The relative order of the other chats doesn't change. If there was no chat with this friend before, then a new chat is simply inserted to the top of the list.
Assuming that the chat list is initially empty, given the sequence of Polycaprus' messages make a list of chats after all of his messages are processed. Assume that no friend wrote any message to Polycarpus.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of Polycarpus' messages. Next *n* lines enlist the message recipients in the order in which the messages were sent. The name of each participant is a non-empty sequence of lowercase English letters of length at most 10.
|
Print all the recipients to who Polycarp talked to in the order of chats with them, from top to bottom.
|
[
"4\nalex\nivan\nroman\nivan\n",
"8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina\n"
] |
[
"ivan\nroman\nalex\n",
"alina\nmaria\nekaterina\ndarya\n"
] |
In the first test case Polycarpus first writes to friend by name "alex", and the list looks as follows:
1. alex
Then Polycarpus writes to friend by name "ivan" and the list looks as follows:
1. ivan 1. alex
Polycarpus writes the third message to friend by name "roman" and the list looks as follows:
1. roman 1. ivan 1. alex
Polycarpus writes the fourth message to friend by name "ivan", to who he has already sent a message, so the list of chats changes as follows:
1. ivan 1. roman 1. alex
| 1,000
|
[
{
"input": "4\nalex\nivan\nroman\nivan",
"output": "ivan\nroman\nalex"
},
{
"input": "8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina",
"output": "alina\nmaria\nekaterina\ndarya"
},
{
"input": "1\nwdi",
"output": "wdi"
},
{
"input": "2\nypg\nypg",
"output": "ypg"
},
{
"input": "3\nexhll\nexhll\narruapexj",
"output": "arruapexj\nexhll"
},
{
"input": "3\nfv\nle\nle",
"output": "le\nfv"
},
{
"input": "8\nm\nm\nm\nm\nm\nm\nm\nm",
"output": "m"
},
{
"input": "10\nr\nr\ni\nw\nk\nr\nb\nu\nu\nr",
"output": "r\nu\nb\nk\nw\ni"
},
{
"input": "7\ne\nfau\ncmk\nnzs\nby\nwx\ntjmok",
"output": "tjmok\nwx\nby\nnzs\ncmk\nfau\ne"
},
{
"input": "6\nklrj\nwe\nklrj\nwe\nwe\nwe",
"output": "we\nklrj"
},
{
"input": "8\nzncybqmh\naeebef\nzncybqmh\nn\naeebef\nzncybqmh\nzncybqmh\nzncybqmh",
"output": "zncybqmh\naeebef\nn"
},
{
"input": "30\nkqqcbs\nvap\nkymomn\nj\nkqqcbs\nfuzlzoum\nkymomn\ndbh\nfuzlzoum\nkymomn\nvap\nvlgzs\ndbh\nvlgzs\nbvy\ndbh\nkymomn\nkymomn\neoqql\nkymomn\nkymomn\nkqqcbs\nvlgzs\nkqqcbs\nkqqcbs\nfuzlzoum\nvlgzs\nrylgdoo\nvlgzs\nrylgdoo",
"output": "rylgdoo\nvlgzs\nfuzlzoum\nkqqcbs\nkymomn\neoqql\ndbh\nbvy\nvap\nj"
},
{
"input": "40\nji\nv\nv\nns\nji\nn\nji\nv\nfvy\nvje\nns\nvje\nv\nhas\nv\nusm\nhas\nfvy\nvje\nkdb\nn\nv\nji\nji\nn\nhas\nv\nji\nkdb\nr\nvje\nns\nv\nusm\nn\nvje\nhas\nns\nhas\nn",
"output": "n\nhas\nns\nvje\nusm\nv\nr\nkdb\nji\nfvy"
},
{
"input": "50\njcg\nvle\njopb\nepdb\nnkef\nfv\nxj\nufe\nfuy\noqta\ngbc\nyuz\nec\nyji\nkuux\ncwm\ntq\nnno\nhp\nzry\nxxpp\ntjvo\ngyz\nkwo\nvwqz\nyaqc\njnj\nwoav\nqcv\ndcu\ngc\nhovn\nop\nevy\ndc\ntrpu\nyb\nuzfa\npca\noq\nnhxy\nsiqu\nde\nhphy\nc\nwovu\nf\nbvv\ndsik\nlwyg",
"output": "lwyg\ndsik\nbvv\nf\nwovu\nc\nhphy\nde\nsiqu\nnhxy\noq\npca\nuzfa\nyb\ntrpu\ndc\nevy\nop\nhovn\ngc\ndcu\nqcv\nwoav\njnj\nyaqc\nvwqz\nkwo\ngyz\ntjvo\nxxpp\nzry\nhp\nnno\ntq\ncwm\nkuux\nyji\nec\nyuz\ngbc\noqta\nfuy\nufe\nxj\nfv\nnkef\nepdb\njopb\nvle\njcg"
},
{
"input": "100\nvhh\nvhh\nvhh\nfa\nfa\nvhh\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nfa\nfa\nfa\nfa\nfa\nfa\nvhh\nfa\nfa\nvhh\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nvhh\nfa\nvhh\nvhh\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nfa\nfa\nfa\nfa\nfa\nfa\nvhh\nvhh\nfa\nvhh\nfa\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nvhh\nfa\nvhh",
"output": "vhh\nfa"
},
{
"input": "2\naa\nbb",
"output": "bb\naa"
},
{
"input": "2\naa\na",
"output": "a\naa"
},
{
"input": "3\naa\naa\naa",
"output": "aa"
},
{
"input": "5\naa\na\naa\na\naa",
"output": "aa\na"
},
{
"input": "7\naaaa\naaaa\naaa\na\naa\naaaaaaa\naaa",
"output": "aaa\naaaaaaa\naa\na\naaaa"
},
{
"input": "5\na\naa\naaa\naaaa\na",
"output": "a\naaaa\naaa\naa"
},
{
"input": "12\naaaaa\naaaaaa\naaaa\naaaaaa\naa\naaaa\naaaa\naaaaaa\na\naaa\naaaaaaaa\naa",
"output": "aa\naaaaaaaa\naaa\na\naaaaaa\naaaa\naaaaa"
},
{
"input": "3\na\naa\naaa",
"output": "aaa\naa\na"
},
{
"input": "9\nzzz\nzzzzz\nzzz\nzzzz\nzz\nzzzz\nzzzzz\nzzzz\nzzzzzzz",
"output": "zzzzzzz\nzzzz\nzzzzz\nzz\nzzz"
}
] | 1,691,532,834
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 95
| 1,216
| 28,876,800
|
m = int(input())
chat_list = []
printed = set()
for _ in range(m):
ctt = input()
chat_list.append(ctt)
for i in range(len(chat_list) - 1, -1, -1):
ctt = chat_list[i]
if ctt not in printed:
print(chat_list[i])
printed.add(ctt)
|
Title: Chat Order
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is a big lover of killing time in social networks. A page with a chatlist in his favourite network is made so that when a message is sent to some friend, his friend's chat rises to the very top of the page. The relative order of the other chats doesn't change. If there was no chat with this friend before, then a new chat is simply inserted to the top of the list.
Assuming that the chat list is initially empty, given the sequence of Polycaprus' messages make a list of chats after all of his messages are processed. Assume that no friend wrote any message to Polycarpus.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of Polycarpus' messages. Next *n* lines enlist the message recipients in the order in which the messages were sent. The name of each participant is a non-empty sequence of lowercase English letters of length at most 10.
Output Specification:
Print all the recipients to who Polycarp talked to in the order of chats with them, from top to bottom.
Demo Input:
['4\nalex\nivan\nroman\nivan\n', '8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina\n']
Demo Output:
['ivan\nroman\nalex\n', 'alina\nmaria\nekaterina\ndarya\n']
Note:
In the first test case Polycarpus first writes to friend by name "alex", and the list looks as follows:
1. alex
Then Polycarpus writes to friend by name "ivan" and the list looks as follows:
1. ivan 1. alex
Polycarpus writes the third message to friend by name "roman" and the list looks as follows:
1. roman 1. ivan 1. alex
Polycarpus writes the fourth message to friend by name "ivan", to who he has already sent a message, so the list of chats changes as follows:
1. ivan 1. roman 1. alex
|
```python
m = int(input())
chat_list = []
printed = set()
for _ in range(m):
ctt = input()
chat_list.append(ctt)
for i in range(len(chat_list) - 1, -1, -1):
ctt = chat_list[i]
if ctt not in printed:
print(chat_list[i])
printed.add(ctt)
```
| 3
|
|
902
|
A
|
Visiting a Friend
|
PROGRAMMING
| 1,100
|
[
"greedy",
"implementation"
] | null | null |
Pig is visiting a friend.
Pig's house is located at point 0, and his friend's house is located at point *m* on an axis.
Pig can use teleports to move along the axis.
To use a teleport, Pig should come to a certain point (where the teleport is located) and choose where to move: for each teleport there is the rightmost point it can move Pig to, this point is known as the limit of the teleport.
Formally, a teleport located at point *x* with limit *y* can move Pig from point *x* to any point within the segment [*x*;<=*y*], including the bounds.
Determine if Pig can visit the friend using teleports only, or he should use his car.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*m*<=≤<=100) — the number of teleports and the location of the friend's house.
The next *n* lines contain information about teleports.
The *i*-th of these lines contains two integers *a**i* and *b**i* (0<=≤<=*a**i*<=≤<=*b**i*<=≤<=*m*), where *a**i* is the location of the *i*-th teleport, and *b**i* is its limit.
It is guaranteed that *a**i*<=≥<=*a**i*<=-<=1 for every *i* (2<=≤<=*i*<=≤<=*n*).
|
Print "YES" if there is a path from Pig's house to his friend's house that uses only teleports, and "NO" otherwise.
You can print each letter in arbitrary case (upper or lower).
|
[
"3 5\n0 2\n2 4\n3 5\n",
"3 7\n0 4\n2 5\n6 7\n"
] |
[
"YES\n",
"NO\n"
] |
The first example is shown on the picture below:
Pig can use the first teleport from his house (point 0) to reach point 2, then using the second teleport go from point 2 to point 3, then using the third teleport go from point 3 to point 5, where his friend lives.
The second example is shown on the picture below:
You can see that there is no path from Pig's house to his friend's house that uses only teleports.
| 500
|
[
{
"input": "3 5\n0 2\n2 4\n3 5",
"output": "YES"
},
{
"input": "3 7\n0 4\n2 5\n6 7",
"output": "NO"
},
{
"input": "1 1\n0 0",
"output": "NO"
},
{
"input": "30 10\n0 7\n1 2\n1 2\n1 4\n1 4\n1 3\n2 2\n2 4\n2 6\n2 9\n2 2\n3 5\n3 8\n4 8\n4 5\n4 6\n5 6\n5 7\n6 6\n6 9\n6 7\n6 9\n7 7\n7 7\n8 8\n8 8\n9 9\n9 9\n10 10\n10 10",
"output": "NO"
},
{
"input": "30 100\n0 27\n4 82\n11 81\n14 32\n33 97\n33 34\n37 97\n38 52\n45 91\n49 56\n50 97\n57 70\n59 94\n59 65\n62 76\n64 65\n65 95\n67 77\n68 100\n71 73\n80 94\n81 92\n84 85\n85 100\n88 91\n91 95\n92 98\n92 98\n99 100\n100 100",
"output": "YES"
},
{
"input": "70 10\n0 4\n0 4\n0 8\n0 9\n0 1\n0 5\n0 7\n1 3\n1 8\n1 8\n1 6\n1 6\n1 2\n1 3\n1 2\n1 3\n2 5\n2 4\n2 3\n2 4\n2 6\n2 2\n2 5\n2 7\n3 7\n3 4\n3 7\n3 4\n3 8\n3 4\n3 9\n3 3\n3 7\n3 9\n3 3\n3 9\n4 6\n4 7\n4 5\n4 7\n5 8\n5 5\n5 9\n5 7\n5 5\n6 6\n6 9\n6 7\n6 8\n6 9\n6 8\n7 7\n7 8\n7 7\n7 8\n8 9\n8 8\n8 9\n8 8\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "NO"
},
{
"input": "30 10\n0 7\n1 2\n1 2\n1 4\n1 4\n1 3\n2 2\n2 4\n2 6\n2 9\n2 2\n3 5\n3 8\n4 8\n4 5\n4 6\n5 6\n5 7\n6 6\n6 9\n6 7\n6 9\n7 7\n7 7\n8 10\n8 10\n9 9\n9 9\n10 10\n10 10",
"output": "YES"
},
{
"input": "50 100\n0 95\n1 100\n1 38\n2 82\n5 35\n7 71\n8 53\n11 49\n15 27\n17 84\n17 75\n18 99\n18 43\n18 69\n21 89\n27 60\n27 29\n38 62\n38 77\n39 83\n40 66\n48 80\n48 100\n50 51\n50 61\n53 77\n53 63\n55 58\n56 68\n60 82\n62 95\n66 74\n67 83\n69 88\n69 81\n69 88\n69 98\n70 91\n70 76\n71 90\n72 99\n81 99\n85 87\n88 97\n88 93\n90 97\n90 97\n92 98\n98 99\n100 100",
"output": "YES"
},
{
"input": "70 10\n0 4\n0 4\n0 8\n0 9\n0 1\n0 5\n0 7\n1 3\n1 8\n1 8\n1 10\n1 9\n1 6\n1 2\n1 3\n1 2\n2 6\n2 5\n2 4\n2 3\n2 10\n2 2\n2 6\n2 2\n3 10\n3 7\n3 7\n3 4\n3 7\n3 4\n3 8\n3 4\n3 10\n3 5\n3 3\n3 7\n4 8\n4 8\n4 9\n4 6\n5 7\n5 10\n5 7\n5 8\n5 5\n6 8\n6 9\n6 10\n6 6\n6 9\n6 7\n7 8\n7 9\n7 10\n7 10\n8 8\n8 8\n8 9\n8 10\n9 10\n9 9\n9 10\n9 10\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "YES"
},
{
"input": "85 10\n0 9\n0 4\n0 2\n0 5\n0 1\n0 8\n0 7\n1 2\n1 4\n1 5\n1 9\n1 1\n1 6\n1 6\n2 5\n2 7\n2 7\n2 7\n2 7\n3 4\n3 7\n3 9\n3 5\n3 3\n4 4\n4 6\n4 5\n5 6\n5 6\n5 6\n5 6\n5 7\n5 8\n5 5\n5 7\n5 8\n5 9\n5 8\n6 8\n6 7\n6 8\n6 9\n6 9\n6 6\n6 9\n6 7\n7 7\n7 7\n7 7\n7 8\n7 7\n7 8\n7 8\n7 9\n8 8\n8 8\n8 8\n8 8\n8 8\n8 9\n8 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "NO"
},
{
"input": "30 40\n0 0\n4 8\n5 17\n7 32\n7 16\n8 16\n10 19\n12 22\n12 27\n13 21\n13 28\n13 36\n14 28\n14 18\n18 21\n21 26\n21 36\n22 38\n23 32\n24 30\n26 35\n29 32\n29 32\n31 34\n31 31\n33 33\n33 35\n35 40\n38 38\n40 40",
"output": "NO"
},
{
"input": "70 100\n0 99\n1 87\n1 94\n1 4\n2 72\n3 39\n3 69\n4 78\n5 85\n7 14\n8 59\n12 69\n14 15\n14 76\n17 17\n19 53\n19 57\n19 21\n21 35\n21 83\n24 52\n24 33\n27 66\n27 97\n30 62\n30 74\n30 64\n32 63\n35 49\n37 60\n40 99\n40 71\n41 83\n42 66\n42 46\n45 83\n51 76\n53 69\n54 82\n54 96\n54 88\n55 91\n56 88\n58 62\n62 87\n64 80\n67 90\n67 69\n68 92\n72 93\n74 93\n77 79\n77 91\n78 97\n78 98\n81 85\n81 83\n81 83\n84 85\n86 88\n89 94\n89 92\n92 97\n96 99\n97 98\n97 99\n99 99\n100 100\n100 100\n100 100",
"output": "NO"
},
{
"input": "1 10\n0 10",
"output": "YES"
},
{
"input": "70 40\n0 34\n1 16\n3 33\n4 36\n4 22\n5 9\n5 9\n7 16\n8 26\n9 29\n9 25\n10 15\n10 22\n10 29\n10 20\n11 27\n11 26\n11 12\n12 19\n13 21\n14 31\n14 36\n15 34\n15 37\n16 21\n17 31\n18 22\n20 27\n20 32\n20 20\n20 29\n21 29\n21 34\n21 30\n22 40\n23 23\n23 28\n24 29\n25 38\n26 35\n27 37\n28 39\n28 33\n28 40\n28 33\n29 31\n29 33\n30 38\n30 36\n30 30\n30 38\n31 37\n31 35\n31 32\n31 36\n33 39\n33 40\n35 38\n36 38\n37 38\n37 40\n38 39\n38 40\n38 39\n39 39\n39 40\n40 40\n40 40\n40 40\n40 40",
"output": "YES"
},
{
"input": "50 40\n0 9\n1 26\n1 27\n2 33\n2 5\n3 30\n4 28\n5 31\n5 27\n5 29\n7 36\n8 32\n8 13\n9 24\n10 10\n10 30\n11 26\n11 22\n11 40\n11 31\n12 26\n13 25\n14 32\n17 19\n21 29\n22 36\n24 27\n25 39\n25 27\n27 32\n27 29\n27 39\n27 29\n28 38\n30 38\n32 40\n32 38\n33 33\n33 40\n34 35\n34 34\n34 38\n34 38\n35 37\n36 39\n36 39\n37 37\n38 40\n39 39\n40 40",
"output": "YES"
},
{
"input": "70 40\n0 34\n1 16\n3 33\n4 36\n4 22\n5 9\n5 9\n7 16\n8 26\n9 29\n9 25\n10 15\n10 22\n10 29\n10 20\n11 27\n11 26\n11 12\n12 19\n13 21\n14 31\n14 36\n15 34\n15 37\n16 21\n17 31\n18 22\n20 27\n20 32\n20 20\n20 29\n21 29\n21 34\n21 30\n22 22\n23 28\n23 39\n24 24\n25 27\n26 38\n27 39\n28 33\n28 39\n28 34\n28 33\n29 30\n29 35\n30 30\n30 38\n30 34\n30 31\n31 36\n31 31\n31 32\n31 38\n33 34\n33 34\n35 36\n36 38\n37 38\n37 39\n38 38\n38 38\n38 38\n39 39\n39 39\n40 40\n40 40\n40 40\n40 40",
"output": "NO"
},
{
"input": "10 100\n0 34\n8 56\n17 79\n24 88\n28 79\n45 79\n48 93\n55 87\n68 93\n88 99",
"output": "NO"
},
{
"input": "10 10\n0 2\n3 8\n3 5\n3 3\n3 9\n3 8\n5 7\n6 10\n7 10\n9 10",
"output": "NO"
},
{
"input": "50 10\n0 2\n0 2\n0 6\n1 9\n1 3\n1 2\n1 6\n1 1\n1 1\n2 7\n2 6\n2 4\n3 9\n3 8\n3 8\n3 8\n3 6\n3 4\n3 7\n3 4\n3 6\n3 5\n4 8\n5 5\n5 7\n6 7\n6 6\n7 7\n7 7\n7 7\n7 8\n7 8\n8 8\n8 8\n8 9\n8 8\n8 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "NO"
},
{
"input": "10 40\n0 21\n1 19\n4 33\n6 26\n8 39\n15 15\n20 24\n27 27\n29 39\n32 37",
"output": "NO"
},
{
"input": "50 10\n0 2\n0 2\n0 6\n1 9\n1 3\n1 2\n1 6\n1 1\n1 1\n2 7\n2 6\n2 4\n3 9\n3 8\n3 8\n3 8\n3 6\n3 4\n3 7\n3 4\n3 6\n3 10\n4 6\n5 9\n5 5\n6 7\n6 10\n7 8\n7 7\n7 7\n7 7\n7 10\n8 8\n8 8\n8 10\n8 8\n8 8\n9 10\n9 10\n9 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "YES"
},
{
"input": "1 1\n0 1",
"output": "YES"
},
{
"input": "30 40\n0 0\n4 8\n5 17\n7 32\n7 16\n8 16\n10 19\n12 22\n12 27\n13 21\n13 28\n13 36\n14 28\n14 18\n18 21\n21 26\n21 36\n22 38\n23 32\n24 30\n26 35\n29 32\n29 32\n31 34\n31 31\n33 33\n33 35\n35 36\n38 38\n40 40",
"output": "NO"
},
{
"input": "30 100\n0 27\n4 82\n11 81\n14 32\n33 97\n33 34\n37 97\n38 52\n45 91\n49 56\n50 97\n57 70\n59 94\n59 65\n62 76\n64 65\n65 95\n67 77\n68 82\n71 94\n80 90\n81 88\n84 93\n85 89\n88 92\n91 97\n92 99\n92 97\n99 99\n100 100",
"output": "NO"
},
{
"input": "10 100\n0 34\n8 56\n17 79\n24 88\n28 79\n45 79\n48 93\n55 87\n68 93\n79 100",
"output": "YES"
},
{
"input": "10 40\n0 21\n1 19\n4 33\n6 26\n8 39\n15 15\n20 24\n27 27\n29 39\n37 40",
"output": "YES"
},
{
"input": "85 10\n0 9\n0 4\n0 2\n0 5\n0 1\n0 8\n0 7\n1 2\n1 10\n1 2\n1 5\n1 10\n1 8\n1 1\n2 8\n2 7\n2 5\n2 5\n2 7\n3 5\n3 7\n3 5\n3 4\n3 7\n4 7\n4 8\n4 6\n5 7\n5 10\n5 5\n5 6\n5 6\n5 6\n5 6\n5 7\n5 8\n5 5\n5 7\n6 10\n6 9\n6 7\n6 10\n6 8\n6 7\n6 10\n6 10\n7 8\n7 9\n7 8\n7 8\n7 8\n7 8\n7 7\n7 7\n8 8\n8 8\n8 10\n8 9\n8 9\n8 9\n8 9\n9 9\n9 10\n9 9\n9 9\n9 9\n9 9\n9 10\n9 10\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "YES"
},
{
"input": "50 100\n0 95\n1 7\n1 69\n2 83\n5 67\n7 82\n8 31\n11 25\n15 44\n17 75\n17 27\n18 43\n18 69\n18 40\n21 66\n27 29\n27 64\n38 77\n38 90\n39 52\n40 60\n48 91\n48 98\n50 89\n50 63\n53 54\n53 95\n55 76\n56 59\n60 96\n62 86\n66 70\n67 77\n69 88\n69 98\n69 80\n69 95\n70 74\n70 77\n71 99\n72 73\n81 87\n85 99\n88 96\n88 91\n90 97\n90 99\n92 92\n98 99\n100 100",
"output": "NO"
},
{
"input": "50 40\n0 9\n1 26\n1 27\n2 33\n2 5\n3 30\n4 28\n5 31\n5 27\n5 29\n7 36\n8 32\n8 13\n9 24\n10 10\n10 30\n11 26\n11 22\n11 35\n11 23\n12 36\n13 31\n14 31\n17 17\n21 25\n22 33\n24 26\n25 32\n25 25\n27 39\n27 29\n27 34\n27 32\n28 34\n30 36\n32 37\n32 33\n33 35\n33 33\n34 38\n34 38\n34 36\n34 36\n35 36\n36 36\n36 39\n37 37\n38 39\n39 39\n40 40",
"output": "NO"
},
{
"input": "10 10\n0 2\n3 8\n3 5\n3 3\n3 9\n3 8\n5 7\n6 9\n7 7\n9 9",
"output": "NO"
},
{
"input": "70 100\n0 99\n1 87\n1 94\n1 4\n2 72\n3 39\n3 69\n4 78\n5 85\n7 14\n8 59\n12 69\n14 15\n14 76\n17 17\n19 53\n19 57\n19 21\n21 35\n21 83\n24 52\n24 33\n27 66\n27 97\n30 62\n30 74\n30 64\n32 63\n35 49\n37 60\n40 99\n40 71\n41 83\n42 66\n42 46\n45 83\n51 76\n53 69\n54 82\n54 96\n54 88\n55 91\n56 88\n58 62\n62 87\n64 80\n67 90\n67 69\n68 92\n72 93\n74 93\n77 79\n77 91\n78 97\n78 98\n81 85\n81 83\n81 83\n84 85\n86 88\n89 94\n89 100\n92 97\n96 96\n97 98\n97 100\n99 100\n100 100\n100 100\n100 100",
"output": "YES"
},
{
"input": "2 2\n0 2\n0 1",
"output": "YES"
},
{
"input": "2 100\n0 49\n50 100",
"output": "NO"
},
{
"input": "2 100\n0 50\n50 100",
"output": "YES"
},
{
"input": "10 100\n0 10\n10 20\n20 30\n30 40\n40 50\n50 60\n60 70\n70 80\n80 90\n90 100",
"output": "YES"
},
{
"input": "100 10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 10",
"output": "YES"
},
{
"input": "1 4\n1 4",
"output": "NO"
},
{
"input": "3 5\n0 2\n2 5\n3 4",
"output": "YES"
},
{
"input": "2 5\n0 5\n1 2",
"output": "YES"
},
{
"input": "5 5\n0 2\n0 2\n3 5\n3 5\n3 5",
"output": "NO"
},
{
"input": "4 10\n0 3\n2 10\n4 10\n5 7",
"output": "YES"
},
{
"input": "3 8\n0 0\n1 8\n2 8",
"output": "NO"
},
{
"input": "6 8\n0 3\n1 5\n2 3\n5 6\n6 7\n7 8",
"output": "YES"
}
] | 1,684,741,687
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 55
| 62
| 0
|
def can_visit_friend(n, m, teleports):
current_pos = 0
for i in range(n):
ai, bi = teleports[i]
if ai > current_pos:
return "NO"
current_pos = max(current_pos, bi)
if current_pos >= m:
return "YES"
return "YES" if current_pos >= m else "NO"
n, m = map(int, input().split())
teleports = []
for _ in range(n):
ai, bi = map(int, input().split())
teleports.append((ai, bi))
result = can_visit_friend(n, m, teleports)
print(result)
|
Title: Visiting a Friend
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pig is visiting a friend.
Pig's house is located at point 0, and his friend's house is located at point *m* on an axis.
Pig can use teleports to move along the axis.
To use a teleport, Pig should come to a certain point (where the teleport is located) and choose where to move: for each teleport there is the rightmost point it can move Pig to, this point is known as the limit of the teleport.
Formally, a teleport located at point *x* with limit *y* can move Pig from point *x* to any point within the segment [*x*;<=*y*], including the bounds.
Determine if Pig can visit the friend using teleports only, or he should use his car.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*m*<=≤<=100) — the number of teleports and the location of the friend's house.
The next *n* lines contain information about teleports.
The *i*-th of these lines contains two integers *a**i* and *b**i* (0<=≤<=*a**i*<=≤<=*b**i*<=≤<=*m*), where *a**i* is the location of the *i*-th teleport, and *b**i* is its limit.
It is guaranteed that *a**i*<=≥<=*a**i*<=-<=1 for every *i* (2<=≤<=*i*<=≤<=*n*).
Output Specification:
Print "YES" if there is a path from Pig's house to his friend's house that uses only teleports, and "NO" otherwise.
You can print each letter in arbitrary case (upper or lower).
Demo Input:
['3 5\n0 2\n2 4\n3 5\n', '3 7\n0 4\n2 5\n6 7\n']
Demo Output:
['YES\n', 'NO\n']
Note:
The first example is shown on the picture below:
Pig can use the first teleport from his house (point 0) to reach point 2, then using the second teleport go from point 2 to point 3, then using the third teleport go from point 3 to point 5, where his friend lives.
The second example is shown on the picture below:
You can see that there is no path from Pig's house to his friend's house that uses only teleports.
|
```python
def can_visit_friend(n, m, teleports):
current_pos = 0
for i in range(n):
ai, bi = teleports[i]
if ai > current_pos:
return "NO"
current_pos = max(current_pos, bi)
if current_pos >= m:
return "YES"
return "YES" if current_pos >= m else "NO"
n, m = map(int, input().split())
teleports = []
for _ in range(n):
ai, bi = map(int, input().split())
teleports.append((ai, bi))
result = can_visit_friend(n, m, teleports)
print(result)
```
| 3
|
|
56
|
A
|
Bar
|
PROGRAMMING
| 1,000
|
[
"implementation"
] |
A. Bar
|
2
|
256
|
According to Berland laws it is only allowed to sell alcohol to people not younger than 18 years. Vasya's job is to monitor the law's enforcement. Tonight he entered a bar and saw *n* people sitting there. For every one of them Vasya happened to determine either the age or the drink the person is having. Vasya can check any person, i.e. learn his age and the drink he is having at the same time. What minimal number of people should Vasya check additionally to make sure that there are no clients under 18 having alcohol drinks?
The list of all alcohol drinks in Berland is: ABSINTH, BEER, BRANDY, CHAMPAGNE, GIN, RUM, SAKE, TEQUILA, VODKA, WHISKEY, WINE
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) which is the number of the bar's clients. Then follow *n* lines, each describing one visitor. A line either contains his age (an integer from 0 to 1000) or his drink (a string of capital Latin letters from 1 to 100 in length). It is guaranteed that the input data does not contain spaces and other unnecessary separators.
Only the drinks from the list given above should be considered alcohol.
|
Print a single number which is the number of people Vasya should check to guarantee the law enforcement.
|
[
"5\n18\nVODKA\nCOKE\n19\n17\n"
] |
[
"2\n"
] |
In the sample test the second and fifth clients should be checked.
| 500
|
[
{
"input": "5\n18\nVODKA\nCOKE\n19\n17",
"output": "2"
},
{
"input": "2\n2\nGIN",
"output": "2"
},
{
"input": "3\nWHISKEY\n3\nGIN",
"output": "3"
},
{
"input": "4\n813\nIORBQITQXMPTFAEMEQDQIKFGKGOTNKTOSZCBRPXJLUKVLVHJYNRUJXK\nRUM\nRHVRWGODYWWTYZFLFYKCVUFFRTQDINKNWPKFHZBFWBHWINWJW",
"output": "1"
},
{
"input": "4\nSAKE\nSAKE\n13\n2",
"output": "4"
},
{
"input": "2\n0\n17",
"output": "2"
},
{
"input": "1\n0",
"output": "1"
}
] | 1,613,475,840
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 28
| 124
| 0
|
a='ABSINTH BEER BRANDY CHAMPAGNE GIN RUM SAKE TEQUILA VODKA WHISKEY WINE'.split()
n=int(input())
ans=0
for i in range(n):
x=input()
if x in a or x.isdigit() and int(x)<18:ans+=1
print(ans)
|
Title: Bar
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
According to Berland laws it is only allowed to sell alcohol to people not younger than 18 years. Vasya's job is to monitor the law's enforcement. Tonight he entered a bar and saw *n* people sitting there. For every one of them Vasya happened to determine either the age or the drink the person is having. Vasya can check any person, i.e. learn his age and the drink he is having at the same time. What minimal number of people should Vasya check additionally to make sure that there are no clients under 18 having alcohol drinks?
The list of all alcohol drinks in Berland is: ABSINTH, BEER, BRANDY, CHAMPAGNE, GIN, RUM, SAKE, TEQUILA, VODKA, WHISKEY, WINE
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) which is the number of the bar's clients. Then follow *n* lines, each describing one visitor. A line either contains his age (an integer from 0 to 1000) or his drink (a string of capital Latin letters from 1 to 100 in length). It is guaranteed that the input data does not contain spaces and other unnecessary separators.
Only the drinks from the list given above should be considered alcohol.
Output Specification:
Print a single number which is the number of people Vasya should check to guarantee the law enforcement.
Demo Input:
['5\n18\nVODKA\nCOKE\n19\n17\n']
Demo Output:
['2\n']
Note:
In the sample test the second and fifth clients should be checked.
|
```python
a='ABSINTH BEER BRANDY CHAMPAGNE GIN RUM SAKE TEQUILA VODKA WHISKEY WINE'.split()
n=int(input())
ans=0
for i in range(n):
x=input()
if x in a or x.isdigit() and int(x)<18:ans+=1
print(ans)
```
| 3.969
|
31
|
A
|
Worms Evolution
|
PROGRAMMING
| 1,200
|
[
"implementation"
] |
A. Worms Evolution
|
2
|
256
|
Professor Vasechkin is studying evolution of worms. Recently he put forward hypotheses that all worms evolve by division. There are *n* forms of worms. Worms of these forms have lengths *a*1, *a*2, ..., *a**n*. To prove his theory, professor needs to find 3 different forms that the length of the first form is equal to sum of lengths of the other two forms. Help him to do this.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of worm's forms. The second line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=1000) — lengths of worms of each form.
|
Output 3 distinct integers *i* *j* *k* (1<=≤<=*i*,<=*j*,<=*k*<=≤<=*n*) — such indexes of worm's forms that *a**i*<==<=*a**j*<=+<=*a**k*. If there is no such triple, output -1. If there are several solutions, output any of them. It possible that *a**j*<==<=*a**k*.
|
[
"5\n1 2 3 5 7\n",
"5\n1 8 1 5 1\n"
] |
[
"3 2 1\n",
"-1\n"
] |
none
| 500
|
[
{
"input": "5\n1 2 3 5 7",
"output": "3 2 1"
},
{
"input": "5\n1 8 1 5 1",
"output": "-1"
},
{
"input": "4\n303 872 764 401",
"output": "-1"
},
{
"input": "6\n86 402 133 524 405 610",
"output": "6 4 1"
},
{
"input": "8\n217 779 418 895 996 473 3 22",
"output": "5 2 1"
},
{
"input": "10\n858 972 670 15 662 114 33 273 53 310",
"output": "2 6 1"
},
{
"input": "100\n611 697 572 770 603 870 128 245 49 904 468 982 788 943 549 288 668 796 803 515 999 735 912 49 298 80 412 841 494 434 543 298 17 571 271 105 70 313 178 755 194 279 585 766 412 164 907 841 776 556 731 268 735 880 176 267 287 65 239 588 155 658 821 47 783 595 585 69 226 906 429 161 999 148 7 484 362 585 952 365 92 749 904 525 307 626 883 367 450 755 564 950 728 724 69 106 119 157 96 290",
"output": "1 38 25"
},
{
"input": "100\n713 572 318 890 577 657 646 146 373 783 392 229 455 871 20 593 573 336 26 381 280 916 907 732 820 713 111 840 570 446 184 711 481 399 788 647 492 15 40 530 549 506 719 782 126 20 778 996 712 761 9 74 812 418 488 175 103 585 900 3 604 521 109 513 145 708 990 361 682 827 791 22 596 780 596 385 450 643 158 496 876 975 319 783 654 895 891 361 397 81 682 899 347 623 809 557 435 279 513 438",
"output": "1 63 61"
},
{
"input": "100\n156 822 179 298 981 82 610 345 373 378 895 734 768 15 78 335 764 608 932 297 717 553 916 367 425 447 361 195 66 70 901 236 905 744 919 564 296 610 963 628 840 52 100 750 345 308 37 687 192 704 101 815 10 990 216 358 823 546 578 821 706 148 182 582 421 482 829 425 121 337 500 301 402 868 66 935 625 527 746 585 308 523 488 914 608 709 875 252 151 781 447 2 756 176 976 302 450 35 680 791",
"output": "1 98 69"
},
{
"input": "100\n54 947 785 838 359 647 92 445 48 465 323 486 101 86 607 31 860 420 709 432 435 372 272 37 903 814 309 197 638 58 259 822 793 564 309 22 522 907 101 853 486 824 614 734 630 452 166 532 256 499 470 9 933 452 256 450 7 26 916 406 257 285 895 117 59 369 424 133 16 417 352 440 806 236 478 34 889 469 540 806 172 296 73 655 261 792 868 380 204 454 330 53 136 629 236 850 134 560 264 291",
"output": "2 29 27"
},
{
"input": "99\n175 269 828 129 499 890 127 263 995 807 508 289 996 226 437 320 365 642 757 22 190 8 345 499 834 713 962 889 336 171 608 492 320 257 472 801 176 325 301 306 198 729 933 4 640 322 226 317 567 586 249 237 202 633 287 128 911 654 719 988 420 855 361 574 716 899 317 356 581 440 284 982 541 111 439 29 37 560 961 224 478 906 319 416 736 603 808 87 762 697 392 713 19 459 262 238 239 599 997",
"output": "1 44 30"
},
{
"input": "98\n443 719 559 672 16 69 529 632 953 999 725 431 54 22 346 968 558 696 48 669 963 129 257 712 39 870 498 595 45 821 344 925 179 388 792 346 755 213 423 365 344 659 824 356 773 637 628 897 841 155 243 536 951 361 192 105 418 431 635 596 150 162 145 548 473 531 750 306 377 354 450 975 79 743 656 733 440 940 19 139 237 346 276 227 64 799 479 633 199 17 796 362 517 234 729 62 995 535",
"output": "2 70 40"
},
{
"input": "97\n359 522 938 862 181 600 283 1000 910 191 590 220 761 818 903 264 751 751 987 316 737 898 168 925 244 674 34 950 754 472 81 6 37 520 112 891 981 454 897 424 489 238 363 709 906 951 677 828 114 373 589 835 52 89 97 435 277 560 551 204 879 469 928 523 231 163 183 609 821 915 615 969 616 23 874 437 844 321 78 53 643 786 585 38 744 347 150 179 988 985 200 11 15 9 547 886 752",
"output": "1 23 10"
},
{
"input": "4\n303 872 764 401",
"output": "-1"
},
{
"input": "100\n328 397 235 453 188 254 879 225 423 36 384 296 486 592 231 849 856 255 213 898 234 800 701 529 951 693 507 326 15 905 618 348 967 927 28 979 752 850 343 35 84 302 36 390 482 826 249 918 91 289 973 457 557 348 365 239 709 565 320 560 153 130 647 708 483 469 788 473 322 844 830 562 611 961 397 673 69 960 74 703 369 968 382 451 328 160 211 230 566 208 7 545 293 73 806 375 157 410 303 58",
"output": "1 79 6"
},
{
"input": "33\n52 145 137 734 180 847 178 286 716 134 181 630 358 764 593 762 785 28 1 468 189 540 764 485 165 656 114 58 628 108 605 584 257",
"output": "8 30 7"
},
{
"input": "57\n75 291 309 68 444 654 985 158 514 204 116 918 374 806 176 31 49 455 269 66 722 713 164 818 317 295 546 564 134 641 28 13 987 478 146 219 213 940 289 173 157 666 168 391 392 71 870 477 446 988 414 568 964 684 409 671 454",
"output": "2 41 29"
},
{
"input": "88\n327 644 942 738 84 118 981 686 530 404 137 197 434 16 693 183 423 325 410 345 941 329 7 106 79 867 584 358 533 675 192 718 641 329 900 768 404 301 101 538 954 590 401 954 447 14 559 337 756 586 934 367 538 928 945 936 770 641 488 579 206 869 902 139 216 446 723 150 829 205 373 578 357 368 960 40 121 206 503 385 521 161 501 694 138 370 709 308",
"output": "1 77 61"
},
{
"input": "100\n804 510 266 304 788 625 862 888 408 82 414 470 777 991 729 229 933 406 601 1 596 720 608 706 432 361 527 548 59 548 474 515 4 991 263 568 681 24 117 563 576 587 281 643 904 521 891 106 842 884 943 54 605 815 504 757 311 374 335 192 447 652 633 410 455 402 382 150 432 836 413 819 669 875 638 925 217 805 632 520 605 266 728 795 162 222 603 159 284 790 914 443 775 97 789 606 859 13 851 47",
"output": "1 77 42"
},
{
"input": "100\n449 649 615 713 64 385 927 466 138 126 143 886 80 199 208 43 196 694 92 89 264 180 617 970 191 196 910 150 275 89 693 190 191 99 542 342 45 592 114 56 451 170 64 589 176 102 308 92 402 153 414 675 352 157 69 150 91 288 163 121 816 184 20 234 836 12 593 150 793 439 540 93 99 663 186 125 349 247 476 106 77 523 215 7 363 278 441 745 337 25 148 384 15 915 108 211 240 58 23 408",
"output": "1 6 5"
},
{
"input": "90\n881 436 52 308 97 261 153 931 670 538 702 156 114 445 154 685 452 76 966 790 93 42 547 65 736 364 136 489 719 322 239 628 696 735 55 703 622 375 100 188 804 341 546 474 484 446 729 290 974 301 602 225 996 244 488 983 882 460 962 754 395 617 61 640 534 292 158 375 632 902 420 979 379 38 100 67 963 928 190 456 545 571 45 716 153 68 844 2 102 116",
"output": "1 14 2"
},
{
"input": "80\n313 674 262 240 697 146 391 221 793 504 896 818 92 899 86 370 341 339 306 887 937 570 830 683 729 519 240 833 656 847 427 958 435 704 853 230 758 347 660 575 843 293 649 396 437 787 654 599 35 103 779 783 447 379 444 585 902 713 791 150 851 228 306 721 996 471 617 403 102 168 197 741 877 481 968 545 331 715 236 654",
"output": "1 13 8"
},
{
"input": "70\n745 264 471 171 946 32 277 511 269 469 89 831 69 2 369 407 583 602 646 633 429 747 113 302 722 321 344 824 241 372 263 287 822 24 652 758 246 967 219 313 882 597 752 965 389 775 227 556 95 904 308 340 899 514 400 187 275 318 621 546 659 488 199 154 811 1 725 79 925 82",
"output": "1 63 60"
},
{
"input": "60\n176 502 680 102 546 917 516 801 392 435 635 492 398 456 653 444 472 513 634 378 273 276 44 920 68 124 800 167 825 250 452 264 561 344 98 933 381 939 426 51 568 548 206 887 342 763 151 514 156 354 486 546 998 649 356 438 295 570 450 589",
"output": "2 26 20"
},
{
"input": "50\n608 92 889 33 146 803 402 91 868 400 828 505 375 558 584 129 361 776 974 123 765 804 326 186 61 927 904 511 762 775 640 593 300 664 897 461 869 911 986 789 607 500 309 457 294 104 724 471 216 155",
"output": "3 25 11"
},
{
"input": "40\n40 330 98 612 747 336 640 381 991 366 22 167 352 12 868 166 603 40 313 869 609 981 609 804 54 729 8 854 347 300 828 922 39 633 695 988 4 530 545 176",
"output": "5 10 8"
},
{
"input": "30\n471 920 308 544 347 222 878 671 467 332 215 180 681 114 151 203 492 951 653 614 453 510 540 422 399 532 113 198 932 825",
"output": "2 21 9"
},
{
"input": "20\n551 158 517 475 595 108 764 961 590 297 761 841 659 568 82 888 733 214 993 359",
"output": "3 20 2"
},
{
"input": "10\n983 748 726 406 196 993 2 251 66 263",
"output": "-1"
},
{
"input": "9\n933 266 457 863 768 257 594 136 145",
"output": "-1"
},
{
"input": "8\n537 198 48 771 944 868 700 163",
"output": "7 8 1"
},
{
"input": "7\n140 779 639 679 768 479 158",
"output": "2 3 1"
},
{
"input": "6\n744 359 230 586 944 442",
"output": "-1"
},
{
"input": "5\n700 939 173 494 120",
"output": "-1"
},
{
"input": "4\n303 872 764 401",
"output": "-1"
},
{
"input": "3\n907 452 355",
"output": "-1"
},
{
"input": "3\n963 630 333",
"output": "1 3 2"
},
{
"input": "3\n2 2 4",
"output": "3 2 1"
},
{
"input": "3\n2 4 100",
"output": "-1"
}
] | 1,667,605,405
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 39
| 92
| 0
|
n = int(input())
data = list(input().split())
numbers_list = list(map(int, data))
numbers = sorted(numbers_list)
i = 0
j = 1
while i != n - 1:
if numbers[i] + numbers[j] not in numbers:
if i == n - 2:
print("-1")
break
if j != n - 1:
j += 1
else:
i += 1
j = i + 1
else:
target = numbers[i] + numbers[j]
if numbers[i] != numbers[j]:
first = numbers[i]
second = numbers[j]
print(f"{numbers_list.index(target) + 1} {numbers_list.index(second) + 1} {numbers_list.index(first) + 1}")
break
else:
twin = numbers[i]
first = [i for i, n in enumerate(numbers) if n == twin][0]
second = [i for i, n in enumerate(numbers) if n == twin][1]
print(f"{numbers_list.index(target) + 1} {second + 1} {first + 1}")
break
|
Title: Worms Evolution
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Professor Vasechkin is studying evolution of worms. Recently he put forward hypotheses that all worms evolve by division. There are *n* forms of worms. Worms of these forms have lengths *a*1, *a*2, ..., *a**n*. To prove his theory, professor needs to find 3 different forms that the length of the first form is equal to sum of lengths of the other two forms. Help him to do this.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of worm's forms. The second line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=1000) — lengths of worms of each form.
Output Specification:
Output 3 distinct integers *i* *j* *k* (1<=≤<=*i*,<=*j*,<=*k*<=≤<=*n*) — such indexes of worm's forms that *a**i*<==<=*a**j*<=+<=*a**k*. If there is no such triple, output -1. If there are several solutions, output any of them. It possible that *a**j*<==<=*a**k*.
Demo Input:
['5\n1 2 3 5 7\n', '5\n1 8 1 5 1\n']
Demo Output:
['3 2 1\n', '-1\n']
Note:
none
|
```python
n = int(input())
data = list(input().split())
numbers_list = list(map(int, data))
numbers = sorted(numbers_list)
i = 0
j = 1
while i != n - 1:
if numbers[i] + numbers[j] not in numbers:
if i == n - 2:
print("-1")
break
if j != n - 1:
j += 1
else:
i += 1
j = i + 1
else:
target = numbers[i] + numbers[j]
if numbers[i] != numbers[j]:
first = numbers[i]
second = numbers[j]
print(f"{numbers_list.index(target) + 1} {numbers_list.index(second) + 1} {numbers_list.index(first) + 1}")
break
else:
twin = numbers[i]
first = [i for i, n in enumerate(numbers) if n == twin][0]
second = [i for i, n in enumerate(numbers) if n == twin][1]
print(f"{numbers_list.index(target) + 1} {second + 1} {first + 1}")
break
```
| 3.977
|
886
|
A
|
ACM ICPC
|
PROGRAMMING
| 1,000
|
[
"brute force"
] | null | null |
In a small but very proud high school it was decided to win ACM ICPC. This goal requires to compose as many teams of three as possible, but since there were only 6 students who wished to participate, the decision was to build exactly two teams.
After practice competition, participant number *i* got a score of *a**i*. Team score is defined as sum of scores of its participants. High school management is interested if it's possible to build two teams with equal scores. Your task is to answer that question.
|
The single line contains six integers *a*1,<=...,<=*a*6 (0<=≤<=*a**i*<=≤<=1000) — scores of the participants
|
Print "YES" (quotes for clarity), if it is possible to build teams with equal score, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES").
|
[
"1 3 2 1 2 1\n",
"1 1 1 1 1 99\n"
] |
[
"YES\n",
"NO\n"
] |
In the first sample, first team can be composed of 1st, 2nd and 6th participant, second — of 3rd, 4th and 5th: team scores are 1 + 3 + 1 = 2 + 1 + 2 = 5.
In the second sample, score of participant number 6 is too high: his team score will be definitely greater.
| 500
|
[
{
"input": "1 3 2 1 2 1",
"output": "YES"
},
{
"input": "1 1 1 1 1 99",
"output": "NO"
},
{
"input": "1000 1000 1000 1000 1000 1000",
"output": "YES"
},
{
"input": "0 0 0 0 0 0",
"output": "YES"
},
{
"input": "633 609 369 704 573 416",
"output": "NO"
},
{
"input": "353 313 327 470 597 31",
"output": "NO"
},
{
"input": "835 638 673 624 232 266",
"output": "NO"
},
{
"input": "936 342 19 398 247 874",
"output": "NO"
},
{
"input": "417 666 978 553 271 488",
"output": "NO"
},
{
"input": "71 66 124 199 67 147",
"output": "YES"
},
{
"input": "54 26 0 171 239 12",
"output": "YES"
},
{
"input": "72 8 186 92 267 69",
"output": "YES"
},
{
"input": "180 179 188 50 75 214",
"output": "YES"
},
{
"input": "16 169 110 136 404 277",
"output": "YES"
},
{
"input": "101 400 9 200 300 10",
"output": "YES"
},
{
"input": "101 400 200 9 300 10",
"output": "YES"
},
{
"input": "101 200 400 9 300 10",
"output": "YES"
},
{
"input": "101 400 200 300 9 10",
"output": "YES"
},
{
"input": "101 200 400 300 9 10",
"output": "YES"
},
{
"input": "4 4 4 4 5 4",
"output": "NO"
},
{
"input": "2 2 2 2 2 1",
"output": "NO"
},
{
"input": "1000 1000 999 1000 1000 1000",
"output": "NO"
},
{
"input": "129 1 10 29 8 111",
"output": "NO"
},
{
"input": "1000 1000 1000 999 999 1000",
"output": "YES"
},
{
"input": "101 200 300 400 9 10",
"output": "YES"
},
{
"input": "101 400 200 300 10 9",
"output": "YES"
},
{
"input": "101 200 400 300 10 9",
"output": "YES"
},
{
"input": "101 200 300 400 10 9",
"output": "YES"
},
{
"input": "101 200 300 10 400 9",
"output": "YES"
},
{
"input": "1 1 1 1 1 5",
"output": "NO"
},
{
"input": "8 1 1 3 3 0",
"output": "NO"
},
{
"input": "1 1 2 2 3 3",
"output": "YES"
},
{
"input": "1 2 2 5 2 5",
"output": "NO"
},
{
"input": "1 2 3 6 6 6",
"output": "NO"
},
{
"input": "36 91 7 86 51 89",
"output": "NO"
},
{
"input": "10 1 1 1 23 24",
"output": "NO"
},
{
"input": "1 1 1 10 23 24",
"output": "NO"
},
{
"input": "20 10 1 2 3 44",
"output": "NO"
},
{
"input": "7 0 14 11 8 6",
"output": "NO"
},
{
"input": "100 496 1 1 1 1",
"output": "NO"
},
{
"input": "5 4 2 5 11 3",
"output": "NO"
},
{
"input": "1 3 7 8 8 9",
"output": "YES"
},
{
"input": "1 3 4 5 18 19",
"output": "YES"
},
{
"input": "5 5 1 2 2 15",
"output": "NO"
},
{
"input": "2 1 0 0 0 5",
"output": "NO"
},
{
"input": "1 6 6 1 20 2",
"output": "NO"
},
{
"input": "2 10 0 0 0 0",
"output": "NO"
},
{
"input": "1 1 3 1 1 11",
"output": "NO"
},
{
"input": "10 10 1 1 1 37",
"output": "NO"
},
{
"input": "1 1 0 0 0 4",
"output": "NO"
},
{
"input": "1 1 10 1 1 28",
"output": "NO"
},
{
"input": "1 5 5 5 6 8",
"output": "YES"
},
{
"input": "0 2 3 4 4 5",
"output": "YES"
}
] | 1,511,328,492
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 53
| 77
| 0
|
a=list(map(int,input().split()))
s=sum(a)
if s%2==1:
print('NO')
exit()
for i in range(6):
for j in range(i+1,6):
for k in range(j+1,6):
if a[i]+a[j]+a[k]==s//2:
print('YES')
exit()
print('NO')
|
Title: ACM ICPC
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In a small but very proud high school it was decided to win ACM ICPC. This goal requires to compose as many teams of three as possible, but since there were only 6 students who wished to participate, the decision was to build exactly two teams.
After practice competition, participant number *i* got a score of *a**i*. Team score is defined as sum of scores of its participants. High school management is interested if it's possible to build two teams with equal scores. Your task is to answer that question.
Input Specification:
The single line contains six integers *a*1,<=...,<=*a*6 (0<=≤<=*a**i*<=≤<=1000) — scores of the participants
Output Specification:
Print "YES" (quotes for clarity), if it is possible to build teams with equal score, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES").
Demo Input:
['1 3 2 1 2 1\n', '1 1 1 1 1 99\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample, first team can be composed of 1st, 2nd and 6th participant, second — of 3rd, 4th and 5th: team scores are 1 + 3 + 1 = 2 + 1 + 2 = 5.
In the second sample, score of participant number 6 is too high: his team score will be definitely greater.
|
```python
a=list(map(int,input().split()))
s=sum(a)
if s%2==1:
print('NO')
exit()
for i in range(6):
for j in range(i+1,6):
for k in range(j+1,6):
if a[i]+a[j]+a[k]==s//2:
print('YES')
exit()
print('NO')
```
| 3
|
|
400
|
A
|
Inna and Choose Options
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
There always is something to choose from! And now, instead of "Noughts and Crosses", Inna choose a very unusual upgrade of this game. The rules of the game are given below:
There is one person playing the game. Before the beginning of the game he puts 12 cards in a row on the table. Each card contains a character: "X" or "O". Then the player chooses two positive integers *a* and *b* (*a*·*b*<==<=12), after that he makes a table of size *a*<=×<=*b* from the cards he put on the table as follows: the first *b* cards form the first row of the table, the second *b* cards form the second row of the table and so on, the last *b* cards form the last (number *a*) row of the table. The player wins if some column of the table contain characters "X" on all cards. Otherwise, the player loses.
Inna has already put 12 cards on the table in a row. But unfortunately, she doesn't know what numbers *a* and *b* to choose. Help her win the game: print to her all the possible ways of numbers *a*,<=*b* that she can choose and win.
|
The first line of the input contains integer *t* (1<=≤<=*t*<=≤<=100). This value shows the number of sets of test data in the input. Next follows the description of each of the *t* tests on a separate line.
The description of each test is a string consisting of 12 characters, each character is either "X", or "O". The *i*-th character of the string shows the character that is written on the *i*-th card from the start.
|
For each test, print the answer to the test on a single line. The first number in the line must represent the number of distinct ways to choose the pair *a*,<=*b*. Next, print on this line the pairs in the format *a*x*b*. Print the pairs in the order of increasing first parameter (*a*). Separate the pairs in the line by whitespaces.
|
[
"4\nOXXXOXOOXOOX\nOXOXOXOXOXOX\nXXXXXXXXXXXX\nOOOOOOOOOOOO\n"
] |
[
"3 1x12 2x6 4x3\n4 1x12 2x6 3x4 6x2\n6 1x12 2x6 3x4 4x3 6x2 12x1\n0\n"
] |
none
| 500
|
[
{
"input": "4\nOXXXOXOOXOOX\nOXOXOXOXOXOX\nXXXXXXXXXXXX\nOOOOOOOOOOOO",
"output": "3 1x12 2x6 4x3\n4 1x12 2x6 3x4 6x2\n6 1x12 2x6 3x4 4x3 6x2 12x1\n0"
},
{
"input": "2\nOOOOOOOOOOOO\nXXXXXXXXXXXX",
"output": "0\n6 1x12 2x6 3x4 4x3 6x2 12x1"
},
{
"input": "13\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX",
"output": "6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1"
}
] | 1,394,528,520
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 44
| 77
| 0
|
T=int(input())
while T>=1:
T-=1
a=input()
list=[]
for i in range(1,13):
if 12 % i==0:
l=12//i
for j in range(0,l):
for k in range(0,i):
if a[k*l+j]!='X':
break
else:
break
else:
continue
list.append(i)
print(len(list),end=' ')
for i in range(0,len(list)):
print(str(list[i])+'x'+str(12//list[i]),end=' ')
print()
|
Title: Inna and Choose Options
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There always is something to choose from! And now, instead of "Noughts and Crosses", Inna choose a very unusual upgrade of this game. The rules of the game are given below:
There is one person playing the game. Before the beginning of the game he puts 12 cards in a row on the table. Each card contains a character: "X" or "O". Then the player chooses two positive integers *a* and *b* (*a*·*b*<==<=12), after that he makes a table of size *a*<=×<=*b* from the cards he put on the table as follows: the first *b* cards form the first row of the table, the second *b* cards form the second row of the table and so on, the last *b* cards form the last (number *a*) row of the table. The player wins if some column of the table contain characters "X" on all cards. Otherwise, the player loses.
Inna has already put 12 cards on the table in a row. But unfortunately, she doesn't know what numbers *a* and *b* to choose. Help her win the game: print to her all the possible ways of numbers *a*,<=*b* that she can choose and win.
Input Specification:
The first line of the input contains integer *t* (1<=≤<=*t*<=≤<=100). This value shows the number of sets of test data in the input. Next follows the description of each of the *t* tests on a separate line.
The description of each test is a string consisting of 12 characters, each character is either "X", or "O". The *i*-th character of the string shows the character that is written on the *i*-th card from the start.
Output Specification:
For each test, print the answer to the test on a single line. The first number in the line must represent the number of distinct ways to choose the pair *a*,<=*b*. Next, print on this line the pairs in the format *a*x*b*. Print the pairs in the order of increasing first parameter (*a*). Separate the pairs in the line by whitespaces.
Demo Input:
['4\nOXXXOXOOXOOX\nOXOXOXOXOXOX\nXXXXXXXXXXXX\nOOOOOOOOOOOO\n']
Demo Output:
['3 1x12 2x6 4x3\n4 1x12 2x6 3x4 6x2\n6 1x12 2x6 3x4 4x3 6x2 12x1\n0\n']
Note:
none
|
```python
T=int(input())
while T>=1:
T-=1
a=input()
list=[]
for i in range(1,13):
if 12 % i==0:
l=12//i
for j in range(0,l):
for k in range(0,i):
if a[k*l+j]!='X':
break
else:
break
else:
continue
list.append(i)
print(len(list),end=' ')
for i in range(0,len(list)):
print(str(list[i])+'x'+str(12//list[i]),end=' ')
print()
```
| 3
|
|
620
|
A
|
Professor GukiZ's Robot
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Professor GukiZ makes a new robot. The robot are in the point with coordinates (*x*1,<=*y*1) and should go to the point (*x*2,<=*y*2). In a single step the robot can change any of its coordinates (maybe both of them) by one (decrease or increase). So the robot can move in one of the 8 directions. Find the minimal number of steps the robot should make to get the finish position.
|
The first line contains two integers *x*1,<=*y*1 (<=-<=109<=≤<=*x*1,<=*y*1<=≤<=109) — the start position of the robot.
The second line contains two integers *x*2,<=*y*2 (<=-<=109<=≤<=*x*2,<=*y*2<=≤<=109) — the finish position of the robot.
|
Print the only integer *d* — the minimal number of steps to get the finish position.
|
[
"0 0\n4 5\n",
"3 4\n6 1\n"
] |
[
"5\n",
"3\n"
] |
In the first example robot should increase both of its coordinates by one four times, so it will be in position (4, 4). After that robot should simply increase its *y* coordinate and get the finish position.
In the second example robot should simultaneously increase *x* coordinate and decrease *y* coordinate by one three times.
| 0
|
[
{
"input": "0 0\n4 5",
"output": "5"
},
{
"input": "3 4\n6 1",
"output": "3"
},
{
"input": "0 0\n4 6",
"output": "6"
},
{
"input": "1 1\n-3 -5",
"output": "6"
},
{
"input": "-1 -1\n-10 100",
"output": "101"
},
{
"input": "1 -1\n100 -100",
"output": "99"
},
{
"input": "-1000000000 -1000000000\n1000000000 1000000000",
"output": "2000000000"
},
{
"input": "-1000000000 -1000000000\n0 999999999",
"output": "1999999999"
},
{
"input": "0 0\n2 1",
"output": "2"
},
{
"input": "10 0\n100 0",
"output": "90"
},
{
"input": "1 5\n6 4",
"output": "5"
},
{
"input": "0 0\n5 4",
"output": "5"
},
{
"input": "10 1\n20 1",
"output": "10"
},
{
"input": "1 1\n-3 4",
"output": "4"
},
{
"input": "-863407280 504312726\n786535210 -661703810",
"output": "1649942490"
},
{
"input": "-588306085 -741137832\n341385643 152943311",
"output": "929691728"
},
{
"input": "0 0\n4 0",
"output": "4"
},
{
"input": "93097194 -48405232\n-716984003 -428596062",
"output": "810081197"
},
{
"input": "9 1\n1 1",
"output": "8"
},
{
"input": "4 6\n0 4",
"output": "4"
},
{
"input": "2 4\n5 2",
"output": "3"
},
{
"input": "-100000000 -100000000\n100000000 100000123",
"output": "200000123"
},
{
"input": "5 6\n5 7",
"output": "1"
},
{
"input": "12 16\n12 1",
"output": "15"
},
{
"input": "0 0\n5 1",
"output": "5"
},
{
"input": "0 1\n1 1",
"output": "1"
},
{
"input": "-44602634 913365223\n-572368780 933284951",
"output": "527766146"
},
{
"input": "-2 0\n2 -2",
"output": "4"
},
{
"input": "0 0\n3 1",
"output": "3"
},
{
"input": "-458 2\n1255 4548",
"output": "4546"
},
{
"input": "-5 -4\n-3 -3",
"output": "2"
},
{
"input": "4 5\n7 3",
"output": "3"
},
{
"input": "-1000000000 -999999999\n1000000000 999999998",
"output": "2000000000"
},
{
"input": "-1000000000 -1000000000\n1000000000 -1000000000",
"output": "2000000000"
},
{
"input": "-464122675 -898521847\n656107323 -625340409",
"output": "1120229998"
},
{
"input": "-463154699 -654742385\n-699179052 -789004997",
"output": "236024353"
},
{
"input": "982747270 -593488945\n342286841 -593604186",
"output": "640460429"
},
{
"input": "-80625246 708958515\n468950878 574646184",
"output": "549576124"
},
{
"input": "0 0\n1 0",
"output": "1"
},
{
"input": "109810 1\n2 3",
"output": "109808"
},
{
"input": "-9 0\n9 9",
"output": "18"
},
{
"input": "9 9\n9 9",
"output": "0"
},
{
"input": "1 1\n4 3",
"output": "3"
},
{
"input": "1 2\n45 1",
"output": "44"
},
{
"input": "207558188 -313753260\n-211535387 -721675423",
"output": "419093575"
},
{
"input": "-11 0\n0 0",
"output": "11"
},
{
"input": "-1000000000 1000000000\n1000000000 -1000000000",
"output": "2000000000"
},
{
"input": "0 0\n1 1",
"output": "1"
},
{
"input": "0 0\n0 1",
"output": "1"
},
{
"input": "0 0\n-1 1",
"output": "1"
},
{
"input": "0 0\n-1 0",
"output": "1"
},
{
"input": "0 0\n-1 -1",
"output": "1"
},
{
"input": "0 0\n0 -1",
"output": "1"
},
{
"input": "0 0\n1 -1",
"output": "1"
},
{
"input": "10 90\n90 10",
"output": "80"
},
{
"input": "851016864 573579544\n-761410925 -380746263",
"output": "1612427789"
},
{
"input": "1 9\n9 9",
"output": "8"
},
{
"input": "1000 1000\n1000 1000",
"output": "0"
},
{
"input": "1 9\n9 1",
"output": "8"
},
{
"input": "1 90\n90 90",
"output": "89"
},
{
"input": "100 100\n1000 1000",
"output": "900"
},
{
"input": "-1 0\n0 0",
"output": "1"
},
{
"input": "-750595959 -2984043\n649569876 -749608783",
"output": "1400165835"
},
{
"input": "958048496 712083589\n423286949 810566863",
"output": "534761547"
},
{
"input": "146316710 53945094\n-523054748 147499505",
"output": "669371458"
},
{
"input": "50383856 -596516251\n-802950224 -557916272",
"output": "853334080"
},
{
"input": "-637204864 -280290367\n-119020929 153679771",
"output": "518183935"
},
{
"input": "-100 -100\n-60 -91",
"output": "40"
},
{
"input": "337537326 74909428\n-765558776 167951547",
"output": "1103096102"
},
{
"input": "0 81\n18 90",
"output": "18"
},
{
"input": "283722202 -902633305\n-831696497 -160868946",
"output": "1115418699"
},
{
"input": "1000 1000\n-1000 1000",
"output": "2000"
},
{
"input": "5 6\n4 8",
"output": "2"
},
{
"input": "40572000 597493595\n-935051731 368493185",
"output": "975623731"
},
{
"input": "-5 5\n5 5",
"output": "10"
}
] | 1,671,759,208
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 75
| 46
| 0
|
x1, y1 = map(int, input().split())
x2, y2 = map(int, input().split())
moo = 0
x, y = x1, y1
a = min(abs(x2-x1), abs(y2-y1))
moo += a
if x2 > x and y2 > y:
x += a
y += a
elif x2 < x and y2 < y:
x -= a
y -= a
elif x2 < x and y2 > y:
x -= a
y += a
else:
x += a
y -= a
if x == x2:
moo += abs(y2-y)
else:
moo += abs(x2-x)
print(moo)
|
Title: Professor GukiZ's Robot
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Professor GukiZ makes a new robot. The robot are in the point with coordinates (*x*1,<=*y*1) and should go to the point (*x*2,<=*y*2). In a single step the robot can change any of its coordinates (maybe both of them) by one (decrease or increase). So the robot can move in one of the 8 directions. Find the minimal number of steps the robot should make to get the finish position.
Input Specification:
The first line contains two integers *x*1,<=*y*1 (<=-<=109<=≤<=*x*1,<=*y*1<=≤<=109) — the start position of the robot.
The second line contains two integers *x*2,<=*y*2 (<=-<=109<=≤<=*x*2,<=*y*2<=≤<=109) — the finish position of the robot.
Output Specification:
Print the only integer *d* — the minimal number of steps to get the finish position.
Demo Input:
['0 0\n4 5\n', '3 4\n6 1\n']
Demo Output:
['5\n', '3\n']
Note:
In the first example robot should increase both of its coordinates by one four times, so it will be in position (4, 4). After that robot should simply increase its *y* coordinate and get the finish position.
In the second example robot should simultaneously increase *x* coordinate and decrease *y* coordinate by one three times.
|
```python
x1, y1 = map(int, input().split())
x2, y2 = map(int, input().split())
moo = 0
x, y = x1, y1
a = min(abs(x2-x1), abs(y2-y1))
moo += a
if x2 > x and y2 > y:
x += a
y += a
elif x2 < x and y2 < y:
x -= a
y -= a
elif x2 < x and y2 > y:
x -= a
y += a
else:
x += a
y -= a
if x == x2:
moo += abs(y2-y)
else:
moo += abs(x2-x)
print(moo)
```
| 3
|
|
609
|
A
|
USB Flash Drives
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
Sean is trying to save a large file to a USB flash drive. He has *n* USB flash drives with capacities equal to *a*1,<=*a*2,<=...,<=*a**n* megabytes. The file size is equal to *m* megabytes.
Find the minimum number of USB flash drives needed to write Sean's file, if he can split the file between drives.
|
The first line contains positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of USB flash drives.
The second line contains positive integer *m* (1<=≤<=*m*<=≤<=105) — the size of Sean's file.
Each of the next *n* lines contains positive integer *a**i* (1<=≤<=*a**i*<=≤<=1000) — the sizes of USB flash drives in megabytes.
It is guaranteed that the answer exists, i. e. the sum of all *a**i* is not less than *m*.
|
Print the minimum number of USB flash drives to write Sean's file, if he can split the file between drives.
|
[
"3\n5\n2\n1\n3\n",
"3\n6\n2\n3\n2\n",
"2\n5\n5\n10\n"
] |
[
"2\n",
"3\n",
"1\n"
] |
In the first example Sean needs only two USB flash drives — the first and the third.
In the second example Sean needs all three USB flash drives.
In the third example Sean needs only one USB flash drive and he can use any available USB flash drive — the first or the second.
| 0
|
[
{
"input": "3\n5\n2\n1\n3",
"output": "2"
},
{
"input": "3\n6\n2\n3\n2",
"output": "3"
},
{
"input": "2\n5\n5\n10",
"output": "1"
},
{
"input": "5\n16\n8\n1\n3\n4\n9",
"output": "2"
},
{
"input": "10\n121\n10\n37\n74\n56\n42\n39\n6\n68\n8\n100",
"output": "2"
},
{
"input": "12\n4773\n325\n377\n192\n780\n881\n816\n839\n223\n215\n125\n952\n8",
"output": "7"
},
{
"input": "15\n7758\n182\n272\n763\n910\n24\n359\n583\n890\n735\n819\n66\n992\n440\n496\n227",
"output": "15"
},
{
"input": "30\n70\n6\n2\n10\n4\n7\n10\n5\n1\n8\n10\n4\n3\n5\n9\n3\n6\n6\n4\n2\n6\n5\n10\n1\n9\n7\n2\n1\n10\n7\n5",
"output": "8"
},
{
"input": "40\n15705\n702\n722\n105\n873\n417\n477\n794\n300\n869\n496\n572\n232\n456\n298\n473\n584\n486\n713\n934\n121\n303\n956\n934\n840\n358\n201\n861\n497\n131\n312\n957\n96\n914\n509\n60\n300\n722\n658\n820\n103",
"output": "21"
},
{
"input": "50\n18239\n300\n151\n770\n9\n200\n52\n247\n753\n523\n263\n744\n463\n540\n244\n608\n569\n771\n32\n425\n777\n624\n761\n628\n124\n405\n396\n726\n626\n679\n237\n229\n49\n512\n18\n671\n290\n768\n632\n739\n18\n136\n413\n117\n83\n413\n452\n767\n664\n203\n404",
"output": "31"
},
{
"input": "70\n149\n5\n3\n3\n4\n6\n1\n2\n9\n8\n3\n1\n8\n4\n4\n3\n6\n10\n7\n1\n10\n8\n4\n9\n3\n8\n3\n2\n5\n1\n8\n6\n9\n10\n4\n8\n6\n9\n9\n9\n3\n4\n2\n2\n5\n8\n9\n1\n10\n3\n4\n3\n1\n9\n3\n5\n1\n3\n7\n6\n9\n8\n9\n1\n7\n4\n4\n2\n3\n5\n7",
"output": "17"
},
{
"input": "70\n2731\n26\n75\n86\n94\n37\n25\n32\n35\n92\n1\n51\n73\n53\n66\n16\n80\n15\n81\n100\n87\n55\n48\n30\n71\n39\n87\n77\n25\n70\n22\n75\n23\n97\n16\n75\n95\n61\n61\n28\n10\n78\n54\n80\n51\n25\n24\n90\n58\n4\n77\n40\n54\n53\n47\n62\n30\n38\n71\n97\n71\n60\n58\n1\n21\n15\n55\n99\n34\n88\n99",
"output": "35"
},
{
"input": "70\n28625\n34\n132\n181\n232\n593\n413\n862\n887\n808\n18\n35\n89\n356\n640\n339\n280\n975\n82\n345\n398\n948\n372\n91\n755\n75\n153\n948\n603\n35\n694\n722\n293\n363\n884\n264\n813\n175\n169\n646\n138\n449\n488\n828\n417\n134\n84\n763\n288\n845\n801\n556\n972\n332\n564\n934\n699\n842\n942\n644\n203\n406\n140\n37\n9\n423\n546\n675\n491\n113\n587",
"output": "45"
},
{
"input": "80\n248\n3\n9\n4\n5\n10\n7\n2\n6\n2\n2\n8\n2\n1\n3\n7\n9\n2\n8\n4\n4\n8\n5\n4\n4\n10\n2\n1\n4\n8\n4\n10\n1\n2\n10\n2\n3\n3\n1\n1\n8\n9\n5\n10\n2\n8\n10\n5\n3\n6\n1\n7\n8\n9\n10\n5\n10\n10\n2\n10\n1\n2\n4\n1\n9\n4\n7\n10\n8\n5\n8\n1\n4\n2\n2\n3\n9\n9\n9\n10\n6",
"output": "27"
},
{
"input": "80\n2993\n18\n14\n73\n38\n14\n73\n77\n18\n81\n6\n96\n65\n77\n86\n76\n8\n16\n81\n83\n83\n34\n69\n58\n15\n19\n1\n16\n57\n95\n35\n5\n49\n8\n15\n47\n84\n99\n94\n93\n55\n43\n47\n51\n61\n57\n13\n7\n92\n14\n4\n83\n100\n60\n75\n41\n95\n74\n40\n1\n4\n95\n68\n59\n65\n15\n15\n75\n85\n46\n77\n26\n30\n51\n64\n75\n40\n22\n88\n68\n24",
"output": "38"
},
{
"input": "80\n37947\n117\n569\n702\n272\n573\n629\n90\n337\n673\n589\n576\n205\n11\n284\n645\n719\n777\n271\n567\n466\n251\n402\n3\n97\n288\n699\n208\n173\n530\n782\n266\n395\n957\n159\n463\n43\n316\n603\n197\n386\n132\n799\n778\n905\n784\n71\n851\n963\n883\n705\n454\n275\n425\n727\n223\n4\n870\n833\n431\n463\n85\n505\n800\n41\n954\n981\n242\n578\n336\n48\n858\n702\n349\n929\n646\n528\n993\n506\n274\n227",
"output": "70"
},
{
"input": "90\n413\n5\n8\n10\n7\n5\n7\n5\n7\n1\n7\n8\n4\n3\n9\n4\n1\n10\n3\n1\n10\n9\n3\n1\n8\n4\n7\n5\n2\n9\n3\n10\n10\n3\n6\n3\n3\n10\n7\n5\n1\n1\n2\n4\n8\n2\n5\n5\n3\n9\n5\n5\n3\n10\n2\n3\n8\n5\n9\n1\n3\n6\n5\n9\n2\n3\n7\n10\n3\n4\n4\n1\n5\n9\n2\n6\n9\n1\n1\n9\n9\n7\n7\n7\n8\n4\n5\n3\n4\n6\n9",
"output": "59"
},
{
"input": "90\n4226\n33\n43\n83\n46\n75\n14\n88\n36\n8\n25\n47\n4\n96\n19\n33\n49\n65\n17\n59\n72\n1\n55\n94\n92\n27\n33\n39\n14\n62\n79\n12\n89\n22\n86\n13\n19\n77\n53\n96\n74\n24\n25\n17\n64\n71\n81\n87\n52\n72\n55\n49\n74\n36\n65\n86\n91\n33\n61\n97\n38\n87\n61\n14\n73\n95\n43\n67\n42\n67\n22\n12\n62\n32\n96\n24\n49\n82\n46\n89\n36\n75\n91\n11\n10\n9\n33\n86\n28\n75\n39",
"output": "64"
},
{
"input": "90\n40579\n448\n977\n607\n745\n268\n826\n479\n59\n330\n609\n43\n301\n970\n726\n172\n632\n600\n181\n712\n195\n491\n312\n849\n722\n679\n682\n780\n131\n404\n293\n387\n567\n660\n54\n339\n111\n833\n612\n911\n869\n356\n884\n635\n126\n639\n712\n473\n663\n773\n435\n32\n973\n484\n662\n464\n699\n274\n919\n95\n904\n253\n589\n543\n454\n250\n349\n237\n829\n511\n536\n36\n45\n152\n626\n384\n199\n877\n941\n84\n781\n115\n20\n52\n726\n751\n920\n291\n571\n6\n199",
"output": "64"
},
{
"input": "100\n66\n7\n9\n10\n5\n2\n8\n6\n5\n4\n10\n10\n6\n5\n2\n2\n1\n1\n5\n8\n7\n8\n10\n5\n6\n6\n5\n9\n9\n6\n3\n8\n7\n10\n5\n9\n6\n7\n3\n5\n8\n6\n8\n9\n1\n1\n1\n2\n4\n5\n5\n1\n1\n2\n6\n7\n1\n5\n8\n7\n2\n1\n7\n10\n9\n10\n2\n4\n10\n4\n10\n10\n5\n3\n9\n1\n2\n1\n10\n5\n1\n7\n4\n4\n5\n7\n6\n10\n4\n7\n3\n4\n3\n6\n2\n5\n2\n4\n9\n5\n3",
"output": "7"
},
{
"input": "100\n4862\n20\n47\n85\n47\n76\n38\n48\n93\n91\n81\n31\n51\n23\n60\n59\n3\n73\n72\n57\n67\n54\n9\n42\n5\n32\n46\n72\n79\n95\n61\n79\n88\n33\n52\n97\n10\n3\n20\n79\n82\n93\n90\n38\n80\n18\n21\n43\n60\n73\n34\n75\n65\n10\n84\n100\n29\n94\n56\n22\n59\n95\n46\n22\n57\n69\n67\n90\n11\n10\n61\n27\n2\n48\n69\n86\n91\n69\n76\n36\n71\n18\n54\n90\n74\n69\n50\n46\n8\n5\n41\n96\n5\n14\n55\n85\n39\n6\n79\n75\n87",
"output": "70"
},
{
"input": "100\n45570\n14\n881\n678\n687\n993\n413\n760\n451\n426\n787\n503\n343\n234\n530\n294\n725\n941\n524\n574\n441\n798\n399\n360\n609\n376\n525\n229\n995\n478\n347\n47\n23\n468\n525\n749\n601\n235\n89\n995\n489\n1\n239\n415\n122\n671\n128\n357\n886\n401\n964\n212\n968\n210\n130\n871\n360\n661\n844\n414\n187\n21\n824\n266\n713\n126\n496\n916\n37\n193\n755\n894\n641\n300\n170\n176\n383\n488\n627\n61\n897\n33\n242\n419\n881\n698\n107\n391\n418\n774\n905\n87\n5\n896\n835\n318\n373\n916\n393\n91\n460",
"output": "78"
},
{
"input": "100\n522\n1\n5\n2\n4\n2\n6\n3\n4\n2\n10\n10\n6\n7\n9\n7\n1\n7\n2\n5\n3\n1\n5\n2\n3\n5\n1\n7\n10\n10\n4\n4\n10\n9\n10\n6\n2\n8\n2\n6\n10\n9\n2\n7\n5\n9\n4\n6\n10\n7\n3\n1\n1\n9\n5\n10\n9\n2\n8\n3\n7\n5\n4\n7\n5\n9\n10\n6\n2\n9\n2\n5\n10\n1\n7\n7\n10\n5\n6\n2\n9\n4\n7\n10\n10\n8\n3\n4\n9\n3\n6\n9\n10\n2\n9\n9\n3\n4\n1\n10\n2",
"output": "74"
},
{
"input": "100\n32294\n414\n116\n131\n649\n130\n476\n630\n605\n213\n117\n757\n42\n109\n85\n127\n635\n629\n994\n410\n764\n204\n161\n231\n577\n116\n936\n537\n565\n571\n317\n722\n819\n229\n284\n487\n649\n304\n628\n727\n816\n854\n91\n111\n549\n87\n374\n417\n3\n868\n882\n168\n743\n77\n534\n781\n75\n956\n910\n734\n507\n568\n802\n946\n891\n659\n116\n678\n375\n380\n430\n627\n873\n350\n930\n285\n6\n183\n96\n517\n81\n794\n235\n360\n551\n6\n28\n799\n226\n996\n894\n981\n551\n60\n40\n460\n479\n161\n318\n952\n433",
"output": "42"
},
{
"input": "100\n178\n71\n23\n84\n98\n8\n14\n4\n42\n56\n83\n87\n28\n22\n32\n50\n5\n96\n90\n1\n59\n74\n56\n96\n77\n88\n71\n38\n62\n36\n85\n1\n97\n98\n98\n32\n99\n42\n6\n81\n20\n49\n57\n71\n66\n9\n45\n41\n29\n28\n32\n68\n38\n29\n35\n29\n19\n27\n76\n85\n68\n68\n41\n32\n78\n72\n38\n19\n55\n83\n83\n25\n46\n62\n48\n26\n53\n14\n39\n31\n94\n84\n22\n39\n34\n96\n63\n37\n42\n6\n78\n76\n64\n16\n26\n6\n79\n53\n24\n29\n63",
"output": "2"
},
{
"input": "100\n885\n226\n266\n321\n72\n719\n29\n121\n533\n85\n672\n225\n830\n783\n822\n30\n791\n618\n166\n487\n922\n434\n814\n473\n5\n741\n947\n910\n305\n998\n49\n945\n588\n868\n809\n803\n168\n280\n614\n434\n634\n538\n591\n437\n540\n445\n313\n177\n171\n799\n778\n55\n617\n554\n583\n611\n12\n94\n599\n182\n765\n556\n965\n542\n35\n460\n177\n313\n485\n744\n384\n21\n52\n879\n792\n411\n614\n811\n565\n695\n428\n587\n631\n794\n461\n258\n193\n696\n936\n646\n756\n267\n55\n690\n730\n742\n734\n988\n235\n762\n440",
"output": "1"
},
{
"input": "100\n29\n9\n2\n10\n8\n6\n7\n7\n3\n3\n10\n4\n5\n2\n5\n1\n6\n3\n2\n5\n10\n10\n9\n1\n4\n5\n2\n2\n3\n1\n2\n2\n9\n6\n9\n7\n8\n8\n1\n5\n5\n3\n1\n5\n6\n1\n9\n2\n3\n8\n10\n8\n3\n2\n7\n1\n2\n1\n2\n8\n10\n5\n2\n3\n1\n10\n7\n1\n7\n4\n9\n6\n6\n4\n7\n1\n2\n7\n7\n9\n9\n7\n10\n4\n10\n8\n2\n1\n5\n5\n10\n5\n8\n1\n5\n6\n5\n1\n5\n6\n8",
"output": "3"
},
{
"input": "100\n644\n94\n69\n43\n36\n54\n93\n30\n74\n56\n95\n70\n49\n11\n36\n57\n30\n59\n3\n52\n59\n90\n82\n39\n67\n32\n8\n80\n64\n8\n65\n51\n48\n89\n90\n35\n4\n54\n66\n96\n68\n90\n30\n4\n13\n97\n41\n90\n85\n17\n45\n94\n31\n58\n4\n39\n76\n95\n92\n59\n67\n46\n96\n55\n82\n64\n20\n20\n83\n46\n37\n15\n60\n37\n79\n45\n47\n63\n73\n76\n31\n52\n36\n32\n49\n26\n61\n91\n31\n25\n62\n90\n65\n65\n5\n94\n7\n15\n97\n88\n68",
"output": "7"
},
{
"input": "100\n1756\n98\n229\n158\n281\n16\n169\n149\n239\n235\n182\n147\n215\n49\n270\n194\n242\n295\n289\n249\n19\n12\n144\n157\n92\n270\n122\n212\n97\n152\n14\n42\n12\n198\n98\n295\n154\n229\n191\n294\n5\n156\n43\n185\n184\n20\n125\n23\n10\n257\n244\n264\n79\n46\n277\n13\n22\n97\n212\n77\n293\n20\n51\n17\n109\n37\n68\n117\n51\n248\n10\n149\n179\n192\n239\n161\n13\n173\n297\n73\n43\n109\n288\n198\n81\n70\n254\n187\n277\n1\n295\n113\n95\n291\n293\n119\n205\n191\n37\n34\n116",
"output": "6"
},
{
"input": "100\n20562\n721\n452\n11\n703\n376\n183\n197\n203\n406\n642\n346\n446\n256\n760\n201\n360\n702\n707\n388\n779\n653\n610\n497\n768\n670\n134\n780\n306\n661\n180\n259\n256\n362\n6\n121\n415\n747\n170\n67\n439\n728\n193\n622\n481\n38\n225\n343\n303\n253\n436\n305\n68\n794\n247\n291\n600\n750\n188\n199\n757\n28\n776\n749\n253\n351\n53\n629\n129\n578\n209\n89\n651\n262\n638\n353\n469\n31\n144\n460\n176\n535\n562\n366\n639\n234\n577\n364\n761\n617\n303\n450\n778\n311\n289\n221\n274\n239\n626\n194\n36",
"output": "30"
},
{
"input": "100\n32630\n548\n21\n756\n138\n56\n719\n97\n86\n599\n531\n464\n137\n737\n239\n626\n179\n170\n271\n335\n178\n298\n597\n616\n104\n190\n216\n333\n606\n621\n310\n70\n286\n593\n655\n472\n556\n77\n625\n744\n395\n487\n762\n316\n469\n258\n475\n596\n651\n180\n737\n101\n511\n708\n163\n713\n475\n557\n649\n705\n583\n97\n447\n119\n91\n372\n194\n394\n667\n384\n635\n611\n746\n758\n613\n54\n508\n405\n188\n570\n254\n28\n599\n767\n115\n737\n194\n148\n686\n705\n236\n762\n613\n770\n633\n401\n773\n448\n274\n141\n718",
"output": "52"
},
{
"input": "1\n1\n1",
"output": "1"
}
] | 1,553,093,235
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 109
| 0
|
def main():
n = int(input())
m = int(input())
arr = [int(input()) for i in range(n)]
arr.sort(reverse=True)
sum = 0
res = 0
for i in arr:
sum += i
res += 1
if sum >= m:
break
print(res)
main()
|
Title: USB Flash Drives
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sean is trying to save a large file to a USB flash drive. He has *n* USB flash drives with capacities equal to *a*1,<=*a*2,<=...,<=*a**n* megabytes. The file size is equal to *m* megabytes.
Find the minimum number of USB flash drives needed to write Sean's file, if he can split the file between drives.
Input Specification:
The first line contains positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of USB flash drives.
The second line contains positive integer *m* (1<=≤<=*m*<=≤<=105) — the size of Sean's file.
Each of the next *n* lines contains positive integer *a**i* (1<=≤<=*a**i*<=≤<=1000) — the sizes of USB flash drives in megabytes.
It is guaranteed that the answer exists, i. e. the sum of all *a**i* is not less than *m*.
Output Specification:
Print the minimum number of USB flash drives to write Sean's file, if he can split the file between drives.
Demo Input:
['3\n5\n2\n1\n3\n', '3\n6\n2\n3\n2\n', '2\n5\n5\n10\n']
Demo Output:
['2\n', '3\n', '1\n']
Note:
In the first example Sean needs only two USB flash drives — the first and the third.
In the second example Sean needs all three USB flash drives.
In the third example Sean needs only one USB flash drive and he can use any available USB flash drive — the first or the second.
|
```python
def main():
n = int(input())
m = int(input())
arr = [int(input()) for i in range(n)]
arr.sort(reverse=True)
sum = 0
res = 0
for i in arr:
sum += i
res += 1
if sum >= m:
break
print(res)
main()
```
| 3
|
|
454
|
B
|
Little Pony and Sort by Shift
|
PROGRAMMING
| 1,200
|
[
"implementation"
] | null | null |
One day, Twilight Sparkle is interested in how to sort a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* in non-decreasing order. Being a young unicorn, the only operation she can perform is a unit shift. That is, she can move the last element of the sequence to its beginning:
Help Twilight Sparkle to calculate: what is the minimum number of operations that she needs to sort the sequence?
|
The first line contains an integer *n* (2<=≤<=*n*<=≤<=105). The second line contains *n* integer numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105).
|
If it's impossible to sort the sequence output -1. Otherwise output the minimum number of operations Twilight Sparkle needs to sort it.
|
[
"2\n2 1\n",
"3\n1 3 2\n",
"2\n1 2\n"
] |
[
"1\n",
"-1\n",
"0\n"
] |
none
| 1,000
|
[
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n1 3 2",
"output": "-1"
},
{
"input": "2\n1 2",
"output": "0"
},
{
"input": "6\n3 4 5 6 3 2",
"output": "-1"
},
{
"input": "3\n1 2 1",
"output": "1"
},
{
"input": "5\n1 1 2 1 1",
"output": "2"
},
{
"input": "4\n5 4 5 4",
"output": "-1"
},
{
"input": "7\n3 4 5 5 5 1 2",
"output": "2"
},
{
"input": "5\n2 2 1 2 2",
"output": "3"
},
{
"input": "5\n5 4 1 2 3",
"output": "-1"
},
{
"input": "4\n6 1 2 7",
"output": "-1"
},
{
"input": "5\n4 5 6 2 3",
"output": "2"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "4\n1 2 2 1",
"output": "1"
},
{
"input": "9\n4 5 6 7 1 2 3 4 10",
"output": "-1"
},
{
"input": "7\n2 3 4 1 2 3 4",
"output": "-1"
},
{
"input": "6\n1 2 1 2 1 2",
"output": "-1"
},
{
"input": "3\n3 2 1",
"output": "-1"
},
{
"input": "4\n1 4 4 1",
"output": "1"
},
{
"input": "5\n1 2 1 1 1",
"output": "3"
},
{
"input": "5\n4 6 7 3 5",
"output": "-1"
},
{
"input": "4\n2 3 1 4",
"output": "-1"
},
{
"input": "5\n5 4 3 2 1",
"output": "-1"
},
{
"input": "4\n2 4 1 4",
"output": "-1"
},
{
"input": "6\n4 5 6 1 2 7",
"output": "-1"
},
{
"input": "6\n1 2 3 1 1 1",
"output": "3"
},
{
"input": "5\n1 3 3 3 1",
"output": "1"
},
{
"input": "6\n5 6 7 5 5 5",
"output": "3"
},
{
"input": "5\n3 4 2 1 2",
"output": "-1"
},
{
"input": "3\n3 4 2",
"output": "1"
},
{
"input": "6\n1 1 2 2 1 1",
"output": "2"
},
{
"input": "4\n2 3 4 2",
"output": "1"
},
{
"input": "5\n3 5 7 7 3",
"output": "1"
},
{
"input": "4\n1 1 4 1",
"output": "1"
},
{
"input": "7\n1 5 6 1 1 1 1",
"output": "4"
},
{
"input": "5\n7 8 6 7 8",
"output": "-1"
},
{
"input": "4\n2 4 1 3",
"output": "-1"
}
] | 1,665,489,825
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 56
| 93
| 13,516,800
|
n = int(input())
arr = list(map(int, input().split()))
ind = -2
for i in range(n):
if arr[(i+1)%n]>=arr[i%n]:
continue
else:
if ind == -2:
ind = i
else:
ind = -4
break
if ind == -4:
print(-1)
elif ind == -2:
print(0)
else:
print(n-ind-1)
|
Title: Little Pony and Sort by Shift
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day, Twilight Sparkle is interested in how to sort a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* in non-decreasing order. Being a young unicorn, the only operation she can perform is a unit shift. That is, she can move the last element of the sequence to its beginning:
Help Twilight Sparkle to calculate: what is the minimum number of operations that she needs to sort the sequence?
Input Specification:
The first line contains an integer *n* (2<=≤<=*n*<=≤<=105). The second line contains *n* integer numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105).
Output Specification:
If it's impossible to sort the sequence output -1. Otherwise output the minimum number of operations Twilight Sparkle needs to sort it.
Demo Input:
['2\n2 1\n', '3\n1 3 2\n', '2\n1 2\n']
Demo Output:
['1\n', '-1\n', '0\n']
Note:
none
|
```python
n = int(input())
arr = list(map(int, input().split()))
ind = -2
for i in range(n):
if arr[(i+1)%n]>=arr[i%n]:
continue
else:
if ind == -2:
ind = i
else:
ind = -4
break
if ind == -4:
print(-1)
elif ind == -2:
print(0)
else:
print(n-ind-1)
```
| 3
|
|
841
|
B
|
Godsend
|
PROGRAMMING
| 1,100
|
[
"games",
"math"
] | null | null |
Leha somehow found an array consisting of *n* integers. Looking at it, he came up with a task. Two players play the game on the array. Players move one by one. The first player can choose for his move a subsegment of non-zero length with an odd sum of numbers and remove it from the array, after that the remaining parts are glued together into one array and the game continues. The second player can choose a subsegment of non-zero length with an even sum and remove it. Loses the one who can not make a move. Who will win if both play optimally?
|
First line of input data contains single integer *n* (1<=≤<=*n*<=≤<=106) — length of the array.
Next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109).
|
Output answer in single line. "First", if first player wins, and "Second" otherwise (without quotes).
|
[
"4\n1 3 2 3\n",
"2\n2 2\n"
] |
[
"First\n",
"Second\n"
] |
In first sample first player remove whole array in one move and win.
In second sample first player can't make a move and lose.
| 1,000
|
[
{
"input": "4\n1 3 2 3",
"output": "First"
},
{
"input": "2\n2 2",
"output": "Second"
},
{
"input": "4\n2 4 6 8",
"output": "Second"
},
{
"input": "5\n1 1 1 1 1",
"output": "First"
},
{
"input": "4\n720074544 345031254 849487632 80870826",
"output": "Second"
},
{
"input": "1\n0",
"output": "Second"
},
{
"input": "1\n999999999",
"output": "First"
},
{
"input": "2\n1 999999999",
"output": "First"
},
{
"input": "4\n3 3 4 4",
"output": "First"
},
{
"input": "2\n1 2",
"output": "First"
},
{
"input": "8\n2 2 2 1 1 2 2 2",
"output": "First"
},
{
"input": "5\n3 3 2 2 2",
"output": "First"
},
{
"input": "4\n0 1 1 0",
"output": "First"
},
{
"input": "3\n1 2 2",
"output": "First"
},
{
"input": "6\n2 2 1 1 4 2",
"output": "First"
},
{
"input": "8\n2 2 2 3 3 2 2 2",
"output": "First"
},
{
"input": "4\n2 3 3 4",
"output": "First"
},
{
"input": "10\n2 2 2 2 3 1 2 2 2 2",
"output": "First"
},
{
"input": "6\n2 2 1 1 2 2",
"output": "First"
},
{
"input": "3\n1 1 2",
"output": "First"
},
{
"input": "6\n2 4 3 3 4 6",
"output": "First"
},
{
"input": "6\n4 4 3 3 4 4",
"output": "First"
},
{
"input": "4\n1 1 2 2",
"output": "First"
},
{
"input": "4\n1 3 5 7",
"output": "First"
},
{
"input": "4\n2 1 1 2",
"output": "First"
},
{
"input": "4\n1 3 3 2",
"output": "First"
},
{
"input": "5\n3 2 2 2 2",
"output": "First"
},
{
"input": "3\n2 1 1",
"output": "First"
},
{
"input": "4\n1000000000 1000000000 1000000000 99999999",
"output": "First"
},
{
"input": "4\n2 2 1 1",
"output": "First"
},
{
"input": "5\n2 3 2 3 2",
"output": "First"
},
{
"input": "1\n1",
"output": "First"
},
{
"input": "4\n1000000000 1000000000 1000000000 1",
"output": "First"
},
{
"input": "5\n2 2 2 1 1",
"output": "First"
},
{
"input": "6\n2 1 1 1 1 2",
"output": "First"
},
{
"input": "6\n1 2 2 2 2 1",
"output": "First"
},
{
"input": "11\n2 2 2 2 2 1 2 2 2 2 2",
"output": "First"
},
{
"input": "5\n1 3 2 2 2",
"output": "First"
},
{
"input": "3\n2 3 2",
"output": "First"
},
{
"input": "2\n1 1",
"output": "First"
},
{
"input": "5\n4 4 4 3 3",
"output": "First"
},
{
"input": "5\n3 3 4 4 4",
"output": "First"
},
{
"input": "1\n2",
"output": "Second"
}
] | 1,682,775,665
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 88
| 327
| 92,569,600
|
n=int(input())
print("First" if 1 in [int(e)%2 for e in input().split()] else "Second")
|
Title: Godsend
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Leha somehow found an array consisting of *n* integers. Looking at it, he came up with a task. Two players play the game on the array. Players move one by one. The first player can choose for his move a subsegment of non-zero length with an odd sum of numbers and remove it from the array, after that the remaining parts are glued together into one array and the game continues. The second player can choose a subsegment of non-zero length with an even sum and remove it. Loses the one who can not make a move. Who will win if both play optimally?
Input Specification:
First line of input data contains single integer *n* (1<=≤<=*n*<=≤<=106) — length of the array.
Next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109).
Output Specification:
Output answer in single line. "First", if first player wins, and "Second" otherwise (without quotes).
Demo Input:
['4\n1 3 2 3\n', '2\n2 2\n']
Demo Output:
['First\n', 'Second\n']
Note:
In first sample first player remove whole array in one move and win.
In second sample first player can't make a move and lose.
|
```python
n=int(input())
print("First" if 1 in [int(e)%2 for e in input().split()] else "Second")
```
| 3
|
|
268
|
A
|
Games
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different.
There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number.
You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
|
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
|
In a single line print the number of games where the host team is going to play in the guest uniform.
|
[
"3\n1 2\n2 4\n3 4\n",
"4\n100 42\n42 100\n5 42\n100 5\n",
"2\n1 2\n1 2\n"
] |
[
"1\n",
"5\n",
"0\n"
] |
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2.
In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
| 500
|
[
{
"input": "3\n1 2\n2 4\n3 4",
"output": "1"
},
{
"input": "4\n100 42\n42 100\n5 42\n100 5",
"output": "5"
},
{
"input": "2\n1 2\n1 2",
"output": "0"
},
{
"input": "7\n4 7\n52 55\n16 4\n55 4\n20 99\n3 4\n7 52",
"output": "6"
},
{
"input": "10\n68 42\n1 35\n25 70\n59 79\n65 63\n46 6\n28 82\n92 62\n43 96\n37 28",
"output": "1"
},
{
"input": "30\n10 39\n89 1\n78 58\n75 99\n36 13\n77 50\n6 97\n79 28\n27 52\n56 5\n93 96\n40 21\n33 74\n26 37\n53 59\n98 56\n61 65\n42 57\n9 7\n25 63\n74 34\n96 84\n95 47\n12 23\n34 21\n71 6\n27 13\n15 47\n64 14\n12 77",
"output": "6"
},
{
"input": "30\n46 100\n87 53\n34 84\n44 66\n23 20\n50 34\n90 66\n17 39\n13 22\n94 33\n92 46\n63 78\n26 48\n44 61\n3 19\n41 84\n62 31\n65 89\n23 28\n58 57\n19 85\n26 60\n75 66\n69 67\n76 15\n64 15\n36 72\n90 89\n42 69\n45 35",
"output": "4"
},
{
"input": "2\n46 6\n6 46",
"output": "2"
},
{
"input": "29\n8 18\n33 75\n69 22\n97 95\n1 97\n78 10\n88 18\n13 3\n19 64\n98 12\n79 92\n41 72\n69 15\n98 31\n57 74\n15 56\n36 37\n15 66\n63 100\n16 42\n47 56\n6 4\n73 15\n30 24\n27 71\n12 19\n88 69\n85 6\n50 11",
"output": "10"
},
{
"input": "23\n43 78\n31 28\n58 80\n66 63\n20 4\n51 95\n40 20\n50 14\n5 34\n36 39\n77 42\n64 97\n62 89\n16 56\n8 34\n58 16\n37 35\n37 66\n8 54\n50 36\n24 8\n68 48\n85 33",
"output": "6"
},
{
"input": "13\n76 58\n32 85\n99 79\n23 58\n96 59\n72 35\n53 43\n96 55\n41 78\n75 10\n28 11\n72 7\n52 73",
"output": "0"
},
{
"input": "18\n6 90\n70 79\n26 52\n67 81\n29 95\n41 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 2",
"output": "1"
},
{
"input": "18\n6 90\n100 79\n26 100\n67 100\n29 100\n100 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 100",
"output": "8"
},
{
"input": "30\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1",
"output": "450"
},
{
"input": "30\n100 99\n58 59\n56 57\n54 55\n52 53\n50 51\n48 49\n46 47\n44 45\n42 43\n40 41\n38 39\n36 37\n34 35\n32 33\n30 31\n28 29\n26 27\n24 25\n22 23\n20 21\n18 19\n16 17\n14 15\n12 13\n10 11\n8 9\n6 7\n4 5\n2 3",
"output": "0"
},
{
"input": "15\n9 3\n2 6\n7 6\n5 10\n9 5\n8 1\n10 5\n2 8\n4 5\n9 8\n5 3\n3 8\n9 8\n4 10\n8 5",
"output": "20"
},
{
"input": "15\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n1 2",
"output": "108"
},
{
"input": "25\n2 1\n1 2\n1 2\n1 2\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n1 2\n2 1\n2 1\n2 1\n2 1\n1 2",
"output": "312"
},
{
"input": "25\n91 57\n2 73\n54 57\n2 57\n23 57\n2 6\n57 54\n57 23\n91 54\n91 23\n57 23\n91 57\n54 2\n6 91\n57 54\n2 57\n57 91\n73 91\n57 23\n91 57\n2 73\n91 2\n23 6\n2 73\n23 6",
"output": "96"
},
{
"input": "28\n31 66\n31 91\n91 31\n97 66\n31 66\n31 66\n66 91\n91 31\n97 31\n91 97\n97 31\n66 31\n66 97\n91 31\n31 66\n31 66\n66 31\n31 97\n66 97\n97 31\n31 91\n66 91\n91 66\n31 66\n91 66\n66 31\n66 31\n91 97",
"output": "210"
},
{
"input": "29\n78 27\n50 68\n24 26\n68 43\n38 78\n26 38\n78 28\n28 26\n27 24\n23 38\n24 26\n24 43\n61 50\n38 78\n27 23\n61 26\n27 28\n43 23\n28 78\n43 27\n43 78\n27 61\n28 38\n61 78\n50 26\n43 27\n26 78\n28 50\n43 78",
"output": "73"
},
{
"input": "29\n80 27\n69 80\n27 80\n69 80\n80 27\n80 27\n80 27\n80 69\n27 69\n80 69\n80 27\n27 69\n69 27\n80 69\n27 69\n69 80\n27 69\n80 69\n80 27\n69 27\n27 69\n27 80\n80 27\n69 80\n27 69\n80 69\n69 80\n69 80\n27 80",
"output": "277"
},
{
"input": "30\n19 71\n7 89\n89 71\n21 7\n19 21\n7 89\n19 71\n89 8\n89 21\n19 8\n21 7\n8 89\n19 89\n7 21\n19 8\n19 7\n7 19\n8 21\n71 21\n71 89\n7 19\n7 19\n21 7\n21 19\n21 19\n71 8\n21 8\n71 19\n19 71\n8 21",
"output": "154"
},
{
"input": "30\n44 17\n44 17\n44 17\n17 44\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n44 17\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n17 44\n44 17\n44 17\n44 17\n17 44\n17 44\n44 17\n17 44\n44 17\n44 17\n44 17",
"output": "418"
},
{
"input": "22\n78 92\n15 92\n92 78\n78 80\n92 16\n24 80\n92 16\n16 92\n78 16\n24 78\n80 78\n92 80\n16 80\n80 78\n15 78\n92 16\n24 15\n24 80\n80 16\n16 80\n92 80\n24 80",
"output": "74"
},
{
"input": "24\n9 83\n90 31\n83 3\n83 3\n21 31\n83 3\n32 31\n12 21\n31 21\n90 32\n32 21\n12 9\n12 31\n9 83\n83 12\n32 3\n32 83\n90 31\n9 32\n31 21\n83 90\n32 21\n21 3\n32 9",
"output": "59"
},
{
"input": "30\n67 21\n85 39\n85 87\n21 39\n66 85\n10 95\n10 21\n87 85\n82 21\n67 21\n95 10\n21 39\n82 21\n21 66\n66 39\n95 30\n67 85\n66 82\n85 82\n21 66\n10 39\n67 10\n21 85\n10 82\n85 95\n10 85\n21 39\n85 39\n39 10\n95 67",
"output": "100"
},
{
"input": "4\n8 7\n8 7\n7 8\n7 8",
"output": "8"
},
{
"input": "6\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1",
"output": "10"
},
{
"input": "12\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1",
"output": "72"
},
{
"input": "4\n1 2\n1 2\n2 1\n2 1",
"output": "8"
}
] | 1,680,001,614
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 92
| 0
|
a=int(input())
g1=[]
g2=[]
c=0
for i in range(a):
h1,h2=list(map(int,input().split()))
g1.append(h1)
g2.append(h2)
for i in g1:
if i in g2:
m=g2.count(i)
c+=m
print(c)
|
Title: Games
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different.
There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number.
You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
Input Specification:
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
Output Specification:
In a single line print the number of games where the host team is going to play in the guest uniform.
Demo Input:
['3\n1 2\n2 4\n3 4\n', '4\n100 42\n42 100\n5 42\n100 5\n', '2\n1 2\n1 2\n']
Demo Output:
['1\n', '5\n', '0\n']
Note:
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2.
In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
|
```python
a=int(input())
g1=[]
g2=[]
c=0
for i in range(a):
h1,h2=list(map(int,input().split()))
g1.append(h1)
g2.append(h2)
for i in g1:
if i in g2:
m=g2.count(i)
c+=m
print(c)
```
| 3
|
|
567
|
A
|
Lineland Mail
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation"
] | null | null |
All cities of Lineland are located on the *Ox* coordinate axis. Thus, each city is associated with its position *x**i* — a coordinate on the *Ox* axis. No two cities are located at a single point.
Lineland residents love to send letters to each other. A person may send a letter only if the recipient lives in another city (because if they live in the same city, then it is easier to drop in).
Strange but true, the cost of sending the letter is exactly equal to the distance between the sender's city and the recipient's city.
For each city calculate two values *min**i* and *max**i*, where *min**i* is the minimum cost of sending a letter from the *i*-th city to some other city, and *max**i* is the the maximum cost of sending a letter from the *i*-th city to some other city
|
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=105) — the number of cities in Lineland. The second line contains the sequence of *n* distinct integers *x*1,<=*x*2,<=...,<=*x**n* (<=-<=109<=≤<=*x**i*<=≤<=109), where *x**i* is the *x*-coordinate of the *i*-th city. All the *x**i*'s are distinct and follow in ascending order.
|
Print *n* lines, the *i*-th line must contain two integers *min**i*,<=*max**i*, separated by a space, where *min**i* is the minimum cost of sending a letter from the *i*-th city, and *max**i* is the maximum cost of sending a letter from the *i*-th city.
|
[
"4\n-5 -2 2 7\n",
"2\n-1 1\n"
] |
[
"3 12\n3 9\n4 7\n5 12\n",
"2 2\n2 2\n"
] |
none
| 500
|
[
{
"input": "4\n-5 -2 2 7",
"output": "3 12\n3 9\n4 7\n5 12"
},
{
"input": "2\n-1 1",
"output": "2 2\n2 2"
},
{
"input": "3\n-1 0 1",
"output": "1 2\n1 1\n1 2"
},
{
"input": "4\n-1 0 1 3",
"output": "1 4\n1 3\n1 2\n2 4"
},
{
"input": "3\n-1000000000 0 1000000000",
"output": "1000000000 2000000000\n1000000000 1000000000\n1000000000 2000000000"
},
{
"input": "2\n-1000000000 1000000000",
"output": "2000000000 2000000000\n2000000000 2000000000"
},
{
"input": "10\n1 10 12 15 59 68 130 912 1239 9123",
"output": "9 9122\n2 9113\n2 9111\n3 9108\n9 9064\n9 9055\n62 8993\n327 8211\n327 7884\n7884 9122"
},
{
"input": "5\n-2 -1 0 1 2",
"output": "1 4\n1 3\n1 2\n1 3\n1 4"
},
{
"input": "5\n-2 -1 0 1 3",
"output": "1 5\n1 4\n1 3\n1 3\n2 5"
},
{
"input": "3\n-10000 1 10000",
"output": "10001 20000\n9999 10001\n9999 20000"
},
{
"input": "5\n-1000000000 -999999999 -999999998 -999999997 -999999996",
"output": "1 4\n1 3\n1 2\n1 3\n1 4"
},
{
"input": "10\n-857422304 -529223472 82412729 145077145 188538640 265299215 527377039 588634631 592896147 702473706",
"output": "328198832 1559896010\n328198832 1231697178\n62664416 939835033\n43461495 1002499449\n43461495 1045960944\n76760575 1122721519\n61257592 1384799343\n4261516 1446056935\n4261516 1450318451\n109577559 1559896010"
},
{
"input": "10\n-876779400 -829849659 -781819137 -570920213 18428128 25280705 121178189 219147240 528386329 923854124",
"output": "46929741 1800633524\n46929741 1753703783\n48030522 1705673261\n210898924 1494774337\n6852577 905425996\n6852577 902060105\n95897484 997957589\n97969051 1095926640\n309239089 1405165729\n395467795 1800633524"
},
{
"input": "30\n-15 1 21 25 30 40 59 60 77 81 97 100 103 123 139 141 157 158 173 183 200 215 226 231 244 256 267 279 289 292",
"output": "16 307\n16 291\n4 271\n4 267\n5 262\n10 252\n1 233\n1 232\n4 215\n4 211\n3 195\n3 192\n3 189\n16 169\n2 154\n2 156\n1 172\n1 173\n10 188\n10 198\n15 215\n11 230\n5 241\n5 246\n12 259\n11 271\n11 282\n10 294\n3 304\n3 307"
},
{
"input": "10\n-1000000000 -999999999 -999999997 -999999996 -999999995 -999999994 -999999992 -999999990 -999999988 -999999986",
"output": "1 14\n1 13\n1 11\n1 10\n1 9\n1 8\n2 8\n2 10\n2 12\n2 14"
},
{
"input": "50\n-50000 -49459 -48875 -48456 -48411 -48096 -47901 -47500 -47150 -46808 -46687 -46679 -46337 -45747 -45604 -45194 -44752 -44242 -44231 -44122 -43636 -43274 -42916 -42881 -42386 -42095 -41830 -41618 -41145 -40897 -40534 -40007 -39761 -39389 -39104 -38909 -38630 -38561 -38364 -38255 -38214 -38084 -37959 -37607 -37202 -36890 -36681 -36136 -36123 -35886",
"output": "541 14114\n541 13573\n419 12989\n45 12570\n45 12525\n195 12210\n195 12015\n350 11614\n342 11264\n121 10922\n8 10801\n8 10793\n342 10451\n143 9861\n143 9718\n410 9308\n442 8866\n11 8356\n11 8345\n109 8236\n362 7750\n358 7388\n35 7084\n35 7119\n291 7614\n265 7905\n212 8170\n212 8382\n248 8855\n248 9103\n363 9466\n246 9993\n246 10239\n285 10611\n195 10896\n195 11091\n69 11370\n69 11439\n109 11636\n41 11745\n41 11786\n125 11916\n125 12041\n352 12393\n312 12798\n209 13110\n209 13319\n13 13864\n13 13877\n237 141..."
},
{
"input": "3\n-1000000000 999999999 1000000000",
"output": "1999999999 2000000000\n1 1999999999\n1 2000000000"
}
] | 1,675,361,722
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 54
| 592
| 8,089,600
|
x=int(input())
l=list(map(int,input().split()))
menor=0
maior=0
for i in range(0,x):
if i==0:
maior=l[x-1]-l[i]
menor=l[1]-l[0]
elif i==x-1:
maior=l[i]-l[0]
menor=l[i]-l[i-1]
else:
maior=max((l[x-1]-l[i]),(l[i]-l[0]))
menor=min(l[i+1]-l[i],l[i]-l[i-1])
print(menor,'',maior)
|
Title: Lineland Mail
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
All cities of Lineland are located on the *Ox* coordinate axis. Thus, each city is associated with its position *x**i* — a coordinate on the *Ox* axis. No two cities are located at a single point.
Lineland residents love to send letters to each other. A person may send a letter only if the recipient lives in another city (because if they live in the same city, then it is easier to drop in).
Strange but true, the cost of sending the letter is exactly equal to the distance between the sender's city and the recipient's city.
For each city calculate two values *min**i* and *max**i*, where *min**i* is the minimum cost of sending a letter from the *i*-th city to some other city, and *max**i* is the the maximum cost of sending a letter from the *i*-th city to some other city
Input Specification:
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=105) — the number of cities in Lineland. The second line contains the sequence of *n* distinct integers *x*1,<=*x*2,<=...,<=*x**n* (<=-<=109<=≤<=*x**i*<=≤<=109), where *x**i* is the *x*-coordinate of the *i*-th city. All the *x**i*'s are distinct and follow in ascending order.
Output Specification:
Print *n* lines, the *i*-th line must contain two integers *min**i*,<=*max**i*, separated by a space, where *min**i* is the minimum cost of sending a letter from the *i*-th city, and *max**i* is the maximum cost of sending a letter from the *i*-th city.
Demo Input:
['4\n-5 -2 2 7\n', '2\n-1 1\n']
Demo Output:
['3 12\n3 9\n4 7\n5 12\n', '2 2\n2 2\n']
Note:
none
|
```python
x=int(input())
l=list(map(int,input().split()))
menor=0
maior=0
for i in range(0,x):
if i==0:
maior=l[x-1]-l[i]
menor=l[1]-l[0]
elif i==x-1:
maior=l[i]-l[0]
menor=l[i]-l[i-1]
else:
maior=max((l[x-1]-l[i]),(l[i]-l[0]))
menor=min(l[i+1]-l[i],l[i]-l[i-1])
print(menor,'',maior)
```
| 3
|
|
268
|
A
|
Games
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different.
There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number.
You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
|
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
|
In a single line print the number of games where the host team is going to play in the guest uniform.
|
[
"3\n1 2\n2 4\n3 4\n",
"4\n100 42\n42 100\n5 42\n100 5\n",
"2\n1 2\n1 2\n"
] |
[
"1\n",
"5\n",
"0\n"
] |
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2.
In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
| 500
|
[
{
"input": "3\n1 2\n2 4\n3 4",
"output": "1"
},
{
"input": "4\n100 42\n42 100\n5 42\n100 5",
"output": "5"
},
{
"input": "2\n1 2\n1 2",
"output": "0"
},
{
"input": "7\n4 7\n52 55\n16 4\n55 4\n20 99\n3 4\n7 52",
"output": "6"
},
{
"input": "10\n68 42\n1 35\n25 70\n59 79\n65 63\n46 6\n28 82\n92 62\n43 96\n37 28",
"output": "1"
},
{
"input": "30\n10 39\n89 1\n78 58\n75 99\n36 13\n77 50\n6 97\n79 28\n27 52\n56 5\n93 96\n40 21\n33 74\n26 37\n53 59\n98 56\n61 65\n42 57\n9 7\n25 63\n74 34\n96 84\n95 47\n12 23\n34 21\n71 6\n27 13\n15 47\n64 14\n12 77",
"output": "6"
},
{
"input": "30\n46 100\n87 53\n34 84\n44 66\n23 20\n50 34\n90 66\n17 39\n13 22\n94 33\n92 46\n63 78\n26 48\n44 61\n3 19\n41 84\n62 31\n65 89\n23 28\n58 57\n19 85\n26 60\n75 66\n69 67\n76 15\n64 15\n36 72\n90 89\n42 69\n45 35",
"output": "4"
},
{
"input": "2\n46 6\n6 46",
"output": "2"
},
{
"input": "29\n8 18\n33 75\n69 22\n97 95\n1 97\n78 10\n88 18\n13 3\n19 64\n98 12\n79 92\n41 72\n69 15\n98 31\n57 74\n15 56\n36 37\n15 66\n63 100\n16 42\n47 56\n6 4\n73 15\n30 24\n27 71\n12 19\n88 69\n85 6\n50 11",
"output": "10"
},
{
"input": "23\n43 78\n31 28\n58 80\n66 63\n20 4\n51 95\n40 20\n50 14\n5 34\n36 39\n77 42\n64 97\n62 89\n16 56\n8 34\n58 16\n37 35\n37 66\n8 54\n50 36\n24 8\n68 48\n85 33",
"output": "6"
},
{
"input": "13\n76 58\n32 85\n99 79\n23 58\n96 59\n72 35\n53 43\n96 55\n41 78\n75 10\n28 11\n72 7\n52 73",
"output": "0"
},
{
"input": "18\n6 90\n70 79\n26 52\n67 81\n29 95\n41 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 2",
"output": "1"
},
{
"input": "18\n6 90\n100 79\n26 100\n67 100\n29 100\n100 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 100",
"output": "8"
},
{
"input": "30\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1",
"output": "450"
},
{
"input": "30\n100 99\n58 59\n56 57\n54 55\n52 53\n50 51\n48 49\n46 47\n44 45\n42 43\n40 41\n38 39\n36 37\n34 35\n32 33\n30 31\n28 29\n26 27\n24 25\n22 23\n20 21\n18 19\n16 17\n14 15\n12 13\n10 11\n8 9\n6 7\n4 5\n2 3",
"output": "0"
},
{
"input": "15\n9 3\n2 6\n7 6\n5 10\n9 5\n8 1\n10 5\n2 8\n4 5\n9 8\n5 3\n3 8\n9 8\n4 10\n8 5",
"output": "20"
},
{
"input": "15\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n1 2",
"output": "108"
},
{
"input": "25\n2 1\n1 2\n1 2\n1 2\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n1 2\n2 1\n2 1\n2 1\n2 1\n1 2",
"output": "312"
},
{
"input": "25\n91 57\n2 73\n54 57\n2 57\n23 57\n2 6\n57 54\n57 23\n91 54\n91 23\n57 23\n91 57\n54 2\n6 91\n57 54\n2 57\n57 91\n73 91\n57 23\n91 57\n2 73\n91 2\n23 6\n2 73\n23 6",
"output": "96"
},
{
"input": "28\n31 66\n31 91\n91 31\n97 66\n31 66\n31 66\n66 91\n91 31\n97 31\n91 97\n97 31\n66 31\n66 97\n91 31\n31 66\n31 66\n66 31\n31 97\n66 97\n97 31\n31 91\n66 91\n91 66\n31 66\n91 66\n66 31\n66 31\n91 97",
"output": "210"
},
{
"input": "29\n78 27\n50 68\n24 26\n68 43\n38 78\n26 38\n78 28\n28 26\n27 24\n23 38\n24 26\n24 43\n61 50\n38 78\n27 23\n61 26\n27 28\n43 23\n28 78\n43 27\n43 78\n27 61\n28 38\n61 78\n50 26\n43 27\n26 78\n28 50\n43 78",
"output": "73"
},
{
"input": "29\n80 27\n69 80\n27 80\n69 80\n80 27\n80 27\n80 27\n80 69\n27 69\n80 69\n80 27\n27 69\n69 27\n80 69\n27 69\n69 80\n27 69\n80 69\n80 27\n69 27\n27 69\n27 80\n80 27\n69 80\n27 69\n80 69\n69 80\n69 80\n27 80",
"output": "277"
},
{
"input": "30\n19 71\n7 89\n89 71\n21 7\n19 21\n7 89\n19 71\n89 8\n89 21\n19 8\n21 7\n8 89\n19 89\n7 21\n19 8\n19 7\n7 19\n8 21\n71 21\n71 89\n7 19\n7 19\n21 7\n21 19\n21 19\n71 8\n21 8\n71 19\n19 71\n8 21",
"output": "154"
},
{
"input": "30\n44 17\n44 17\n44 17\n17 44\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n44 17\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n17 44\n44 17\n44 17\n44 17\n17 44\n17 44\n44 17\n17 44\n44 17\n44 17\n44 17",
"output": "418"
},
{
"input": "22\n78 92\n15 92\n92 78\n78 80\n92 16\n24 80\n92 16\n16 92\n78 16\n24 78\n80 78\n92 80\n16 80\n80 78\n15 78\n92 16\n24 15\n24 80\n80 16\n16 80\n92 80\n24 80",
"output": "74"
},
{
"input": "24\n9 83\n90 31\n83 3\n83 3\n21 31\n83 3\n32 31\n12 21\n31 21\n90 32\n32 21\n12 9\n12 31\n9 83\n83 12\n32 3\n32 83\n90 31\n9 32\n31 21\n83 90\n32 21\n21 3\n32 9",
"output": "59"
},
{
"input": "30\n67 21\n85 39\n85 87\n21 39\n66 85\n10 95\n10 21\n87 85\n82 21\n67 21\n95 10\n21 39\n82 21\n21 66\n66 39\n95 30\n67 85\n66 82\n85 82\n21 66\n10 39\n67 10\n21 85\n10 82\n85 95\n10 85\n21 39\n85 39\n39 10\n95 67",
"output": "100"
},
{
"input": "4\n8 7\n8 7\n7 8\n7 8",
"output": "8"
},
{
"input": "6\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1",
"output": "10"
},
{
"input": "12\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1",
"output": "72"
},
{
"input": "4\n1 2\n1 2\n2 1\n2 1",
"output": "8"
}
] | 1,680,413,522
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 92
| 0
|
n = int(input())
home = {}
away = {}
ahome = []
aaway = []
for _ in range(n) :
d = input().split()
n = [int(i) for i in d]
home[n[0]] = 0
away[n[1]] = 0
ahome.append(n[0])
aaway.append(n[1])
r= 0
for i in range(len(ahome)):
home[ahome[i]]+=1
away[aaway[i]]+=1
for i in home.keys():
if i in away.keys():
r+= away[i]*home[i]
print(r)
|
Title: Games
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different.
There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number.
You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
Input Specification:
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
Output Specification:
In a single line print the number of games where the host team is going to play in the guest uniform.
Demo Input:
['3\n1 2\n2 4\n3 4\n', '4\n100 42\n42 100\n5 42\n100 5\n', '2\n1 2\n1 2\n']
Demo Output:
['1\n', '5\n', '0\n']
Note:
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2.
In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
|
```python
n = int(input())
home = {}
away = {}
ahome = []
aaway = []
for _ in range(n) :
d = input().split()
n = [int(i) for i in d]
home[n[0]] = 0
away[n[1]] = 0
ahome.append(n[0])
aaway.append(n[1])
r= 0
for i in range(len(ahome)):
home[ahome[i]]+=1
away[aaway[i]]+=1
for i in home.keys():
if i in away.keys():
r+= away[i]*home[i]
print(r)
```
| 3
|
|
141
|
A
|
Amusing Joke
|
PROGRAMMING
| 800
|
[
"implementation",
"sortings",
"strings"
] | null | null |
So, the New Year holidays are over. Santa Claus and his colleagues can take a rest and have guests at last. When two "New Year and Christmas Men" meet, thear assistants cut out of cardboard the letters from the guest's name and the host's name in honor of this event. Then the hung the letters above the main entrance. One night, when everyone went to bed, someone took all the letters of our characters' names. Then he may have shuffled the letters and put them in one pile in front of the door.
The next morning it was impossible to find the culprit who had made the disorder. But everybody wondered whether it is possible to restore the names of the host and his guests from the letters lying at the door? That is, we need to verify that there are no extra letters, and that nobody will need to cut more letters.
Help the "New Year and Christmas Men" and their friends to cope with this problem. You are given both inscriptions that hung over the front door the previous night, and a pile of letters that were found at the front door next morning.
|
The input file consists of three lines: the first line contains the guest's name, the second line contains the name of the residence host and the third line contains letters in a pile that were found at the door in the morning. All lines are not empty and contain only uppercase Latin letters. The length of each line does not exceed 100.
|
Print "YES" without the quotes, if the letters in the pile could be permuted to make the names of the "New Year and Christmas Men". Otherwise, print "NO" without the quotes.
|
[
"SANTACLAUS\nDEDMOROZ\nSANTAMOROZDEDCLAUS\n",
"PAPAINOEL\nJOULUPUKKI\nJOULNAPAOILELUPUKKI\n",
"BABBONATALE\nFATHERCHRISTMAS\nBABCHRISTMASBONATALLEFATHER\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
In the first sample the letters written in the last line can be used to write the names and there won't be any extra letters left.
In the second sample letter "P" is missing from the pile and there's an extra letter "L".
In the third sample there's an extra letter "L".
| 500
|
[
{
"input": "SANTACLAUS\nDEDMOROZ\nSANTAMOROZDEDCLAUS",
"output": "YES"
},
{
"input": "PAPAINOEL\nJOULUPUKKI\nJOULNAPAOILELUPUKKI",
"output": "NO"
},
{
"input": "BABBONATALE\nFATHERCHRISTMAS\nBABCHRISTMASBONATALLEFATHER",
"output": "NO"
},
{
"input": "B\nA\nAB",
"output": "YES"
},
{
"input": "ONDOL\nJNPB\nONLNJBODP",
"output": "YES"
},
{
"input": "Y\nW\nYW",
"output": "YES"
},
{
"input": "OI\nM\nIMO",
"output": "YES"
},
{
"input": "VFQRWWWACX\nGHZJPOQUSXRAQDGOGMR\nOPAWDOUSGWWCGQXXQAZJRQRGHRMVF",
"output": "YES"
},
{
"input": "JUTCN\nPIGMZOPMEUFADQBW\nNWQGZMAIPUPOMCDUB",
"output": "NO"
},
{
"input": "Z\nO\nZOCNDOLTBZKQLTBOLDEGXRHZGTTPBJBLSJCVSVXISQZCSFDEBXRCSGBGTHWOVIXYHACAGBRYBKBJAEPIQZHVEGLYH",
"output": "NO"
},
{
"input": "IQ\nOQ\nQOQIGGKFNHJSGCGM",
"output": "NO"
},
{
"input": "ROUWANOPNIGTVMIITVMZ\nOQTUPZMTKUGY\nVTVNGZITGPUNPMQOOATUUIYIWMMKZOTR",
"output": "YES"
},
{
"input": "OVQELLOGFIOLEHXMEMBJDIGBPGEYFG\nJNKFPFFIJOFHRIFHXEWYZOPDJBZTJZKBWQTECNHRFSJPJOAPQT\nYAIPFFFEXJJNEJPLREIGODEGQZVMCOBDFKWTMWJSBEBTOFFQOHIQJLHFNXIGOHEZRZLFOKJBJPTPHPGY",
"output": "YES"
},
{
"input": "NBJGVNGUISUXQTBOBKYHQCOOVQWUXWPXBUDLXPKX\nNSFQDFUMQDQWQ\nWXKKVNTDQQFXCUQBIMQGQHSLVGWSBFYBUPOWPBDUUJUXQNOQDNXOX",
"output": "YES"
},
{
"input": "IJHHGKCXWDBRWJUPRDBZJLNTTNWKXLUGJSBWBOAUKWRAQWGFNL\nNJMWRMBCNPHXTDQQNZ\nWDNJRCLILNQRHWBANLTXWMJBPKUPGKJDJZAQWKTZFBRCTXHHBNXRGUQUNBNMWODGSJWW",
"output": "YES"
},
{
"input": "SRROWANGUGZHCIEFYMQVTWVOMDWPUZJFRDUMVFHYNHNTTGNXCJ\nDJYWGLBFCCECXFHOLORDGDCNRHPWXNHXFCXQCEZUHRRNAEKUIX\nWCUJDNYHNHYOPWMHLDCDYRWBVOGHFFUKOZTXJRXJHRGWICCMRNEVNEGQWTZPNFCSHDRFCFQDCXMHTLUGZAXOFNXNVGUEXIACRERU",
"output": "YES"
},
{
"input": "H\nJKFGHMIAHNDBMFXWYQLZRSVNOTEGCQSVUBYUOZBTNKTXPFQDCMKAGFITEUGOYDFIYQIORMFJEOJDNTFVIQEBICSNGKOSNLNXJWC\nBQSVDOGIHCHXSYNYTQFCHNJGYFIXTSOQINZOKSVQJMTKNTGFNXAVTUYEONMBQMGJLEWJOFGEARIOPKFUFCEMUBRBDNIIDFZDCLWK",
"output": "YES"
},
{
"input": "DSWNZRFVXQ\nPVULCZGOOU\nUOLVZXNUPOQRZGWFVDSCANQTCLEIE",
"output": "NO"
},
{
"input": "EUHTSCENIPXLTSBMLFHD\nIZAVSZPDLXOAGESUSE\nLXAELAZ",
"output": "NO"
},
{
"input": "WYSJFEREGELSKRQRXDXCGBODEFZVSI\nPEJKMGFLBFFDWRCRFSHVEFLEBTJCVCHRJTLDTISHPOGFWPLEWNYJLMXWIAOTYOXMV\nHXERTZWLEXTPIOTFRVMEJVYFFJLRPFMXDEBNSGCEOFFCWTKIDDGCFYSJKGLHBORWEPLDRXRSJYBGASSVCMHEEJFLVI",
"output": "NO"
},
{
"input": "EPBMDIUQAAUGLBIETKOKFLMTCVEPETWJRHHYKCKU\nHGMAETVPCFZYNNKDQXVXUALHYLOTCHM\nECGXACVKEYMCEDOTMKAUFHLHOMT",
"output": "NO"
},
{
"input": "NUBKQEJHALANSHEIFUZHYEZKKDRFHQKAJHLAOWTZIMOCWOVVDW\nEFVOBIGAUAUSQGVSNBKNOBDMINODMFSHDL\nKLAMKNTHBFFOHVKWICHBKNDDQNEISODUSDNLUSIOAVWY",
"output": "NO"
},
{
"input": "VXINHOMEQCATZUGAJEIUIZZLPYFGUTVLNBNWCUVMEENUXKBWBGZTMRJJVJDLVSLBABVCEUDDSQFHOYPYQTWVAGTWOLKYISAGHBMC\nZMRGXPZSHOGCSAECAPGVOIGCWEOWWOJXLGYRDMPXBLOKZVRACPYQLEQGFQCVYXAGBEBELUTDAYEAGPFKXRULZCKFHZCHVCWIRGPK\nRCVUXGQVNWFGRUDLLENNDQEJHYYVWMKTLOVIPELKPWCLSQPTAXAYEMGWCBXEVAIZGGDDRBRT",
"output": "NO"
},
{
"input": "PHBDHHWUUTZAHELGSGGOPOQXSXEZIXHZTOKYFBQLBDYWPVCNQSXHEAXRRPVHFJBVBYCJIFOTQTWSUOWXLKMVJJBNLGTVITWTCZZ\nFUPDLNVIHRWTEEEHOOEC\nLOUSUUSZCHJBPEWIILUOXEXRQNCJEGTOBRVZLTTZAHTKVEJSNGHFTAYGY",
"output": "NO"
},
{
"input": "GDSLNIIKTO\nJF\nPDQYFKDTNOLI",
"output": "NO"
},
{
"input": "AHOKHEKKPJLJIIWJRCGY\nORELJCSIX\nZVWPXVFWFSWOXXLIHJKPXIOKRELYE",
"output": "NO"
},
{
"input": "ZWCOJFORBPHXCOVJIDPKVECMHVHCOC\nTEV\nJVGTBFTLFVIEPCCHODOFOMCVZHWXVCPEH",
"output": "NO"
},
{
"input": "AGFIGYWJLVMYZGNQHEHWKJIAWBPUAQFERMCDROFN\nPMJNHMVNRGCYZAVRWNDSMLSZHFNYIUWFPUSKKIGU\nMCDVPPRXGUAYLSDRHRURZASXUWZSIIEZCPXUVEONKNGNWRYGOSFMCKESMVJZHWWUCHWDQMLASLNNMHAU",
"output": "NO"
},
{
"input": "XLOWVFCZSSXCSYQTIIDKHNTKNKEEDFMDZKXSPVLBIDIREDUAIN\nZKIWNDGBISDB\nSLPKLYFYSRNRMOSWYLJJDGFFENPOXYLPZFTQDANKBDNZDIIEWSUTTKYBKVICLG",
"output": "NO"
},
{
"input": "PMUKBTRKFIAYVGBKHZHUSJYSSEPEOEWPOSPJLWLOCTUYZODLTUAFCMVKGQKRRUSOMPAYOTBTFPXYAZXLOADDEJBDLYOTXJCJYTHA\nTWRRAJLCQJTKOKWCGUH\nEWDPNXVCXWCDQCOYKKSOYTFSZTOOPKPRDKFJDETKSRAJRVCPDOBWUGPYRJPUWJYWCBLKOOTUPBESTOFXZHTYLLMCAXDYAEBUTAHM",
"output": "NO"
},
{
"input": "QMIMGQRQDMJDPNFEFXSXQMCHEJKTWCTCVZPUAYICOIRYOWKUSIWXJLHDYWSBOITHTMINXFKBKAWZTXXBJIVYCRWKXNKIYKLDDXL\nV\nFWACCXBVDOJFIUAVYRALBYJKXXWIIFORRUHKHCXLDBZMXIYJWISFEAWTIQFIZSBXMKNOCQKVKRWDNDAMQSTKYLDNYVTUCGOJXJTW",
"output": "NO"
},
{
"input": "XJXPVOOQODELPPWUISSYVVXRJTYBPDHJNENQEVQNVFIXSESKXVYPVVHPMOSX\nLEXOPFPVPSZK\nZVXVPYEYOYXVOISVLXPOVHEQVXPNQJIOPFDTXEUNMPEPPHELNXKKWSVSOXSBPSJDPVJVSRFQ",
"output": "YES"
},
{
"input": "OSKFHGYNQLSRFSAHPXKGPXUHXTRBJNAQRBSSWJVEENLJCDDHFXVCUNPZAIVVO\nFNUOCXAGRRHNDJAHVVLGGEZQHWARYHENBKHP\nUOEFNWVXCUNERLKVTHAGPSHKHDYFPYWZHJKHQLSNFBJHVJANRXCNSDUGVDABGHVAOVHBJZXGRACHRXEGNRPQEAPORQSILNXFS",
"output": "YES"
},
{
"input": "VYXYVVACMLPDHONBUTQFZTRREERBLKUJYKAHZRCTRLRCLOZYWVPBRGDQPFPQIF\nFE\nRNRPEVDRLYUQFYRZBCQLCYZEABKLRXCJLKVZBVFUEYRATOMDRTHFPGOWQVTIFPPH",
"output": "YES"
},
{
"input": "WYXUZQJQNLASEGLHPMSARWMTTQMQLVAZLGHPIZTRVTCXDXBOLNXZPOFCTEHCXBZ\nBLQZRRWP\nGIQZXPLTTMNHQVWPPEAPLOCDMBSTHRCFLCQRRZXLVAOQEGZBRUZJXXZTMAWLZHSLWNQTYXB",
"output": "YES"
},
{
"input": "MKVJTSSTDGKPVVDPYSRJJYEVGKBMSIOKHLZQAEWLRIBINVRDAJIBCEITKDHUCCVY\nPUJJQFHOGZKTAVNUGKQUHMKTNHCCTI\nQVJKUSIGTSVYUMOMLEGHWYKSKQTGATTKBNTKCJKJPCAIRJIRMHKBIZISEGFHVUVQZBDERJCVAKDLNTHUDCHONDCVVJIYPP",
"output": "YES"
},
{
"input": "OKNJOEYVMZXJMLVJHCSPLUCNYGTDASKSGKKCRVIDGEIBEWRVBVRVZZTLMCJLXHJIA\nDJBFVRTARTFZOWN\nAGHNVUNJVCPLWSVYBJKZSVTFGLELZASLWTIXDDJXCZDICTVIJOTMVEYOVRNMJGRKKHRMEBORAKFCZJBR",
"output": "YES"
},
{
"input": "OQZACLPSAGYDWHFXDFYFRRXWGIEJGSXWUONAFWNFXDTGVNDEWNQPHUXUJNZWWLBPYL\nOHBKWRFDRQUAFRCMT\nWIQRYXRJQWWRUWCYXNXALKFZGXFTLOODWRDPGURFUFUQOHPWBASZNVWXNCAGHWEHFYESJNFBMNFDDAPLDGT",
"output": "YES"
},
{
"input": "OVIRQRFQOOWVDEPLCJETWQSINIOPLTLXHSQWUYUJNFBMKDNOSHNJQQCDHZOJVPRYVSV\nMYYDQKOOYPOOUELCRIT\nNZSOTVLJTTVQLFHDQEJONEOUOFOLYVSOIYUDNOSIQVIRMVOERCLMYSHPCQKIDRDOQPCUPQBWWRYYOXJWJQPNKH",
"output": "YES"
},
{
"input": "WGMBZWNMSJXNGDUQUJTCNXDSJJLYRDOPEGPQXYUGBESDLFTJRZDDCAAFGCOCYCQMDBWK\nYOBMOVYTUATTFGJLYUQD\nDYXVTLQCYFJUNJTUXPUYOPCBCLBWNSDUJRJGWDOJDSQAAMUOJWSYERDYDXYTMTOTMQCGQZDCGNFBALGGDFKZMEBG",
"output": "YES"
},
{
"input": "CWLRBPMEZCXAPUUQFXCUHAQTLPBTXUUKWVXKBHKNSSJFEXLZMXGVFHHVTPYAQYTIKXJJE\nMUFOSEUEXEQTOVLGDSCWM\nJUKEQCXOXWEHCGKFPBIGMWVJLXUONFXBYTUAXERYTXKCESKLXAEHVPZMMUFTHLXTTZSDMBJLQPEUWCVUHSQQVUASPF",
"output": "YES"
},
{
"input": "IDQRX\nWETHO\nODPDGBHVUVSSISROHQJTUKPUCLXABIZQQPPBPKOSEWGEHRSRRNBAVLYEMZISMWWGKHVTXKUGUXEFBSWOIWUHRJGMWBMHQLDZHBWA",
"output": "NO"
},
{
"input": "IXFDY\nJRMOU\nDF",
"output": "NO"
},
{
"input": "JPSPZ\nUGCUB\nJMZZZZZZZZ",
"output": "NO"
},
{
"input": "AC\nA\nBBA",
"output": "NO"
},
{
"input": "UIKWWKXLSHTOOZOVGXKYSOJEHAUEEG\nKZXQDWJJWRXFHKJDQHJK\nXMZHTFOGEXAUJXXJUYVJIFOTKLZHDKELJWERHMGAWGKWAQKEKHIDWGGZVYOHKXRPWSJDPESFJUMKQYWBYUTHQYEFZUGKQOBHYDWB",
"output": "NO"
},
{
"input": "PXWRXRPFLR\nPJRWWXIVHODV\nXW",
"output": "NO"
},
{
"input": "CHTAZVHGSHCVIBK\nEQINEBKXEPYJSAZIMLDF\nZCZZZZDZMCZZEZDZZEZZZZQZZBZZZOZZCZE",
"output": "NO"
},
{
"input": "GXPZFSELJJNDAXYRV\nUYBKPMVBSOVOJWMONLTJOJCNQKMTAHEWLHOWIIBH\nHCWNFWJPEJIWOVPTBMVCRJLSISSVNOHCKLBFMIUAIMASQWPXEYXBOXQGFEMYJLBKDCZIMJNHOJEDGGANIVYKQTUOSOVOPWHVJGXH",
"output": "NO"
},
{
"input": "LFGJCJJDUTUP\nOVSBILTIYCJCRHKCIXCETJQJJ\nGIJJTJCLTJJJ",
"output": "NO"
},
{
"input": "GIO\nPRL\nPRL",
"output": "NO"
},
{
"input": "A\nB\nABC",
"output": "NO"
},
{
"input": "KKK\nKKK\nZZZZZ",
"output": "NO"
},
{
"input": "ZMYGQLDBLAPN\nZFJBKWHROVNPSJQUDFTHOCGREUFLYIWYICD\nZMJZZEDAZANKZZZZZZEZZBZDZZZZZZKHZZFZZZDZNZMDZZA",
"output": "NO"
}
] | 1,684,173,812
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 54
| 92
| 0
|
a=input()
b=input()
c=sorted(input())
d= a+b
if sorted(d) ==c:
print('YES')
else:
print('NO')
|
Title: Amusing Joke
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
So, the New Year holidays are over. Santa Claus and his colleagues can take a rest and have guests at last. When two "New Year and Christmas Men" meet, thear assistants cut out of cardboard the letters from the guest's name and the host's name in honor of this event. Then the hung the letters above the main entrance. One night, when everyone went to bed, someone took all the letters of our characters' names. Then he may have shuffled the letters and put them in one pile in front of the door.
The next morning it was impossible to find the culprit who had made the disorder. But everybody wondered whether it is possible to restore the names of the host and his guests from the letters lying at the door? That is, we need to verify that there are no extra letters, and that nobody will need to cut more letters.
Help the "New Year and Christmas Men" and their friends to cope with this problem. You are given both inscriptions that hung over the front door the previous night, and a pile of letters that were found at the front door next morning.
Input Specification:
The input file consists of three lines: the first line contains the guest's name, the second line contains the name of the residence host and the third line contains letters in a pile that were found at the door in the morning. All lines are not empty and contain only uppercase Latin letters. The length of each line does not exceed 100.
Output Specification:
Print "YES" without the quotes, if the letters in the pile could be permuted to make the names of the "New Year and Christmas Men". Otherwise, print "NO" without the quotes.
Demo Input:
['SANTACLAUS\nDEDMOROZ\nSANTAMOROZDEDCLAUS\n', 'PAPAINOEL\nJOULUPUKKI\nJOULNAPAOILELUPUKKI\n', 'BABBONATALE\nFATHERCHRISTMAS\nBABCHRISTMASBONATALLEFATHER\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
In the first sample the letters written in the last line can be used to write the names and there won't be any extra letters left.
In the second sample letter "P" is missing from the pile and there's an extra letter "L".
In the third sample there's an extra letter "L".
|
```python
a=input()
b=input()
c=sorted(input())
d= a+b
if sorted(d) ==c:
print('YES')
else:
print('NO')
```
| 3
|
|
393
|
A
|
Nineteen
|
PROGRAMMING
| 0
|
[] | null | null |
Alice likes word "nineteen" very much. She has a string *s* and wants the string to contain as many such words as possible. For that reason she can rearrange the letters of the string.
For example, if she has string "xiineteenppnnnewtnee", she can get string "xnineteenppnineteenw", containing (the occurrences marked) two such words. More formally, word "nineteen" occurs in the string the number of times you can read it starting from some letter of the string. Of course, you shouldn't skip letters.
Help her to find the maximum number of "nineteen"s that she can get in her string.
|
The first line contains a non-empty string *s*, consisting only of lowercase English letters. The length of string *s* doesn't exceed 100.
|
Print a single integer — the maximum number of "nineteen"s that she can get in her string.
|
[
"nniinneetteeeenn\n",
"nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii\n",
"nineteenineteen\n"
] |
[
"2",
"2",
"2"
] |
none
| 500
|
[
{
"input": "nniinneetteeeenn",
"output": "2"
},
{
"input": "nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii",
"output": "2"
},
{
"input": "nineteenineteen",
"output": "2"
},
{
"input": "nssemsnnsitjtihtthij",
"output": "0"
},
{
"input": "eehihnttehtherjsihihnrhimihrjinjiehmtjimnrss",
"output": "1"
},
{
"input": "rrrteiehtesisntnjirtitijnjjjthrsmhtneirjimniemmnrhirssjnhetmnmjejjnjjritjttnnrhnjs",
"output": "2"
},
{
"input": "mmrehtretseihsrjmtsenemniehssnisijmsnntesismmtmthnsieijjjnsnhisi",
"output": "2"
},
{
"input": "hshretttnntmmiertrrnjihnrmshnthirnnirrheinnnrjiirshthsrsijtrrtrmnjrrjnresnintnmtrhsnjrinsseimn",
"output": "1"
},
{
"input": "snmmensntritetnmmmerhhrmhnehehtesmhthseemjhmnrti",
"output": "2"
},
{
"input": "rmeetriiitijmrenmeiijt",
"output": "0"
},
{
"input": "ihimeitimrmhriemsjhrtjtijtesmhemnmmrsetmjttthtjhnnmirtimne",
"output": "1"
},
{
"input": "rhtsnmnesieernhstjnmmirthhieejsjttsiierhihhrrijhrrnejsjer",
"output": "2"
},
{
"input": "emmtjsjhretehmiiiestmtmnmissjrstnsnjmhimjmststsitemtttjrnhsrmsenjtjim",
"output": "2"
},
{
"input": "nmehhjrhirniitshjtrrtitsjsntjhrstjehhhrrerhemehjeermhmhjejjesnhsiirheijjrnrjmminneeehtm",
"output": "3"
},
{
"input": "hsntijjetmehejtsitnthietssmeenjrhhetsnjrsethisjrtrhrierjtmimeenjnhnijeesjttrmn",
"output": "3"
},
{
"input": "jnirirhmirmhisemittnnsmsttesjhmjnsjsmntisheneiinsrjsjirnrmnjmjhmistntersimrjni",
"output": "1"
},
{
"input": "neithjhhhtmejjnmieishethmtetthrienrhjmjenrmtejerernmthmsnrthhtrimmtmshm",
"output": "2"
},
{
"input": "sithnrsnemhijsnjitmijjhejjrinejhjinhtisttteermrjjrtsirmessejireihjnnhhemiirmhhjeet",
"output": "3"
},
{
"input": "jrjshtjstteh",
"output": "0"
},
{
"input": "jsihrimrjnnmhttmrtrenetimemjnshnimeiitmnmjishjjneisesrjemeshjsijithtn",
"output": "2"
},
{
"input": "hhtjnnmsemermhhtsstejehsssmnesereehnnsnnremjmmieethmirjjhn",
"output": "2"
},
{
"input": "tmnersmrtsehhntsietttrehrhneiireijnijjejmjhei",
"output": "1"
},
{
"input": "mtstiresrtmesritnjriirehtermtrtseirtjrhsejhhmnsineinsjsin",
"output": "2"
},
{
"input": "ssitrhtmmhtnmtreijteinimjemsiiirhrttinsnneshintjnin",
"output": "1"
},
{
"input": "rnsrsmretjiitrjthhritniijhjmm",
"output": "0"
},
{
"input": "hntrteieimrimteemenserntrejhhmijmtjjhnsrsrmrnsjseihnjmehtthnnithirnhj",
"output": "3"
},
{
"input": "nmmtsmjrntrhhtmimeresnrinstjnhiinjtnjjjnthsintmtrhijnrnmtjihtinmni",
"output": "0"
},
{
"input": "eihstiirnmteejeehimttrijittjsntjejmessstsemmtristjrhenithrrsssihnthheehhrnmimssjmejjreimjiemrmiis",
"output": "2"
},
{
"input": "srthnimimnemtnmhsjmmmjmmrsrisehjseinemienntetmitjtnnneseimhnrmiinsismhinjjnreehseh",
"output": "3"
},
{
"input": "etrsmrjehntjjimjnmsresjnrthjhehhtreiijjminnheeiinseenmmethiemmistsei",
"output": "3"
},
{
"input": "msjeshtthsieshejsjhsnhejsihisijsertenrshhrthjhiirijjneinjrtrmrs",
"output": "1"
},
{
"input": "mehsmstmeejrhhsjihntjmrjrihssmtnensttmirtieehimj",
"output": "1"
},
{
"input": "mmmsermimjmrhrhejhrrejermsneheihhjemnehrhihesnjsehthjsmmjeiejmmnhinsemjrntrhrhsmjtttsrhjjmejj",
"output": "2"
},
{
"input": "rhsmrmesijmmsnsmmhertnrhsetmisshriirhetmjihsmiinimtrnitrseii",
"output": "1"
},
{
"input": "iihienhirmnihh",
"output": "0"
},
{
"input": "ismtthhshjmhisssnmnhe",
"output": "0"
},
{
"input": "rhsmnrmhejshinnjrtmtsssijimimethnm",
"output": "0"
},
{
"input": "eehnshtiriejhiirntminrirnjihmrnittnmmnjejjhjtennremrnssnejtntrtsiejjijisermj",
"output": "3"
},
{
"input": "rnhmeesnhttrjintnhnrhristjrthhrmehrhjmjhjehmstrijemjmmistes",
"output": "2"
},
{
"input": "ssrmjmjeeetrnimemrhimes",
"output": "0"
},
{
"input": "n",
"output": "0"
},
{
"input": "ni",
"output": "0"
},
{
"input": "nine",
"output": "0"
},
{
"input": "nineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteen",
"output": "13"
},
{
"input": "ninetee",
"output": "0"
},
{
"input": "mzbmweyydiadtlcouegmdbyfwurpwbpuvhifnuapwynd",
"output": "0"
},
{
"input": "zenudggmyopddhszhrbmftgzmjorabhgojdtfnzxjkayjlkgczsyshczutkdch",
"output": "0"
},
{
"input": "rtzxovxqfapkdmelxiyjroohufhbakpmmvaxq",
"output": "0"
},
{
"input": "zninetneeineteeniwnteeennieteenineteenineteenineteenineteenineteenineteenineteenineteeninetzeenz",
"output": "13"
},
{
"input": "nnnnnnniiiiiiiiiiiitttttttttteeeeeeeeeeeeeeeeee",
"output": "3"
},
{
"input": "ttttiiiieeeeeeeeeeeennnnnnnnn",
"output": "4"
},
{
"input": "ttttttttteeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiinnnnnnn",
"output": "3"
},
{
"input": "nnnnnnnnnneeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiiiiiiiiiitttttttttttttttttttt",
"output": "4"
},
{
"input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiiiiiiittttttttttttttttnnnnnnn",
"output": "3"
},
{
"input": "nineeen",
"output": "0"
},
{
"input": "nineteeeeeeeeeeeeeeeeettttttttttttttttttiiiiiiiiiiiiiiiiii",
"output": "0"
},
{
"input": "nineteenieteenieteenieteenieteenieteenieteen",
"output": "4"
},
{
"input": "nineteenineteenineteenineteenineteen",
"output": "5"
}
] | 1,585,849,926
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 58
| 108
| 0
|
s= input ()
pr=[]
e=s.count("e")
n=s.count("n")
t=s.count("t")
i=s.count("i")
pr.append(int((n-1)/2))
pr.append(i)
pr.append(int(e/3))
pr.append(t)
print(min(pr))
|
Title: Nineteen
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alice likes word "nineteen" very much. She has a string *s* and wants the string to contain as many such words as possible. For that reason she can rearrange the letters of the string.
For example, if she has string "xiineteenppnnnewtnee", she can get string "xnineteenppnineteenw", containing (the occurrences marked) two such words. More formally, word "nineteen" occurs in the string the number of times you can read it starting from some letter of the string. Of course, you shouldn't skip letters.
Help her to find the maximum number of "nineteen"s that she can get in her string.
Input Specification:
The first line contains a non-empty string *s*, consisting only of lowercase English letters. The length of string *s* doesn't exceed 100.
Output Specification:
Print a single integer — the maximum number of "nineteen"s that she can get in her string.
Demo Input:
['nniinneetteeeenn\n', 'nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii\n', 'nineteenineteen\n']
Demo Output:
['2', '2', '2']
Note:
none
|
```python
s= input ()
pr=[]
e=s.count("e")
n=s.count("n")
t=s.count("t")
i=s.count("i")
pr.append(int((n-1)/2))
pr.append(i)
pr.append(int(e/3))
pr.append(t)
print(min(pr))
```
| 3
|
|
817
|
A
|
Treasure Hunt
|
PROGRAMMING
| 1,200
|
[
"implementation",
"math",
"number theory"
] | null | null |
Captain Bill the Hummingbird and his crew recieved an interesting challenge offer. Some stranger gave them a map, potion of teleportation and said that only this potion might help them to reach the treasure.
Bottle with potion has two values *x* and *y* written on it. These values define four moves which can be performed using the potion:
- - - -
Map shows that the position of Captain Bill the Hummingbird is (*x*1,<=*y*1) and the position of the treasure is (*x*2,<=*y*2).
You task is to tell Captain Bill the Hummingbird whether he should accept this challenge or decline. If it is possible for Captain to reach the treasure using the potion then output "YES", otherwise "NO" (without quotes).
The potion can be used infinite amount of times.
|
The first line contains four integer numbers *x*1,<=*y*1,<=*x*2,<=*y*2 (<=-<=105<=≤<=*x*1,<=*y*1,<=*x*2,<=*y*2<=≤<=105) — positions of Captain Bill the Hummingbird and treasure respectively.
The second line contains two integer numbers *x*,<=*y* (1<=≤<=*x*,<=*y*<=≤<=105) — values on the potion bottle.
|
Print "YES" if it is possible for Captain to reach the treasure using the potion, otherwise print "NO" (without quotes).
|
[
"0 0 0 6\n2 3\n",
"1 1 3 6\n1 5\n"
] |
[
"YES\n",
"NO\n"
] |
In the first example there exists such sequence of moves:
1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7c939890fb4ed35688177327dac981bfa9216c00.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the first type of move 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/afbfa42fbac4e0641e7466e3aac74cbbb08ed597.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the third type of move
| 0
|
[
{
"input": "0 0 0 6\n2 3",
"output": "YES"
},
{
"input": "1 1 3 6\n1 5",
"output": "NO"
},
{
"input": "5 4 6 -10\n1 1",
"output": "NO"
},
{
"input": "6 -3 -7 -7\n1 2",
"output": "NO"
},
{
"input": "2 -5 -8 8\n2 1",
"output": "YES"
},
{
"input": "70 -81 -17 80\n87 23",
"output": "YES"
},
{
"input": "41 366 218 -240\n3456 1234",
"output": "NO"
},
{
"input": "-61972 -39646 -42371 -24854\n573 238",
"output": "NO"
},
{
"input": "-84870 -42042 94570 98028\n8972 23345",
"output": "YES"
},
{
"input": "-58533 -50999 -1007 -59169\n8972 23345",
"output": "NO"
},
{
"input": "-100000 -100000 100000 100000\n100000 100000",
"output": "YES"
},
{
"input": "-100000 -100000 100000 100000\n1 1",
"output": "YES"
},
{
"input": "5 2 5 3\n1 1",
"output": "NO"
},
{
"input": "5 5 5 5\n5 5",
"output": "YES"
},
{
"input": "0 0 1000 1000\n1 1",
"output": "YES"
},
{
"input": "0 0 0 1\n1 1",
"output": "NO"
},
{
"input": "1 1 4 4\n2 2",
"output": "NO"
},
{
"input": "100000 100000 99999 99999\n100000 100000",
"output": "NO"
},
{
"input": "1 1 1 6\n1 5",
"output": "NO"
},
{
"input": "2 9 4 0\n2 3",
"output": "YES"
},
{
"input": "0 0 0 9\n2 3",
"output": "NO"
},
{
"input": "14 88 14 88\n100 500",
"output": "YES"
},
{
"input": "-1 0 3 0\n4 4",
"output": "NO"
},
{
"input": "0 0 8 9\n2 3",
"output": "NO"
},
{
"input": "-2 5 7 -6\n1 1",
"output": "YES"
},
{
"input": "3 7 -8 8\n2 2",
"output": "NO"
},
{
"input": "-4 -8 -6 -1\n1 3",
"output": "NO"
},
{
"input": "0 8 6 2\n1 1",
"output": "YES"
},
{
"input": "-5 -2 -8 -2\n1 1",
"output": "NO"
},
{
"input": "1 4 -5 0\n1 1",
"output": "YES"
},
{
"input": "8 -4 4 -7\n1 2",
"output": "NO"
},
{
"input": "5 2 2 4\n2 2",
"output": "NO"
},
{
"input": "2 0 -4 6\n1 2",
"output": "NO"
},
{
"input": "-2 6 -5 -4\n1 2",
"output": "YES"
},
{
"input": "-6 5 10 6\n2 4",
"output": "NO"
},
{
"input": "3 -7 1 -8\n1 2",
"output": "NO"
},
{
"input": "4 1 4 -4\n9 4",
"output": "NO"
},
{
"input": "9 -3 -9 -3\n2 2",
"output": "NO"
},
{
"input": "-6 -6 -10 -5\n6 7",
"output": "NO"
},
{
"input": "-5 -2 2 2\n1 7",
"output": "NO"
},
{
"input": "9 0 8 1\n7 10",
"output": "NO"
},
{
"input": "-1 6 -7 -6\n6 4",
"output": "YES"
},
{
"input": "2 2 -3 -3\n3 1",
"output": "NO"
},
{
"input": "2 -6 7 2\n2 1",
"output": "NO"
},
{
"input": "-6 2 -7 -7\n1 2",
"output": "NO"
},
{
"input": "-5 -5 -1 -5\n2 2",
"output": "YES"
},
{
"input": "0 5 3 -6\n2 2",
"output": "NO"
},
{
"input": "0 -6 2 -1\n1 1",
"output": "NO"
},
{
"input": "-6 6 -5 -4\n1 2",
"output": "YES"
},
{
"input": "7 -7 1 -7\n2 2",
"output": "NO"
},
{
"input": "99966 -99952 -99966 99923\n1 1",
"output": "NO"
},
{
"input": "99921 99980 -99956 -99907\n3 4",
"output": "NO"
},
{
"input": "100000 100000 -100000 -100000\n1 1",
"output": "YES"
},
{
"input": "1 0 2 0\n5 1",
"output": "NO"
},
{
"input": "-3 0 -8 0\n7 2",
"output": "NO"
},
{
"input": "-9 4 -5 -1\n8 2",
"output": "NO"
},
{
"input": "-99999 -100000 100000 100000\n1 1",
"output": "NO"
},
{
"input": "0 0 -100 -100\n2 2",
"output": "YES"
},
{
"input": "9 -5 -3 -2\n1 4",
"output": "NO"
},
{
"input": "1 -10 -10 5\n7 5",
"output": "NO"
},
{
"input": "6 -9 -1 -9\n1 9",
"output": "NO"
}
] | 1,619,680,442
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 61
| 109
| 307,200
|
import sys
input=sys.stdin.readline
from collections import defaultdict as dc
from collections import Counter
from bisect import bisect_right, bisect_left,bisect
import math
from operator import itemgetter
from heapq import heapify, heappop, heappush
x1,y1,x2,y2=map(int,input().split())
x,y=map(int,input().split())
if abs(x2-x1)%x==0 and abs(y2-y1)%y==0 and (abs(x2-x1)//x)%2==(abs(y2-y1)//y)%2:
print("YES")
else:
print("NO")
|
Title: Treasure Hunt
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Captain Bill the Hummingbird and his crew recieved an interesting challenge offer. Some stranger gave them a map, potion of teleportation and said that only this potion might help them to reach the treasure.
Bottle with potion has two values *x* and *y* written on it. These values define four moves which can be performed using the potion:
- - - -
Map shows that the position of Captain Bill the Hummingbird is (*x*1,<=*y*1) and the position of the treasure is (*x*2,<=*y*2).
You task is to tell Captain Bill the Hummingbird whether he should accept this challenge or decline. If it is possible for Captain to reach the treasure using the potion then output "YES", otherwise "NO" (without quotes).
The potion can be used infinite amount of times.
Input Specification:
The first line contains four integer numbers *x*1,<=*y*1,<=*x*2,<=*y*2 (<=-<=105<=≤<=*x*1,<=*y*1,<=*x*2,<=*y*2<=≤<=105) — positions of Captain Bill the Hummingbird and treasure respectively.
The second line contains two integer numbers *x*,<=*y* (1<=≤<=*x*,<=*y*<=≤<=105) — values on the potion bottle.
Output Specification:
Print "YES" if it is possible for Captain to reach the treasure using the potion, otherwise print "NO" (without quotes).
Demo Input:
['0 0 0 6\n2 3\n', '1 1 3 6\n1 5\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first example there exists such sequence of moves:
1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7c939890fb4ed35688177327dac981bfa9216c00.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the first type of move 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/afbfa42fbac4e0641e7466e3aac74cbbb08ed597.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the third type of move
|
```python
import sys
input=sys.stdin.readline
from collections import defaultdict as dc
from collections import Counter
from bisect import bisect_right, bisect_left,bisect
import math
from operator import itemgetter
from heapq import heapify, heappop, heappush
x1,y1,x2,y2=map(int,input().split())
x,y=map(int,input().split())
if abs(x2-x1)%x==0 and abs(y2-y1)%y==0 and (abs(x2-x1)//x)%2==(abs(y2-y1)//y)%2:
print("YES")
else:
print("NO")
```
| 3
|
|
965
|
A
|
Paper Airplanes
|
PROGRAMMING
| 800
|
[
"math"
] | null | null |
To make a paper airplane, one has to use a rectangular piece of paper. From a sheet of standard size you can make $s$ airplanes.
A group of $k$ people decided to make $n$ airplanes each. They are going to buy several packs of paper, each of them containing $p$ sheets, and then distribute the sheets between the people. Each person should have enough sheets to make $n$ airplanes. How many packs should they buy?
|
The only line contains four integers $k$, $n$, $s$, $p$ ($1 \le k, n, s, p \le 10^4$) — the number of people, the number of airplanes each should make, the number of airplanes that can be made using one sheet and the number of sheets in one pack, respectively.
|
Print a single integer — the minimum number of packs they should buy.
|
[
"5 3 2 3\n",
"5 3 100 1\n"
] |
[
"4\n",
"5\n"
] |
In the first sample they have to buy $4$ packs of paper: there will be $12$ sheets in total, and giving $2$ sheets to each person is enough to suit everyone's needs.
In the second sample they have to buy a pack for each person as they can't share sheets.
| 500
|
[
{
"input": "5 3 2 3",
"output": "4"
},
{
"input": "5 3 100 1",
"output": "5"
},
{
"input": "10000 10000 1 1",
"output": "100000000"
},
{
"input": "1 1 10000 10000",
"output": "1"
},
{
"input": "300 300 21 23",
"output": "196"
},
{
"input": "300 2 37 51",
"output": "6"
},
{
"input": "2 400 23 57",
"output": "1"
},
{
"input": "1 1 1 1",
"output": "1"
},
{
"input": "10000 10000 3 2",
"output": "16670000"
},
{
"input": "1 2 1 2",
"output": "1"
},
{
"input": "1 1 2 2",
"output": "1"
},
{
"input": "1 1 10 10",
"output": "1"
},
{
"input": "5324 5439 32 13",
"output": "69622"
},
{
"input": "9000 1 2432 1",
"output": "9000"
},
{
"input": "230 1234 9124 23",
"output": "10"
},
{
"input": "11 1 1 1",
"output": "11"
},
{
"input": "6246 8489 1227 9",
"output": "4858"
},
{
"input": "9 20 5 7",
"output": "6"
}
] | 1,579,525,880
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 18
| 109
| 0
|
import math
a = [int(x) for x in input().split()]
x = math.ceil(a[1]/a[2])
y = math.ceil((x*a[0])/a[3])
print(int(y))
|
Title: Paper Airplanes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
To make a paper airplane, one has to use a rectangular piece of paper. From a sheet of standard size you can make $s$ airplanes.
A group of $k$ people decided to make $n$ airplanes each. They are going to buy several packs of paper, each of them containing $p$ sheets, and then distribute the sheets between the people. Each person should have enough sheets to make $n$ airplanes. How many packs should they buy?
Input Specification:
The only line contains four integers $k$, $n$, $s$, $p$ ($1 \le k, n, s, p \le 10^4$) — the number of people, the number of airplanes each should make, the number of airplanes that can be made using one sheet and the number of sheets in one pack, respectively.
Output Specification:
Print a single integer — the minimum number of packs they should buy.
Demo Input:
['5 3 2 3\n', '5 3 100 1\n']
Demo Output:
['4\n', '5\n']
Note:
In the first sample they have to buy $4$ packs of paper: there will be $12$ sheets in total, and giving $2$ sheets to each person is enough to suit everyone's needs.
In the second sample they have to buy a pack for each person as they can't share sheets.
|
```python
import math
a = [int(x) for x in input().split()]
x = math.ceil(a[1]/a[2])
y = math.ceil((x*a[0])/a[3])
print(int(y))
```
| 3
|
|
551
|
A
|
GukiZ and Contest
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"sortings"
] | null | null |
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest.
In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings.
He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position.
GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students.
The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
|
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
|
[
"3\n1 3 3\n",
"1\n1\n",
"5\n3 5 3 4 5\n"
] |
[
"3 1 1\n",
"1\n",
"4 1 4 3 1\n"
] |
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating.
In the second sample, first student is the only one on the contest.
In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
| 500
|
[
{
"input": "3\n1 3 3",
"output": "3 1 1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "5\n3 5 3 4 5",
"output": "4 1 4 3 1"
},
{
"input": "7\n1 3 5 4 2 2 1",
"output": "6 3 1 2 4 4 6"
},
{
"input": "11\n5 6 4 2 9 7 6 6 6 6 7",
"output": "9 4 10 11 1 2 4 4 4 4 2"
},
{
"input": "1\n2000",
"output": "1"
},
{
"input": "2\n2000 2000",
"output": "1 1"
},
{
"input": "3\n500 501 502",
"output": "3 2 1"
},
{
"input": "10\n105 106 1 1 1 11 1000 999 1000 999",
"output": "6 5 8 8 8 7 1 3 1 3"
},
{
"input": "6\n1 2 3 4 5 6",
"output": "6 5 4 3 2 1"
},
{
"input": "7\n6 5 4 3 2 1 1",
"output": "1 2 3 4 5 6 6"
},
{
"input": "8\n153 100 87 14 10 8 6 5",
"output": "1 2 3 4 5 6 7 8"
},
{
"input": "70\n11 54 37 62 1 46 13 17 38 47 28 15 63 5 61 34 49 66 32 59 3 41 58 28 23 62 41 64 20 5 14 41 10 37 51 32 65 46 61 8 15 19 16 44 31 42 19 46 66 25 26 58 60 5 19 18 69 53 20 40 45 27 24 41 32 23 57 56 62 10",
"output": "62 18 35 7 70 23 61 56 34 22 42 58 6 66 10 37 21 2 38 13 69 29 14 42 48 7 29 5 50 66 60 29 63 35 20 38 4 23 10 65 58 52 57 27 41 28 52 23 2 46 45 14 12 66 52 55 1 19 50 33 26 44 47 29 38 48 16 17 7 63"
},
{
"input": "5\n1 2000 1 1 2000",
"output": "3 1 3 3 1"
}
] | 1,596,255,464
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 124
| 6,963,200
|
n=int(input())
l=list(map(int,input().split()))
s=sorted(l)
s=s[::-1]
for i in range(n):
l[i]=s.index(l[i])+1
print(*l)
|
Title: GukiZ and Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest.
In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings.
He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position.
GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students.
The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
Output Specification:
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
Demo Input:
['3\n1 3 3\n', '1\n1\n', '5\n3 5 3 4 5\n']
Demo Output:
['3 1 1\n', '1\n', '4 1 4 3 1\n']
Note:
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating.
In the second sample, first student is the only one on the contest.
In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
|
```python
n=int(input())
l=list(map(int,input().split()))
s=sorted(l)
s=s[::-1]
for i in range(n):
l[i]=s.index(l[i])+1
print(*l)
```
| 3
|
|
43
|
A
|
Football
|
PROGRAMMING
| 1,000
|
[
"strings"
] |
A. Football
|
2
|
256
|
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
|
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
|
[
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] |
[
"ABC\n",
"A\n"
] |
none
| 500
|
[
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,472,400,769
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 124
| 0
|
sl = []
for i in range(int(input())):
sl+=[input()]
ans = []
for s in set(sl):
ans+=[[sl.count(s), s]]
ans.sort(reverse=True)
print(ans[0][1])
|
Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none
|
```python
sl = []
for i in range(int(input())):
sl+=[input()]
ans = []
for s in set(sl):
ans+=[[sl.count(s), s]]
ans.sort(reverse=True)
print(ans[0][1])
```
| 3.969
|
805
|
B
|
3-palindrome
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms"
] | null | null |
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string.
|
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
|
[
"2\n",
"3\n"
] |
[
"aa\n",
"bba\n"
] |
A palindrome is a sequence of characters which reads the same backward and forward.
| 1,000
|
[
{
"input": "2",
"output": "aa"
},
{
"input": "3",
"output": "aab"
},
{
"input": "38",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "47",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "59",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "67",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "77",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "89",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "98",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "109",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "117",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "1",
"output": "a"
},
{
"input": "200000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "100000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "143670",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "104217",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "17879",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "131809",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "140873",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "77859",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "153022",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "179227",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "182801",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "5188",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "86539",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "12802",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "120289",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "132866",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "133377",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "31775",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "160397",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "161415",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "163623",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "22942",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "134767",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "52257",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "64905",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "183758",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "60131",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "146883",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "6",
"output": "aabbaa"
},
{
"input": "4",
"output": "aabb"
}
] | 1,636,961,316
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 42
| 92
| 1,024,000
|
s, n = "aabb", int(input())
print(s * ((n >> 1) >> 1) + s[0:n % 4])
|
Title: 3-palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string.
Output Specification:
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
Demo Input:
['2\n', '3\n']
Demo Output:
['aa\n', 'bba\n']
Note:
A palindrome is a sequence of characters which reads the same backward and forward.
|
```python
s, n = "aabb", int(input())
print(s * ((n >> 1) >> 1) + s[0:n % 4])
```
| 3
|
|
854
|
A
|
Fraction
|
PROGRAMMING
| 800
|
[
"brute force",
"constructive algorithms",
"math"
] | null | null |
Petya is a big fan of mathematics, especially its part related to fractions. Recently he learned that a fraction is called proper iff its numerator is smaller than its denominator (*a*<=<<=*b*) and that the fraction is called irreducible if its numerator and its denominator are coprime (they do not have positive common divisors except 1).
During his free time, Petya thinks about proper irreducible fractions and converts them to decimals using the calculator. One day he mistakenly pressed addition button (<=+<=) instead of division button (÷) and got sum of numerator and denominator that was equal to *n* instead of the expected decimal notation.
Petya wanted to restore the original fraction, but soon he realized that it might not be done uniquely. That's why he decided to determine maximum possible proper irreducible fraction such that sum of its numerator and denominator equals *n*. Help Petya deal with this problem.
|
In the only line of input there is an integer *n* (3<=≤<=*n*<=≤<=1000), the sum of numerator and denominator of the fraction.
|
Output two space-separated positive integers *a* and *b*, numerator and denominator of the maximum possible proper irreducible fraction satisfying the given sum.
|
[
"3\n",
"4\n",
"12\n"
] |
[
"1 2\n",
"1 3\n",
"5 7\n"
] |
none
| 500
|
[
{
"input": "3",
"output": "1 2"
},
{
"input": "4",
"output": "1 3"
},
{
"input": "12",
"output": "5 7"
},
{
"input": "34",
"output": "15 19"
},
{
"input": "13",
"output": "6 7"
},
{
"input": "11",
"output": "5 6"
},
{
"input": "24",
"output": "11 13"
},
{
"input": "17",
"output": "8 9"
},
{
"input": "10",
"output": "3 7"
},
{
"input": "69",
"output": "34 35"
},
{
"input": "100",
"output": "49 51"
},
{
"input": "57",
"output": "28 29"
},
{
"input": "1000",
"output": "499 501"
},
{
"input": "999",
"output": "499 500"
},
{
"input": "998",
"output": "497 501"
},
{
"input": "997",
"output": "498 499"
},
{
"input": "996",
"output": "497 499"
},
{
"input": "995",
"output": "497 498"
},
{
"input": "994",
"output": "495 499"
},
{
"input": "5",
"output": "2 3"
},
{
"input": "6",
"output": "1 5"
},
{
"input": "8",
"output": "3 5"
},
{
"input": "9",
"output": "4 5"
},
{
"input": "423",
"output": "211 212"
},
{
"input": "876",
"output": "437 439"
},
{
"input": "29",
"output": "14 15"
}
] | 1,535,949,784
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 26
| 202
| 1,126,400
|
from fractions import gcd
sum = input()
sum = int(sum)
div = sum/2
i = 1
gcdFlag = True
a = 0
b = 0
while gcdFlag:
a = int(div-i)
b = int(div+i)
if (sum%2!=0) :
a += 1
if(gcd(a,b)<=1):
gcdFlag = False
else:
i += 1
print(a," ",b)
|
Title: Fraction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya is a big fan of mathematics, especially its part related to fractions. Recently he learned that a fraction is called proper iff its numerator is smaller than its denominator (*a*<=<<=*b*) and that the fraction is called irreducible if its numerator and its denominator are coprime (they do not have positive common divisors except 1).
During his free time, Petya thinks about proper irreducible fractions and converts them to decimals using the calculator. One day he mistakenly pressed addition button (<=+<=) instead of division button (÷) and got sum of numerator and denominator that was equal to *n* instead of the expected decimal notation.
Petya wanted to restore the original fraction, but soon he realized that it might not be done uniquely. That's why he decided to determine maximum possible proper irreducible fraction such that sum of its numerator and denominator equals *n*. Help Petya deal with this problem.
Input Specification:
In the only line of input there is an integer *n* (3<=≤<=*n*<=≤<=1000), the sum of numerator and denominator of the fraction.
Output Specification:
Output two space-separated positive integers *a* and *b*, numerator and denominator of the maximum possible proper irreducible fraction satisfying the given sum.
Demo Input:
['3\n', '4\n', '12\n']
Demo Output:
['1 2\n', '1 3\n', '5 7\n']
Note:
none
|
```python
from fractions import gcd
sum = input()
sum = int(sum)
div = sum/2
i = 1
gcdFlag = True
a = 0
b = 0
while gcdFlag:
a = int(div-i)
b = int(div+i)
if (sum%2!=0) :
a += 1
if(gcd(a,b)<=1):
gcdFlag = False
else:
i += 1
print(a," ",b)
```
| 3
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.