contestId
int64
0
1.01k
index
stringclasses
40 values
name
stringlengths
2
54
type
stringclasses
2 values
rating
int64
0
3.4k
tags
listlengths
0
7
title
stringclasses
393 values
time-limit
stringclasses
7 values
memory-limit
stringclasses
6 values
problem-description
stringlengths
0
2.97k
input-specification
stringlengths
4
1.87k
output-specification
stringlengths
4
1.12k
demo-input
listlengths
0
7
demo-output
listlengths
0
7
note
stringlengths
0
5.24k
points
float64
0
3.5k
test_cases
listlengths
0
402
creationTimeSeconds
int64
1.37B
1.7B
relativeTimeSeconds
int64
8
2.15B
programmingLanguage
stringclasses
3 values
verdict
stringclasses
1 value
testset
stringclasses
9 values
passedTestCount
int64
1
402
timeConsumedMillis
int64
15
8.06k
memoryConsumedBytes
int64
0
514M
code
stringlengths
11
61.4k
prompt
stringlengths
297
7.35k
response
stringlengths
25
61.4k
score
float64
2.82
3.99
9
A
Die Roll
PROGRAMMING
800
[ "math", "probabilities" ]
A. Die Roll
1
64
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place. But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams. Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania. It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
[ "4 2\n" ]
[ "1/2\n" ]
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
0
[ { "input": "4 2", "output": "1/2" }, { "input": "1 1", "output": "1/1" }, { "input": "1 2", "output": "5/6" }, { "input": "1 3", "output": "2/3" }, { "input": "1 4", "output": "1/2" }, { "input": "1 5", "output": "1/3" }, { "input": "1 6", "output": "1/6" }, { "input": "2 1", "output": "5/6" }, { "input": "2 2", "output": "5/6" }, { "input": "2 3", "output": "2/3" }, { "input": "2 4", "output": "1/2" }, { "input": "2 5", "output": "1/3" }, { "input": "2 6", "output": "1/6" }, { "input": "3 1", "output": "2/3" }, { "input": "3 2", "output": "2/3" }, { "input": "3 3", "output": "2/3" }, { "input": "3 4", "output": "1/2" }, { "input": "3 5", "output": "1/3" }, { "input": "3 6", "output": "1/6" }, { "input": "4 1", "output": "1/2" }, { "input": "4 3", "output": "1/2" }, { "input": "4 4", "output": "1/2" }, { "input": "4 5", "output": "1/3" }, { "input": "4 6", "output": "1/6" }, { "input": "5 1", "output": "1/3" }, { "input": "5 2", "output": "1/3" }, { "input": "5 3", "output": "1/3" }, { "input": "5 4", "output": "1/3" }, { "input": "5 5", "output": "1/3" }, { "input": "5 6", "output": "1/6" }, { "input": "6 1", "output": "1/6" }, { "input": "6 2", "output": "1/6" }, { "input": "6 3", "output": "1/6" }, { "input": "6 4", "output": "1/6" }, { "input": "6 5", "output": "1/6" }, { "input": "6 6", "output": "1/6" } ]
1,685,754,658
2,147,483,647
Python 3
OK
TESTS
36
92
0
import sys # sys.stdin = open("1.in", "r") Y, W = map(int, input().split()) win_num = 6 - max(Y, W) + 1 if win_num == 6: print("1/1") elif win_num == 2: print("1/3") elif win_num == 3: print("1/2") elif win_num == 4: print("2/3") else: print(str(win_num) + "/6")
Title: Die Roll Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place. But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams. Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania. It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win. Input Specification: The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls. Output Specification: Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1». Demo Input: ['4 2\n'] Demo Output: ['1/2\n'] Note: Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
```python import sys # sys.stdin = open("1.in", "r") Y, W = map(int, input().split()) win_num = 6 - max(Y, W) + 1 if win_num == 6: print("1/1") elif win_num == 2: print("1/3") elif win_num == 3: print("1/2") elif win_num == 4: print("2/3") else: print(str(win_num) + "/6") ```
3.954
378
A
Playing with Dice
PROGRAMMING
800
[ "brute force" ]
null
null
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw. The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
[ "2 5\n", "2 4\n" ]
[ "3 0 3\n", "2 1 3\n" ]
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct. You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| &lt; |*b* - *x*|.
500
[ { "input": "2 5", "output": "3 0 3" }, { "input": "2 4", "output": "2 1 3" }, { "input": "5 3", "output": "2 1 3" }, { "input": "1 6", "output": "3 0 3" }, { "input": "5 1", "output": "3 1 2" }, { "input": "6 3", "output": "2 0 4" }, { "input": "2 3", "output": "2 0 4" }, { "input": "5 6", "output": "5 0 1" }, { "input": "4 4", "output": "0 6 0" }, { "input": "1 1", "output": "0 6 0" }, { "input": "6 4", "output": "1 1 4" }, { "input": "1 4", "output": "2 0 4" }, { "input": "5 5", "output": "0 6 0" }, { "input": "4 5", "output": "4 0 2" }, { "input": "4 3", "output": "3 0 3" }, { "input": "1 5", "output": "2 1 3" }, { "input": "6 5", "output": "1 0 5" }, { "input": "2 2", "output": "0 6 0" }, { "input": "1 3", "output": "1 1 4" }, { "input": "3 6", "output": "4 0 2" }, { "input": "3 1", "output": "4 1 1" }, { "input": "3 2", "output": "4 0 2" }, { "input": "3 5", "output": "3 1 2" }, { "input": "3 3", "output": "0 6 0" }, { "input": "6 2", "output": "2 1 3" }, { "input": "4 1", "output": "4 0 2" }, { "input": "5 2", "output": "3 0 3" }, { "input": "4 2", "output": "3 1 2" }, { "input": "2 1", "output": "5 0 1" }, { "input": "6 1", "output": "3 0 3" }, { "input": "4 6", "output": "4 1 1" }, { "input": "2 6", "output": "3 1 2" }, { "input": "3 4", "output": "3 0 3" }, { "input": "1 2", "output": "1 0 5" }, { "input": "6 6", "output": "0 6 0" }, { "input": "5 4", "output": "2 0 4" }, { "input": "3 3", "output": "0 6 0" }, { "input": "1 1", "output": "0 6 0" } ]
1,675,675,188
2,147,483,647
PyPy 3-64
OK
TESTS
38
62
0
m = input().split() count1=0 count2=0 k=0 a = int(m[0]) b = int(m[1]) for x in range(1,7): if abs(a-x) < abs(b-x): count1+=1 elif abs(a-x) > abs(b-x): count2+=1 elif abs(a-x) == abs(b-x): k += 1 print(count1,k,count2)
Title: Playing with Dice Time Limit: None seconds Memory Limit: None megabytes Problem Description: Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw. The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins? Input Specification: The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly. Output Specification: Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly. Demo Input: ['2 5\n', '2 4\n'] Demo Output: ['3 0 3\n', '2 1 3\n'] Note: The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct. You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| &lt; |*b* - *x*|.
```python m = input().split() count1=0 count2=0 k=0 a = int(m[0]) b = int(m[1]) for x in range(1,7): if abs(a-x) < abs(b-x): count1+=1 elif abs(a-x) > abs(b-x): count2+=1 elif abs(a-x) == abs(b-x): k += 1 print(count1,k,count2) ```
3
38
A
Army
PROGRAMMING
800
[ "implementation" ]
A. Army
2
256
The Berland Armed Forces System consists of *n* ranks that are numbered using natural numbers from 1 to *n*, where 1 is the lowest rank and *n* is the highest rank. One needs exactly *d**i* years to rise from rank *i* to rank *i*<=+<=1. Reaching a certain rank *i* having not reached all the previous *i*<=-<=1 ranks is impossible. Vasya has just reached a new rank of *a*, but he dreams of holding the rank of *b*. Find for how many more years Vasya should serve in the army until he can finally realize his dream.
The first input line contains an integer *n* (2<=≤<=*n*<=≤<=100). The second line contains *n*<=-<=1 integers *d**i* (1<=≤<=*d**i*<=≤<=100). The third input line contains two integers *a* and *b* (1<=≤<=*a*<=&lt;<=*b*<=≤<=*n*). The numbers on the lines are space-separated.
Print the single number which is the number of years that Vasya needs to rise from rank *a* to rank *b*.
[ "3\n5 6\n1 2\n", "3\n5 6\n1 3\n" ]
[ "5\n", "11\n" ]
none
0
[ { "input": "3\n5 6\n1 2", "output": "5" }, { "input": "3\n5 6\n1 3", "output": "11" }, { "input": "2\n55\n1 2", "output": "55" }, { "input": "3\n85 78\n1 3", "output": "163" }, { "input": "4\n63 4 49\n2 3", "output": "4" }, { "input": "5\n93 83 42 56\n2 5", "output": "181" }, { "input": "6\n22 9 87 89 57\n1 6", "output": "264" }, { "input": "7\n52 36 31 23 74 78\n2 7", "output": "242" }, { "input": "8\n82 14 24 5 91 49 94\n3 8", "output": "263" }, { "input": "9\n12 40 69 39 59 21 59 5\n4 6", "output": "98" }, { "input": "10\n95 81 32 59 71 30 50 61 100\n1 6", "output": "338" }, { "input": "15\n89 55 94 4 15 69 19 60 91 77 3 94 91 62\n3 14", "output": "617" }, { "input": "20\n91 1 41 51 95 67 92 35 23 70 44 91 57 50 21 8 9 71 40\n8 17", "output": "399" }, { "input": "25\n70 95 21 84 97 39 12 98 53 24 78 29 84 65 70 22 100 17 69 27 62 48 35 80\n8 23", "output": "846" }, { "input": "30\n35 69 50 44 19 56 86 56 98 24 21 2 61 24 85 30 2 22 57 35 59 84 12 77 92 53 50 92 9\n1 16", "output": "730" }, { "input": "35\n2 34 47 15 27 61 6 88 67 20 53 65 29 68 77 5 78 86 44 98 32 81 91 79 54 84 95 23 65 97 22 33 42 87\n8 35", "output": "1663" }, { "input": "40\n32 88 59 36 95 45 28 78 73 30 97 13 13 47 48 100 43 21 22 45 88 25 15 13 63 25 72 92 29 5 25 11 50 5 54 51 48 84 23\n7 26", "output": "862" }, { "input": "45\n83 74 73 95 10 31 100 26 29 15 80 100 22 70 31 88 9 56 19 70 2 62 48 30 27 47 52 50 94 44 21 94 23 85 15 3 95 72 43 62 94 89 68 88\n17 40", "output": "1061" }, { "input": "50\n28 8 16 29 19 82 70 51 96 84 74 72 17 69 12 21 37 21 39 3 18 66 19 49 86 96 94 93 2 90 96 84 59 88 58 15 61 33 55 22 35 54 51 29 64 68 29 38 40\n23 28", "output": "344" }, { "input": "60\n24 28 25 21 43 71 64 73 71 90 51 83 69 43 75 43 78 72 56 61 99 7 23 86 9 16 16 94 23 74 18 56 20 72 13 31 75 34 35 86 61 49 4 72 84 7 65 70 66 52 21 38 6 43 69 40 73 46 5\n28 60", "output": "1502" }, { "input": "70\n69 95 34 14 67 61 6 95 94 44 28 94 73 66 39 13 19 71 73 71 28 48 26 22 32 88 38 95 43 59 88 77 80 55 17 95 40 83 67 1 38 95 58 63 56 98 49 2 41 4 73 8 78 41 64 71 60 71 41 61 67 4 4 19 97 14 39 20 27\n9 41", "output": "1767" }, { "input": "80\n65 15 43 6 43 98 100 16 69 98 4 54 25 40 2 35 12 23 38 29 10 89 30 6 4 8 7 96 64 43 11 49 89 38 20 59 54 85 46 16 16 89 60 54 28 37 32 34 67 9 78 30 50 87 58 53 99 48 77 3 5 6 19 99 16 20 31 10 80 76 82 56 56 83 72 81 84 60 28\n18 24", "output": "219" }, { "input": "90\n61 35 100 99 67 87 42 90 44 4 81 65 29 63 66 56 53 22 55 87 39 30 34 42 27 80 29 97 85 28 81 22 50 22 24 75 67 86 78 79 94 35 13 97 48 76 68 66 94 13 82 1 22 85 5 36 86 73 65 97 43 56 35 26 87 25 74 47 81 67 73 75 99 75 53 38 70 21 66 78 38 17 57 40 93 57 68 55 1\n12 44", "output": "1713" }, { "input": "95\n37 74 53 96 65 84 65 72 95 45 6 77 91 35 58 50 51 51 97 30 51 20 79 81 92 10 89 34 40 76 71 54 26 34 73 72 72 28 53 19 95 64 97 10 44 15 12 38 5 63 96 95 86 8 36 96 45 53 81 5 18 18 47 97 65 9 33 53 41 86 37 53 5 40 15 76 83 45 33 18 26 5 19 90 46 40 100 42 10 90 13 81 40 53\n6 15", "output": "570" }, { "input": "96\n51 32 95 75 23 54 70 89 67 3 1 51 4 100 97 30 9 35 56 38 54 77 56 98 43 17 60 43 72 46 87 61 100 65 81 22 74 38 16 96 5 10 54 22 23 22 10 91 9 54 49 82 29 73 33 98 75 8 4 26 24 90 71 42 90 24 94 74 94 10 41 98 56 63 18 43 56 21 26 64 74 33 22 38 67 66 38 60 64 76 53 10 4 65 76\n21 26", "output": "328" }, { "input": "97\n18 90 84 7 33 24 75 55 86 10 96 72 16 64 37 9 19 71 62 97 5 34 85 15 46 72 82 51 52 16 55 68 27 97 42 72 76 97 32 73 14 56 11 86 2 81 59 95 60 93 1 22 71 37 77 100 6 16 78 47 78 62 94 86 16 91 56 46 47 35 93 44 7 86 70 10 29 45 67 62 71 61 74 39 36 92 24 26 65 14 93 92 15 28 79 59\n6 68", "output": "3385" }, { "input": "98\n32 47 26 86 43 42 79 72 6 68 40 46 29 80 24 89 29 7 21 56 8 92 13 33 50 79 5 7 84 85 24 23 1 80 51 21 26 55 96 51 24 2 68 98 81 88 57 100 64 84 54 10 14 2 74 1 89 71 1 20 84 85 17 31 42 58 69 67 48 60 97 90 58 10 21 29 2 21 60 61 68 89 77 39 57 18 61 44 67 100 33 74 27 40 83 29 6\n8 77", "output": "3319" }, { "input": "99\n46 5 16 66 53 12 84 89 26 27 35 68 41 44 63 17 88 43 80 15 59 1 42 50 53 34 75 16 16 55 92 30 28 11 12 71 27 65 11 28 86 47 24 10 60 47 7 53 16 75 6 49 56 66 70 3 20 78 75 41 38 57 89 23 16 74 30 39 1 32 49 84 9 33 25 95 75 45 54 59 17 17 29 40 79 96 47 11 69 86 73 56 91 4 87 47 31 24\n23 36", "output": "514" }, { "input": "100\n63 65 21 41 95 23 3 4 12 23 95 50 75 63 58 34 71 27 75 31 23 94 96 74 69 34 43 25 25 55 44 19 43 86 68 17 52 65 36 29 72 96 84 25 84 23 71 54 6 7 71 7 21 100 99 58 93 35 62 47 36 70 68 9 75 13 35 70 76 36 62 22 52 51 2 87 66 41 54 35 78 62 30 35 65 44 74 93 78 37 96 70 26 32 71 27 85 85 63\n43 92", "output": "2599" }, { "input": "51\n85 38 22 38 42 36 55 24 36 80 49 15 66 91 88 61 46 82 1 61 89 92 6 56 28 8 46 80 56 90 91 38 38 17 69 64 57 68 13 44 45 38 8 72 61 39 87 2 73 88\n15 27", "output": "618" }, { "input": "2\n3\n1 2", "output": "3" }, { "input": "5\n6 8 22 22\n2 3", "output": "8" }, { "input": "6\n3 12 27 28 28\n3 4", "output": "27" }, { "input": "9\n1 2 2 2 2 3 3 5\n3 7", "output": "9" }, { "input": "10\n1 1 1 1 1 1 1 1 1\n6 8", "output": "2" }, { "input": "20\n1 1 1 1 1 1 1 1 2 2 2 2 2 3 3 3 3 3 3\n5 17", "output": "23" }, { "input": "25\n1 1 1 4 5 6 8 11 11 11 11 12 13 14 14 14 15 16 16 17 17 17 19 19\n4 8", "output": "23" }, { "input": "35\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2\n30 31", "output": "2" }, { "input": "45\n1 1 1 1 2 2 2 2 2 2 2 3 3 3 3 3 3 4 5 5 5 5 6 6 6 6 6 6 6 7 7 7 7 8 8 8 9 9 9 9 9 10 10 10\n42 45", "output": "30" }, { "input": "50\n1 8 8 13 14 15 15 16 19 21 22 24 26 31 32 37 45 47 47 47 50 50 51 54 55 56 58 61 61 61 63 63 64 66 66 67 67 70 71 80 83 84 85 92 92 94 95 95 100\n4 17", "output": "285" }, { "input": "60\n1 2 4 4 4 6 6 8 9 10 10 13 14 18 20 20 21 22 23 23 26 29 30 32 33 34 35 38 40 42 44 44 46 48 52 54 56 56 60 60 66 67 68 68 69 73 73 74 80 80 81 81 82 84 86 86 87 89 89\n56 58", "output": "173" }, { "input": "70\n1 2 3 3 4 5 5 7 7 7 8 8 8 8 9 9 10 12 12 12 12 13 16 16 16 16 16 16 17 17 18 18 20 20 21 23 24 25 25 26 29 29 29 29 31 32 32 34 35 36 36 37 37 38 39 39 40 40 40 40 41 41 42 43 44 44 44 45 45\n62 65", "output": "126" }, { "input": "80\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 4 4 4 4 5 5 5 5 5 5 5 6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 12 12\n17 65", "output": "326" }, { "input": "90\n1 1 3 5 8 9 10 11 11 11 11 12 13 14 15 15 15 16 16 19 19 20 22 23 24 25 25 28 29 29 30 31 33 34 35 37 37 38 41 43 43 44 45 47 51 54 55 56 58 58 59 59 60 62 66 67 67 67 68 68 69 70 71 72 73 73 76 77 77 78 78 78 79 79 79 82 83 84 85 85 87 87 89 93 93 93 95 99 99\n28 48", "output": "784" }, { "input": "95\n2 2 3 3 4 6 6 7 7 7 9 10 12 12 12 12 13 14 15 16 17 18 20 20 20 20 21 21 21 21 22 22 22 22 22 23 23 23 25 26 26 27 27 27 28 29 29 30 30 31 32 33 34 36 37 37 38 39 39 39 42 43 43 43 45 47 48 50 50 51 52 53 54 54 54 55 55 55 58 59 60 61 61 61 61 62 62 63 64 65 66 67 67 67\n64 93", "output": "1636" }, { "input": "96\n1 1 2 3 3 5 8 9 9 10 10 10 11 11 11 11 11 12 13 13 13 14 15 15 16 16 17 17 17 17 18 18 20 20 20 21 21 21 23 24 24 25 25 26 27 27 27 27 29 29 29 30 30 30 32 32 32 32 32 32 33 33 34 34 34 35 35 35 36 36 37 37 37 38 39 40 41 41 41 41 42 42 43 43 45 45 45 46 46 47 47 49 50 52 52\n76 96", "output": "898" }, { "input": "98\n2 3 4 4 5 7 8 10 10 10 11 11 12 12 12 12 13 14 15 15 16 16 18 19 19 20 21 21 21 21 22 23 24 25 26 26 27 27 27 27 29 29 30 30 31 31 37 40 40 40 41 41 41 42 43 44 44 44 46 46 47 49 49 50 50 50 51 53 55 55 56 56 56 56 56 57 57 58 59 60 60 60 62 62 63 64 64 64 65 66 66 67 68 70 70 71 71\n8 90", "output": "3016" }, { "input": "99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n66 95", "output": "29" }, { "input": "100\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 10 10 10 10 11 11 11 11 12 12 12 13 13 13 13 13 13 13 13 13 13 14 14 14 14 14 14 15 15 15 15 15 15 16 16 16 17 17\n39 52", "output": "82" }, { "input": "51\n5 7 9 16 19 25 26 29 29 30 31 32 32 41 43 44 47 49 50 50 51 52 54 55 56 63 64 66 67 70 74 74 77 78 79 80 80 85 86 87 89 89 90 92 93 94 94 95 95 97\n3 44", "output": "2268" } ]
1,692,737,379
2,147,483,647
PyPy 3-64
OK
TESTS
50
124
0
n = int(input()) k = [int(i) for i in input().split()] a, b = [int(i) for i in input().split()] c = 0 for i in range(a-1, b-1): c += k[i] print(c)
Title: Army Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The Berland Armed Forces System consists of *n* ranks that are numbered using natural numbers from 1 to *n*, where 1 is the lowest rank and *n* is the highest rank. One needs exactly *d**i* years to rise from rank *i* to rank *i*<=+<=1. Reaching a certain rank *i* having not reached all the previous *i*<=-<=1 ranks is impossible. Vasya has just reached a new rank of *a*, but he dreams of holding the rank of *b*. Find for how many more years Vasya should serve in the army until he can finally realize his dream. Input Specification: The first input line contains an integer *n* (2<=≤<=*n*<=≤<=100). The second line contains *n*<=-<=1 integers *d**i* (1<=≤<=*d**i*<=≤<=100). The third input line contains two integers *a* and *b* (1<=≤<=*a*<=&lt;<=*b*<=≤<=*n*). The numbers on the lines are space-separated. Output Specification: Print the single number which is the number of years that Vasya needs to rise from rank *a* to rank *b*. Demo Input: ['3\n5 6\n1 2\n', '3\n5 6\n1 3\n'] Demo Output: ['5\n', '11\n'] Note: none
```python n = int(input()) k = [int(i) for i in input().split()] a, b = [int(i) for i in input().split()] c = 0 for i in range(a-1, b-1): c += k[i] print(c) ```
3.969
181
A
Series of Crimes
PROGRAMMING
800
[ "brute force", "geometry", "implementation" ]
null
null
The Berland capital is shaken with three bold crimes committed by the Pihsters, a notorious criminal gang. The Berland capital's map is represented by an *n*<=×<=*m* rectangular table. Each cell of the table on the map represents some districts of the capital. The capital's main detective Polycarpus took a map and marked there the districts where the first three robberies had been committed as asterisks. Deduction tells Polycarpus that the fourth robbery will be committed in such district, that all four robbed districts will form the vertices of some rectangle, parallel to the sides of the map. Polycarpus is good at deduction but he's hopeless at math. So he asked you to find the district where the fourth robbery will be committed.
The first line contains two space-separated integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of rows and columns in the table, correspondingly. Each of the next *n* lines contains *m* characters — the description of the capital's map. Each character can either be a "." (dot), or an "*" (asterisk). A character equals "*" if the corresponding district has been robbed. Otherwise, it equals ".". It is guaranteed that the map has exactly three characters "*" and we can always find the fourth district that meets the problem requirements.
Print two integers — the number of the row and the number of the column of the city district that is the fourth one to be robbed. The rows are numbered starting from one from top to bottom and the columns are numbered starting from one from left to right.
[ "3 2\n.*\n..\n**\n", "3 3\n*.*\n*..\n...\n" ]
[ "1 1\n", "2 3\n" ]
none
500
[ { "input": "3 2\n.*\n..\n**", "output": "1 1" }, { "input": "2 5\n*....\n*...*", "output": "1 5" }, { "input": "7 2\n..\n**\n..\n..\n..\n..\n.*", "output": "7 1" }, { "input": "7 2\n*.\n..\n..\n..\n..\n..\n**", "output": "1 2" }, { "input": "2 10\n*......*..\n.......*..", "output": "2 1" }, { "input": "10 3\n*..\n...\n...\n...\n...\n...\n...\n...\n...\n**.", "output": "1 2" }, { "input": "100 2\n*.\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n**", "output": "1 2" }, { "input": "99 3\n**.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n*..", "output": "99 2" }, { "input": "98 3\n...\n.*.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n.**", "output": "2 3" }, { "input": "99 3\n**.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n*..", "output": "99 2" }, { "input": "98 3\n...\n.*.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n.**", "output": "2 3" }, { "input": "2 100\n...................................................................................................*\n*..................................................................................................*", "output": "1 1" }, { "input": "2 2\n*.\n**", "output": "1 2" }, { "input": "2 2\n**\n.*", "output": "2 1" }, { "input": "2 3\n*.*\n..*", "output": "2 1" } ]
1,578,238,428
2,147,483,647
PyPy 3
OK
TESTS
36
280
1,331,200
n, m = map(int, input().split()) row, col = 0, 0 for i in range(n): s = input() for j in range(m): if s[j] == '*': row ^= i + 1 col ^= j + 1 print(row, col)
Title: Series of Crimes Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Berland capital is shaken with three bold crimes committed by the Pihsters, a notorious criminal gang. The Berland capital's map is represented by an *n*<=×<=*m* rectangular table. Each cell of the table on the map represents some districts of the capital. The capital's main detective Polycarpus took a map and marked there the districts where the first three robberies had been committed as asterisks. Deduction tells Polycarpus that the fourth robbery will be committed in such district, that all four robbed districts will form the vertices of some rectangle, parallel to the sides of the map. Polycarpus is good at deduction but he's hopeless at math. So he asked you to find the district where the fourth robbery will be committed. Input Specification: The first line contains two space-separated integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of rows and columns in the table, correspondingly. Each of the next *n* lines contains *m* characters — the description of the capital's map. Each character can either be a "." (dot), or an "*" (asterisk). A character equals "*" if the corresponding district has been robbed. Otherwise, it equals ".". It is guaranteed that the map has exactly three characters "*" and we can always find the fourth district that meets the problem requirements. Output Specification: Print two integers — the number of the row and the number of the column of the city district that is the fourth one to be robbed. The rows are numbered starting from one from top to bottom and the columns are numbered starting from one from left to right. Demo Input: ['3 2\n.*\n..\n**\n', '3 3\n*.*\n*..\n...\n'] Demo Output: ['1 1\n', '2 3\n'] Note: none
```python n, m = map(int, input().split()) row, col = 0, 0 for i in range(n): s = input() for j in range(m): if s[j] == '*': row ^= i + 1 col ^= j + 1 print(row, col) ```
3
46
C
Hamsters and Tigers
PROGRAMMING
1,600
[ "two pointers" ]
C. Hamsters and Tigers
2
256
Today there is going to be an unusual performance at the circus — hamsters and tigers will perform together! All of them stand in circle along the arena edge and now the trainer faces a difficult task: he wants to swap the animals' positions so that all the hamsters stood together and all the tigers also stood together. The trainer swaps the animals in pairs not to create a mess. He orders two animals to step out of the circle and swap places. As hamsters feel highly uncomfortable when tigers are nearby as well as tigers get nervous when there's so much potential prey around (consisting not only of hamsters but also of yummier spectators), the trainer wants to spend as little time as possible moving the animals, i.e. he wants to achieve it with the minimal number of swaps. Your task is to help him.
The first line contains number *n* (2<=≤<=*n*<=≤<=1000) which indicates the total number of animals in the arena. The second line contains the description of the animals' positions. The line consists of *n* symbols "H" and "T". The "H"s correspond to hamsters and the "T"s correspond to tigers. It is guaranteed that at least one hamster and one tiger are present on the arena. The animals are given in the order in which they are located circle-wise, in addition, the last animal stands near the first one.
Print the single number which is the minimal number of swaps that let the trainer to achieve his goal.
[ "3\nHTH\n", "9\nHTHTHTHHT\n" ]
[ "0\n", "2\n" ]
In the first example we shouldn't move anybody because the animals of each species already stand apart from the other species. In the second example you may swap, for example, the tiger in position 2 with the hamster in position 5 and then — the tiger in position 9 with the hamster in position 7.
0
[ { "input": "3\nHTH", "output": "0" }, { "input": "9\nHTHTHTHHT", "output": "2" }, { "input": "2\nTH", "output": "0" }, { "input": "4\nHTTH", "output": "0" }, { "input": "4\nHTHT", "output": "1" }, { "input": "7\nTTTHTTT", "output": "0" }, { "input": "8\nHHTHHTHH", "output": "1" }, { "input": "13\nHTTTHHHTTTTHH", "output": "3" }, { "input": "20\nTTHTHTHHTHTTHHTTTHHH", "output": "4" }, { "input": "35\nTTTTTTHTTHTTTTTHTTTTTTTTTTTHTHTTTTT", "output": "3" }, { "input": "120\nTTTTTTTHTHTHTTTTTHTHTTTTHTTTTTTTTTTTTTTTTTTTTHTTHTTTTHTTHTTTTTTTTTTTTTTTHTTTTTTHTHTTHTTTTTTHTTTTTTTTTHTTHTTTTHTTTHTTTTTH", "output": "14" }, { "input": "19\nHHHHHHHHHHHHHTTTHHH", "output": "0" }, { "input": "87\nHTHHTTHHHHTHHHHHTTTHHTHHHHTTTTHHHTTHHTHTHTHHTTHTHHTHTHTTHHHTTTTTHTTHHHHHHTHHTHHTHTTHTHH", "output": "17" }, { "input": "178\nTHHHTHTTTHTTHTTHHHHHTTTHTTHHTHTTTHTHTTTTTHHHTHTHHHTHHHTTTTTTTTHHHHTTHHTHHHHTHTTTHHHHHHTHHTHTTHTHTTTTTTTTTHHTTHHTHTTHHTHHHHHTTHHTTHHTTHHHTTHHTTTTHTHHHTHTTHTHTTTHHHHTHHTHHHTHTTTTTT", "output": "40" } ]
1,454,024,935
2,147,483,647
Python 3
OK
TESTS
27
124
0
n = int(input()) c, v = [0] * (n + 1), 0 for i, ch in enumerate(input()): c[i + 1] = c[i] + (ch == 'H') for i in range(n): if i + c[n] <= n: v = max(v, c[i + c[n]] - c[i]) else: v = max(v, c[n] - c[i] + c[c[n] - (n - i)]) print(c[n] - v)
Title: Hamsters and Tigers Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Today there is going to be an unusual performance at the circus — hamsters and tigers will perform together! All of them stand in circle along the arena edge and now the trainer faces a difficult task: he wants to swap the animals' positions so that all the hamsters stood together and all the tigers also stood together. The trainer swaps the animals in pairs not to create a mess. He orders two animals to step out of the circle and swap places. As hamsters feel highly uncomfortable when tigers are nearby as well as tigers get nervous when there's so much potential prey around (consisting not only of hamsters but also of yummier spectators), the trainer wants to spend as little time as possible moving the animals, i.e. he wants to achieve it with the minimal number of swaps. Your task is to help him. Input Specification: The first line contains number *n* (2<=≤<=*n*<=≤<=1000) which indicates the total number of animals in the arena. The second line contains the description of the animals' positions. The line consists of *n* symbols "H" and "T". The "H"s correspond to hamsters and the "T"s correspond to tigers. It is guaranteed that at least one hamster and one tiger are present on the arena. The animals are given in the order in which they are located circle-wise, in addition, the last animal stands near the first one. Output Specification: Print the single number which is the minimal number of swaps that let the trainer to achieve his goal. Demo Input: ['3\nHTH\n', '9\nHTHTHTHHT\n'] Demo Output: ['0\n', '2\n'] Note: In the first example we shouldn't move anybody because the animals of each species already stand apart from the other species. In the second example you may swap, for example, the tiger in position 2 with the hamster in position 5 and then — the tiger in position 9 with the hamster in position 7.
```python n = int(input()) c, v = [0] * (n + 1), 0 for i, ch in enumerate(input()): c[i + 1] = c[i] + (ch == 'H') for i in range(n): if i + c[n] <= n: v = max(v, c[i + c[n]] - c[i]) else: v = max(v, c[n] - c[i] + c[c[n] - (n - i)]) print(c[n] - v) ```
3.969
451
B
Sort the Array
PROGRAMMING
1,300
[ "implementation", "sortings" ]
null
null
Being a programmer, you like arrays a lot. For your birthday, your friends have given you an array *a* consisting of *n* distinct integers. Unfortunately, the size of *a* is too small. You want a bigger array! Your friends agree to give you a bigger array, but only if you are able to answer the following question correctly: is it possible to sort the array *a* (in increasing order) by reversing exactly one segment of *a*? See definitions of segment and reversing in the notes.
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=105) — the size of array *a*. The second line contains *n* distinct space-separated integers: *a*[1],<=*a*[2],<=...,<=*a*[*n*] (1<=≤<=*a*[*i*]<=≤<=109).
Print "yes" or "no" (without quotes), depending on the answer. If your answer is "yes", then also print two space-separated integers denoting start and end (start must not be greater than end) indices of the segment to be reversed. If there are multiple ways of selecting these indices, print any of them.
[ "3\n3 2 1\n", "4\n2 1 3 4\n", "4\n3 1 2 4\n", "2\n1 2\n" ]
[ "yes\n1 3\n", "yes\n1 2\n", "no\n", "yes\n1 1\n" ]
Sample 1. You can reverse the entire array to get [1, 2, 3], which is sorted. Sample 3. No segment can be reversed such that the array will be sorted. Definitions A segment [*l*, *r*] of array *a* is the sequence *a*[*l*], *a*[*l* + 1], ..., *a*[*r*]. If you have an array *a* of size *n* and you reverse its segment [*l*, *r*], the array will become: *a*[1], *a*[2], ..., *a*[*l* - 2], *a*[*l* - 1], *a*[*r*], *a*[*r* - 1], ..., *a*[*l* + 1], *a*[*l*], *a*[*r* + 1], *a*[*r* + 2], ..., *a*[*n* - 1], *a*[*n*].
1,000
[ { "input": "3\n3 2 1", "output": "yes\n1 3" }, { "input": "4\n2 1 3 4", "output": "yes\n1 2" }, { "input": "4\n3 1 2 4", "output": "no" }, { "input": "2\n1 2", "output": "yes\n1 1" }, { "input": "2\n58 4", "output": "yes\n1 2" }, { "input": "5\n69 37 27 4 2", "output": "yes\n1 5" }, { "input": "9\n6 78 63 59 28 24 8 96 99", "output": "yes\n2 7" }, { "input": "6\n19517752 43452931 112792556 68417469 779722934 921694415", "output": "yes\n3 4" }, { "input": "6\n169793171 335736854 449917902 513287332 811627074 938727967", "output": "yes\n1 1" }, { "input": "6\n509329 173849943 297546987 591032670 796346199 914588283", "output": "yes\n1 1" }, { "input": "25\n46 45 37 35 26 25 21 19 11 3 1 51 54 55 57 58 59 62 66 67 76 85 88 96 100", "output": "yes\n1 11" }, { "input": "46\n10 12 17 19 20 21 22 24 25 26 27 28 29 30 32 37 42 43 47 48 50 51 52 56 87 86 81 79 74 71 69 67 66 65 60 59 57 89 91 92 94 96 97 98 99 100", "output": "yes\n25 37" }, { "input": "96\n1 2 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 68 69 70 71 72 73 74 75 76 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "yes\n3 22" }, { "input": "2\n404928771 698395106", "output": "yes\n1 1" }, { "input": "2\n699573624 308238132", "output": "yes\n1 2" }, { "input": "5\n75531609 242194958 437796493 433259361 942142185", "output": "yes\n3 4" }, { "input": "5\n226959376 840957605 833410429 273566427 872976052", "output": "yes\n2 4" }, { "input": "5\n373362086 994096202 767275079 734424844 515504383", "output": "yes\n2 5" }, { "input": "5\n866379155 593548704 259097686 216134784 879911740", "output": "yes\n1 4" }, { "input": "5\n738083041 719956102 420866851 307749161 257917459", "output": "yes\n1 5" }, { "input": "5\n90786760 107075352 139104198 424911569 858427981", "output": "yes\n1 1" }, { "input": "6\n41533825 525419745 636375901 636653266 879043107 967434399", "output": "yes\n1 1" }, { "input": "40\n22993199 75843013 76710455 99749069 105296587 122559115 125881005 153961749 163646706 175409222 185819807 214465092 264449243 278246513 295514446 322935239 370349154 375773209 390474983 775646826 767329655 740310077 718820037 708508595 693119912 680958422 669537382 629123011 607511013 546574974 546572137 511951383 506996390 493995578 458256840 815612821 881161983 901337648 962275390 986568907", "output": "yes\n20 35" }, { "input": "40\n3284161 23121669 24630274 33434127 178753820 231503277 271972002 272578266 346450638 355655265 372217434 376132047 386622863 387235708 389799554 427160037 466577363 491873718 492746058 502535866 535768673 551570285 557477055 583643014 586216753 588981593 592960633 605923775 611051145 643142759 632768011 634888864 736715552 750574599 867737742 924365786 927179496 934453020 954090860 977765165", "output": "no" }, { "input": "40\n42131757 49645896 49957344 78716964 120937785 129116222 172128600 211446903 247833196 779340466 717548386 709969818 696716905 636153997 635635467 614115746 609201167 533608141 521874836 273044950 291514539 394083281 399369419 448830087 485128983 487192341 488673105 497678164 501864738 265305156 799595875 831638598 835155840 845617770 847736630 851436542 879757553 885618675 964068808 969215471", "output": "no" }, { "input": "40\n25722567 28250400 47661056 108729970 119887370 142272261 145287693 178946020 182917658 187405805 209478929 278713296 312035195 393514697 403876943 410188367 413061616 420619615 477231590 511200584 560288373 571690007 603093961 615463729 631624043 723138759 726089658 728151980 756393077 785590533 809755752 823601179 828357990 866942019 869575503 877310377 881382070 901314141 929048602 947139655", "output": "yes\n1 1" }, { "input": "40\n17927221 33153935 60257083 110553879 114654567 119809916 163899753 167741765 182812464 188486743 220036903 220127072 227545828 229552200 244963635 248298934 299478582 354141058 371400641 430054473 452548736 458695269 466968129 469000714 478004472 478693873 509342093 750631027 609759323 669427158 688490225 690701652 696893030 704668825 749028408 557906039 545356441 926901326 955586118 972642992", "output": "no" }, { "input": "4\n1 4 2 3", "output": "no" }, { "input": "6\n1 2 5 4 3 6", "output": "yes\n3 5" }, { "input": "1\n1", "output": "yes\n1 1" }, { "input": "6\n1 5 3 4 2 6", "output": "no" }, { "input": "4\n3 4 1 2", "output": "no" }, { "input": "5\n2 5 4 3 1", "output": "no" }, { "input": "4\n2 1 4 3", "output": "no" }, { "input": "6\n2 1 4 3 5 6", "output": "no" } ]
1,691,241,251
2,147,483,647
Python 3
OK
TESTS
76
78
12,902,400
length = int(input()) li = list(map(int,input().split())) liSort = sorted(li) index1 = -1 index2 = -1 for index in range(length) : if li[index] != liSort[index] : index1 = index break if index1 == -1 : print("yes") quit(print(1 , 1)) for index in range(length - 1 , -1 , -1) : if li[index] != liSort[index] : index2 = index break if liSort[index1:index2+1] == list(reversed(li[index1:index2+1])) : print("yes") print(index1 + 1 , index2 + 1) else : print("no")
Title: Sort the Array Time Limit: None seconds Memory Limit: None megabytes Problem Description: Being a programmer, you like arrays a lot. For your birthday, your friends have given you an array *a* consisting of *n* distinct integers. Unfortunately, the size of *a* is too small. You want a bigger array! Your friends agree to give you a bigger array, but only if you are able to answer the following question correctly: is it possible to sort the array *a* (in increasing order) by reversing exactly one segment of *a*? See definitions of segment and reversing in the notes. Input Specification: The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=105) — the size of array *a*. The second line contains *n* distinct space-separated integers: *a*[1],<=*a*[2],<=...,<=*a*[*n*] (1<=≤<=*a*[*i*]<=≤<=109). Output Specification: Print "yes" or "no" (without quotes), depending on the answer. If your answer is "yes", then also print two space-separated integers denoting start and end (start must not be greater than end) indices of the segment to be reversed. If there are multiple ways of selecting these indices, print any of them. Demo Input: ['3\n3 2 1\n', '4\n2 1 3 4\n', '4\n3 1 2 4\n', '2\n1 2\n'] Demo Output: ['yes\n1 3\n', 'yes\n1 2\n', 'no\n', 'yes\n1 1\n'] Note: Sample 1. You can reverse the entire array to get [1, 2, 3], which is sorted. Sample 3. No segment can be reversed such that the array will be sorted. Definitions A segment [*l*, *r*] of array *a* is the sequence *a*[*l*], *a*[*l* + 1], ..., *a*[*r*]. If you have an array *a* of size *n* and you reverse its segment [*l*, *r*], the array will become: *a*[1], *a*[2], ..., *a*[*l* - 2], *a*[*l* - 1], *a*[*r*], *a*[*r* - 1], ..., *a*[*l* + 1], *a*[*l*], *a*[*r* + 1], *a*[*r* + 2], ..., *a*[*n* - 1], *a*[*n*].
```python length = int(input()) li = list(map(int,input().split())) liSort = sorted(li) index1 = -1 index2 = -1 for index in range(length) : if li[index] != liSort[index] : index1 = index break if index1 == -1 : print("yes") quit(print(1 , 1)) for index in range(length - 1 , -1 , -1) : if li[index] != liSort[index] : index2 = index break if liSort[index1:index2+1] == list(reversed(li[index1:index2+1])) : print("yes") print(index1 + 1 , index2 + 1) else : print("no") ```
3
716
A
Crazy Computer
PROGRAMMING
800
[ "implementation" ]
null
null
ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear! More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=&gt;<=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen. For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen. You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything.
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively. The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=&lt;<=*t*2<=&lt;<=...<=&lt;<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word.
Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*.
[ "6 5\n1 3 8 14 19 20\n", "6 1\n1 3 5 7 9 10\n" ]
[ "3", "2" ]
The first sample is already explained in the problem statement. For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 &gt; 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1.
500
[ { "input": "6 5\n1 3 8 14 19 20", "output": "3" }, { "input": "6 1\n1 3 5 7 9 10", "output": "2" }, { "input": "1 1\n1000000000", "output": "1" }, { "input": "5 5\n1 7 12 13 14", "output": "4" }, { "input": "2 1000000000\n1 1000000000", "output": "2" }, { "input": "3 5\n1 10 20", "output": "1" }, { "input": "3 10\n1 2 3", "output": "3" }, { "input": "2 1\n1 100", "output": "1" }, { "input": "3 1\n1 2 10", "output": "1" }, { "input": "2 1\n1 2", "output": "2" } ]
1,597,047,488
2,147,483,647
Python 3
OK
TESTS
81
233
15,462,400
n = list(map(int,input().split())) l = list(map(int,input().split())) a = n[1] count = 1 for i in range(len(l)): if i != len(l)-1 and l[i+1]-l[i] <= a: count +=1 elif i != len(l)-1 and l[i+1]-l[i] > a: count = 1 else: break print(count)
Title: Crazy Computer Time Limit: None seconds Memory Limit: None megabytes Problem Description: ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear! More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=&gt;<=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen. For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen. You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything. Input Specification: The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively. The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=&lt;<=*t*2<=&lt;<=...<=&lt;<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word. Output Specification: Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*. Demo Input: ['6 5\n1 3 8 14 19 20\n', '6 1\n1 3 5 7 9 10\n'] Demo Output: ['3', '2'] Note: The first sample is already explained in the problem statement. For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 &gt; 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1.
```python n = list(map(int,input().split())) l = list(map(int,input().split())) a = n[1] count = 1 for i in range(len(l)): if i != len(l)-1 and l[i+1]-l[i] <= a: count +=1 elif i != len(l)-1 and l[i+1]-l[i] > a: count = 1 else: break print(count) ```
3
165
A
Supercentral Point
PROGRAMMING
1,000
[ "implementation" ]
null
null
One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*): - point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=&gt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=&lt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=&lt;<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=&gt;<=*y* We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points. Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set.
The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different.
Print the only number — the number of supercentral points of the given set.
[ "8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n", "5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n" ]
[ "2\n", "1\n" ]
In the first sample the supercentral points are only points (1, 1) and (1, 2). In the second sample there is one supercental point — point (0, 0).
500
[ { "input": "8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3", "output": "2" }, { "input": "5\n0 0\n0 1\n1 0\n0 -1\n-1 0", "output": "1" }, { "input": "9\n-565 -752\n-184 723\n-184 -752\n-184 1\n950 723\n-565 723\n950 -752\n950 1\n-565 1", "output": "1" }, { "input": "25\n-651 897\n916 897\n-651 -808\n-748 301\n-734 414\n-651 -973\n-734 897\n916 -550\n-758 414\n916 180\n-758 -808\n-758 -973\n125 -550\n125 -973\n125 301\n916 414\n-748 -808\n-651 301\n-734 301\n-307 897\n-651 -550\n-651 414\n125 -808\n-748 -550\n916 -808", "output": "7" }, { "input": "1\n487 550", "output": "0" }, { "input": "10\n990 -396\n990 736\n990 646\n990 -102\n990 -570\n990 155\n990 528\n990 489\n990 268\n990 676", "output": "0" }, { "input": "30\n507 836\n525 836\n-779 196\n507 -814\n525 -814\n525 42\n525 196\n525 -136\n-779 311\n507 -360\n525 300\n507 578\n507 311\n-779 836\n507 300\n525 -360\n525 311\n-779 -360\n-779 578\n-779 300\n507 42\n525 578\n-779 379\n507 196\n525 379\n507 379\n-779 -814\n-779 42\n-779 -136\n507 -136", "output": "8" }, { "input": "25\n890 -756\n890 -188\n-37 -756\n-37 853\n523 998\n-261 853\n-351 853\n-351 -188\n523 -756\n-261 -188\n-37 998\n523 -212\n-351 998\n-37 -188\n-351 -756\n-37 -212\n890 998\n890 -212\n523 853\n-351 -212\n-261 -212\n-261 998\n-261 -756\n890 853\n523 -188", "output": "9" }, { "input": "21\n-813 -11\n486 254\n685 254\n-708 254\n-55 -11\n-671 -191\n486 -11\n-671 -11\n685 -11\n685 -191\n486 -191\n-55 254\n-708 -11\n-813 254\n-708 -191\n41 -11\n-671 254\n-813 -191\n41 254\n-55 -191\n41 -191", "output": "5" }, { "input": "4\n1 0\n2 0\n1 1\n1 -1", "output": "0" } ]
1,649,314,314
2,147,483,647
Python 3
OK
TESTS
26
154
0
n = int(input()) x = [] # y = [] ans = 0 # for i in range(n): # a, b = map(int, input().split()) # x.append(a) # y.append(b) for i in range(n): a = list(map(int, input().split())) x.append(a) for i in range(n): r = 0 l = 0 u = 0 d = 0 for j in range(n): if (x[j][0] > x[i][0] and x[j][1] == x[i][1]): r += 1 if (x[j][0] < x[i][0] and x[j][1] == x[i][1]): l += 1 if (x[j][0] == x[i][0] and x[j][1] > x[i][1]): u += 1 if (x[j][0] == x[i][0] and x[j][1] < x[i][1]): d += 1 if r >0 and l>0 and u>0 and d>0: ans+=1 print(ans)
Title: Supercentral Point Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*): - point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=&gt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=&lt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=&lt;<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=&gt;<=*y* We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points. Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set. Input Specification: The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different. Output Specification: Print the only number — the number of supercentral points of the given set. Demo Input: ['8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n', '5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n'] Demo Output: ['2\n', '1\n'] Note: In the first sample the supercentral points are only points (1, 1) and (1, 2). In the second sample there is one supercental point — point (0, 0).
```python n = int(input()) x = [] # y = [] ans = 0 # for i in range(n): # a, b = map(int, input().split()) # x.append(a) # y.append(b) for i in range(n): a = list(map(int, input().split())) x.append(a) for i in range(n): r = 0 l = 0 u = 0 d = 0 for j in range(n): if (x[j][0] > x[i][0] and x[j][1] == x[i][1]): r += 1 if (x[j][0] < x[i][0] and x[j][1] == x[i][1]): l += 1 if (x[j][0] == x[i][0] and x[j][1] > x[i][1]): u += 1 if (x[j][0] == x[i][0] and x[j][1] < x[i][1]): d += 1 if r >0 and l>0 and u>0 and d>0: ans+=1 print(ans) ```
3
999
C
Alphabetic Removals
PROGRAMMING
1,200
[ "implementation" ]
null
null
You are given a string $s$ consisting of $n$ lowercase Latin letters. Polycarp wants to remove exactly $k$ characters ($k \le n$) from the string $s$. Polycarp uses the following algorithm $k$ times: - if there is at least one letter 'a', remove the leftmost occurrence and stop the algorithm, otherwise go to next item; - if there is at least one letter 'b', remove the leftmost occurrence and stop the algorithm, otherwise go to next item; - ... - remove the leftmost occurrence of the letter 'z' and stop the algorithm. This algorithm removes a single letter from the string. Polycarp performs this algorithm exactly $k$ times, thus removing exactly $k$ characters. Help Polycarp find the resulting string.
The first line of input contains two integers $n$ and $k$ ($1 \le k \le n \le 4 \cdot 10^5$) — the length of the string and the number of letters Polycarp will remove. The second line contains the string $s$ consisting of $n$ lowercase Latin letters.
Print the string that will be obtained from $s$ after Polycarp removes exactly $k$ letters using the above algorithm $k$ times. If the resulting string is empty, print nothing. It is allowed to print nothing or an empty line (line break).
[ "15 3\ncccaabababaccbc\n", "15 9\ncccaabababaccbc\n", "1 1\nu\n" ]
[ "cccbbabaccbc\n", "cccccc\n", "" ]
none
0
[ { "input": "15 3\ncccaabababaccbc", "output": "cccbbabaccbc" }, { "input": "15 9\ncccaabababaccbc", "output": "cccccc" }, { "input": "5 2\nzyzyx", "output": "zzy" }, { "input": "4 3\nhack", "output": "k" }, { "input": "4 3\nzzzz", "output": "z" }, { "input": "6 5\naaccdd", "output": "d" }, { "input": "2 1\nzz", "output": "z" }, { "input": "14 5\nhxehmvkybeklnj", "output": "xmvkyklnj" } ]
1,611,155,054
1,574
Python 3
OK
TESTS
44
1,278
28,057,600
n,m=map(int,input().split()) s=input() lst=[] for i in range(n): lst.append([s[i],i]) lst.sort() ans=[None]*(n) for i in range(m,n): ans[lst[i][1]]=lst[i][0] for i in ans: if i!=None: print(i,end="")
Title: Alphabetic Removals Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a string $s$ consisting of $n$ lowercase Latin letters. Polycarp wants to remove exactly $k$ characters ($k \le n$) from the string $s$. Polycarp uses the following algorithm $k$ times: - if there is at least one letter 'a', remove the leftmost occurrence and stop the algorithm, otherwise go to next item; - if there is at least one letter 'b', remove the leftmost occurrence and stop the algorithm, otherwise go to next item; - ... - remove the leftmost occurrence of the letter 'z' and stop the algorithm. This algorithm removes a single letter from the string. Polycarp performs this algorithm exactly $k$ times, thus removing exactly $k$ characters. Help Polycarp find the resulting string. Input Specification: The first line of input contains two integers $n$ and $k$ ($1 \le k \le n \le 4 \cdot 10^5$) — the length of the string and the number of letters Polycarp will remove. The second line contains the string $s$ consisting of $n$ lowercase Latin letters. Output Specification: Print the string that will be obtained from $s$ after Polycarp removes exactly $k$ letters using the above algorithm $k$ times. If the resulting string is empty, print nothing. It is allowed to print nothing or an empty line (line break). Demo Input: ['15 3\ncccaabababaccbc\n', '15 9\ncccaabababaccbc\n', '1 1\nu\n'] Demo Output: ['cccbbabaccbc\n', 'cccccc\n', ''] Note: none
```python n,m=map(int,input().split()) s=input() lst=[] for i in range(n): lst.append([s[i],i]) lst.sort() ans=[None]*(n) for i in range(m,n): ans[lst[i][1]]=lst[i][0] for i in ans: if i!=None: print(i,end="") ```
3
600
B
Queries about less or equal elements
PROGRAMMING
1,300
[ "binary search", "data structures", "sortings", "two pointers" ]
null
null
You are given two arrays of integers *a* and *b*. For each element of the second array *b**j* you should find the number of elements in array *a* that are less than or equal to the value *b**j*.
The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=2·105) — the sizes of arrays *a* and *b*. The second line contains *n* integers — the elements of array *a* (<=-<=109<=≤<=*a**i*<=≤<=109). The third line contains *m* integers — the elements of array *b* (<=-<=109<=≤<=*b**j*<=≤<=109).
Print *m* integers, separated by spaces: the *j*-th of which is equal to the number of such elements in array *a* that are less than or equal to the value *b**j*.
[ "5 4\n1 3 5 7 9\n6 4 2 8\n", "5 5\n1 2 1 2 5\n3 1 4 1 5\n" ]
[ "3 2 1 4\n", "4 2 4 2 5\n" ]
none
0
[ { "input": "5 4\n1 3 5 7 9\n6 4 2 8", "output": "3 2 1 4" }, { "input": "5 5\n1 2 1 2 5\n3 1 4 1 5", "output": "4 2 4 2 5" }, { "input": "1 1\n-1\n-2", "output": "0" }, { "input": "1 1\n-80890826\n686519510", "output": "1" }, { "input": "11 11\n237468511 -779187544 -174606592 193890085 404563196 -71722998 -617934776 170102710 -442808289 109833389 953091341\n994454001 322957429 216874735 -606986750 -455806318 -663190696 3793295 41395397 -929612742 -787653860 -684738874", "output": "11 9 8 2 2 1 5 5 0 0 1" }, { "input": "20 22\n858276994 -568758442 -918490847 -983345984 -172435358 389604931 200224783 486556113 413281867 -258259500 -627945379 -584563643 444685477 -602481243 -370745158 965672503 630955806 -626138773 -997221880 633102929\n-61330638 -977252080 -212144219 385501731 669589742 954357160 563935906 584468977 -895883477 405774444 853372186 186056475 -964575261 -952431965 632332084 -388829939 -23011650 310957048 -770695392 977376693 321435214 199223897", "output": "11 2 10 12 18 19 16 16 3 13 18 11 2 2 17 8 11 12 3 20 12 11" }, { "input": "5 9\n1 3 5 7 9\n1 2 3 4 5 6 7 8 9", "output": "1 1 2 2 3 3 4 4 5" }, { "input": "22 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22\n1", "output": "1" }, { "input": "5 1\n1 3 3 3 5\n3", "output": "4" }, { "input": "4 5\n1 1 1 4\n1 5 5 4 3", "output": "3 4 4 4 3" }, { "input": "5 4\n0 5 5 5 6\n5 1 6 3", "output": "4 1 5 1" }, { "input": "1 3\n0\n-1 0 1", "output": "0 1 1" }, { "input": "96 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1", "output": "96" }, { "input": "7 1\n1 2 3 4 5 6 7\n1", "output": "1" }, { "input": "13 13\n-1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000\n-1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000", "output": "7 13 7 13 7 13 7 13 7 13 7 13 7" }, { "input": "9 5\n1 2 3 4 5 6 7 8 9\n1 2 3 4 5", "output": "1 2 3 4 5" }, { "input": "3 8\n1 1 1\n1 1 1 1 1 1 1 1", "output": "3 3 3 3 3 3 3 3" }, { "input": "1 1\n-11111\n-5938", "output": "1" }, { "input": "1 1\n1\n400000009", "output": "1" }, { "input": "1 1\n1\n300000009", "output": "1" }, { "input": "1 1\n1\n200000009", "output": "1" }, { "input": "1 1\n1\n200000003", "output": "1" } ]
1,670,058,914
2,147,483,647
PyPy 3-64
OK
TESTS
60
249
33,280,000
def main(): n, m = read_ints() aseq = read_ints() bseq = read_ints() aseq.sort() ans = [] for bi in bseq: lo = 0 hi = n while lo < hi: mid = lo + (hi - lo) // 2 if aseq[mid] <= bi: lo = mid + 1 else: hi = mid ans.append(lo) print(*ans) def read_ints(): return [int(c) for c in input().split()] def print_lines(lst): print('\n'.join(map(str, lst))) if __name__ == "__main__": from os import environ as env if 'COMPUTERNAME' in env and 'L2A6HRI' in env['COMPUTERNAME']: import sys sys.stdout = open('out.txt', 'w') sys.stdin = open('in.txt', 'r') main()
Title: Queries about less or equal elements Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given two arrays of integers *a* and *b*. For each element of the second array *b**j* you should find the number of elements in array *a* that are less than or equal to the value *b**j*. Input Specification: The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=2·105) — the sizes of arrays *a* and *b*. The second line contains *n* integers — the elements of array *a* (<=-<=109<=≤<=*a**i*<=≤<=109). The third line contains *m* integers — the elements of array *b* (<=-<=109<=≤<=*b**j*<=≤<=109). Output Specification: Print *m* integers, separated by spaces: the *j*-th of which is equal to the number of such elements in array *a* that are less than or equal to the value *b**j*. Demo Input: ['5 4\n1 3 5 7 9\n6 4 2 8\n', '5 5\n1 2 1 2 5\n3 1 4 1 5\n'] Demo Output: ['3 2 1 4\n', '4 2 4 2 5\n'] Note: none
```python def main(): n, m = read_ints() aseq = read_ints() bseq = read_ints() aseq.sort() ans = [] for bi in bseq: lo = 0 hi = n while lo < hi: mid = lo + (hi - lo) // 2 if aseq[mid] <= bi: lo = mid + 1 else: hi = mid ans.append(lo) print(*ans) def read_ints(): return [int(c) for c in input().split()] def print_lines(lst): print('\n'.join(map(str, lst))) if __name__ == "__main__": from os import environ as env if 'COMPUTERNAME' in env and 'L2A6HRI' in env['COMPUTERNAME']: import sys sys.stdout = open('out.txt', 'w') sys.stdin = open('in.txt', 'r') main() ```
3
369
A
Valera and Plates
PROGRAMMING
900
[ "greedy", "implementation" ]
null
null
Valera is a lazy student. He has *m* clean bowls and *k* clean plates. Valera has made an eating plan for the next *n* days. As Valera is lazy, he will eat exactly one dish per day. At that, in order to eat a dish, he needs exactly one clean plate or bowl. We know that Valera can cook only two types of dishes. He can eat dishes of the first type from bowls and dishes of the second type from either bowls or plates. When Valera finishes eating, he leaves a dirty plate/bowl behind. His life philosophy doesn't let him eat from dirty kitchenware. So sometimes he needs to wash his plate/bowl before eating. Find the minimum number of times Valera will need to wash a plate/bowl, if he acts optimally.
The first line of the input contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=1000) — the number of the planned days, the number of clean bowls and the number of clean plates. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2). If *a**i* equals one, then on day *i* Valera will eat a first type dish. If *a**i* equals two, then on day *i* Valera will eat a second type dish.
Print a single integer — the minimum number of times Valera will need to wash a plate/bowl.
[ "3 1 1\n1 2 1\n", "4 3 1\n1 1 1 1\n", "3 1 2\n2 2 2\n", "8 2 2\n1 2 1 2 1 2 1 2\n" ]
[ "1\n", "1\n", "0\n", "4\n" ]
In the first sample Valera will wash a bowl only on the third day, so the answer is one. In the second sample, Valera will have the first type of the dish during all four days, and since there are only three bowls, he will wash a bowl exactly once. In the third sample, Valera will have the second type of dish for all three days, and as they can be eaten from either a plate or a bowl, he will never need to wash a plate/bowl.
500
[ { "input": "3 1 1\n1 2 1", "output": "1" }, { "input": "4 3 1\n1 1 1 1", "output": "1" }, { "input": "3 1 2\n2 2 2", "output": "0" }, { "input": "8 2 2\n1 2 1 2 1 2 1 2", "output": "4" }, { "input": "2 100 100\n2 2", "output": "0" }, { "input": "1 1 1\n2", "output": "0" }, { "input": "233 100 1\n2 2 1 1 1 2 2 2 2 1 1 2 2 2 1 2 2 1 1 1 2 2 1 1 1 1 2 1 2 2 1 1 2 2 1 2 2 1 2 1 2 1 2 2 2 1 1 1 1 2 1 2 1 1 2 1 1 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 2 2 2 1 1 2 2 1 1 1 1 2 1 1 2 1 2 2 2 1 1 1 2 2 2 1 1 1 1 2 1 2 1 1 1 1 2 2 2 1 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 2 1 1 1 2 2 1 1 2 1 2 1 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 1 2 2 1 1 1 2 2 1 1 2 2 1 1 2 1 1 2 2 1 2 2 2 2 2 2 1 2 2 2 2 2 1 1 2 2 2 2 2 2 1 1 1 2 1 2 2 2 2 2 2 2 2 1 1 2 1 2 1 2 2", "output": "132" }, { "input": "123 100 1\n2 2 2 1 1 2 2 2 2 1 1 2 2 2 1 2 2 2 2 1 2 2 2 1 1 1 2 2 2 2 1 2 2 2 2 2 2 1 2 1 2 1 2 2 2 1 2 1 2 2 1 2 2 1 2 2 1 2 2 1 2 2 2 1 1 1 1 1 1 1 1 1 2 2 2 2 2 1 1 2 2 1 1 1 1 2 1 2 2 1 2 2 2 1 1 1 2 2 2 1 2 2 2 2 1 2 2 2 2 1 2 2 2 1 1 2 1 2 1 2 1 1 1", "output": "22" }, { "input": "188 100 1\n2 2 1 1 1 2 2 2 2 1 1 2 2 2 1 2 2 1 1 1 2 2 1 1 1 1 2 1 2 2 1 1 2 2 1 2 2 1 2 1 2 1 2 2 2 1 1 1 1 2 1 2 1 1 2 1 1 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 2 2 2 1 1 2 2 1 1 1 1 2 1 1 2 1 2 2 2 1 1 1 2 2 2 1 1 1 1 2 1 2 1 1 1 1 2 2 2 1 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 2 1 1 1 2 2 1 1 2 1 2 1 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 1 2 2 1 1 1 2 2 1 1 2 2 1 1 2 1", "output": "87" }, { "input": "3 1 2\n1 1 1", "output": "2" }, { "input": "3 2 2\n1 1 1", "output": "1" }, { "input": "3 2 1\n1 1 1", "output": "1" }, { "input": "3 1 1\n1 1 1", "output": "2" }, { "input": "5 1 2\n2 2 2 2 2", "output": "2" }, { "input": "5 2 2\n2 2 2 2 2", "output": "1" }, { "input": "5 2 1\n2 2 2 2 2", "output": "2" }, { "input": "5 1 1\n2 2 2 2 2", "output": "3" }, { "input": "1 1 2\n2", "output": "0" }, { "input": "1 2 2\n2", "output": "0" }, { "input": "1 2 1\n2", "output": "0" }, { "input": "1 1 1\n2", "output": "0" }, { "input": "6 3 1\n1 1 2 2 2 2", "output": "2" }, { "input": "100 40 20\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "40" }, { "input": "7 5 2\n2 2 1 1 1 1 1", "output": "0" }, { "input": "10 4 4\n2 2 2 2 2 2 1 1 1 1", "output": "2" }, { "input": "3 2 1\n2 1 1", "output": "0" }, { "input": "7 6 1\n2 1 1 1 1 1 1", "output": "0" }, { "input": "7 5 1\n1 1 1 2 2 2 2", "output": "1" }, { "input": "5 3 1\n1 1 2 2 2", "output": "1" }, { "input": "3 1 1\n2 2 2", "output": "1" }, { "input": "5 2 2\n2 2 2 2 2", "output": "1" }, { "input": "3 1 3\n1 1 1", "output": "2" }, { "input": "5 2 1\n1 1 2 2 2", "output": "2" }, { "input": "4 3 2\n2 1 1 1", "output": "0" }, { "input": "4 2 1\n1 2 2 2", "output": "1" }, { "input": "14 4 7\n1 1 1 2 2 2 2 2 2 2 2 2 2 2", "output": "3" }, { "input": "12 10 4\n2 2 2 2 2 2 1 1 1 1 1 1", "output": "0" }, { "input": "5 3 2\n2 2 1 1 1", "output": "0" } ]
1,518,897,672
2,147,483,647
Python 3
OK
TESTS
63
77
5,632,000
n, m, k = [int(x) for x in input().split(' ')] dish = [int(x) for x in input().split(' ')] ans = 0 for i in dish: if i == 1: if m!= 0: m = m-1 else: ans = ans +1 else: if k!=0: k = k -1 continue if m!=0: m = m-1 continue else: ans = ans+1 print(ans)
Title: Valera and Plates Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera is a lazy student. He has *m* clean bowls and *k* clean plates. Valera has made an eating plan for the next *n* days. As Valera is lazy, he will eat exactly one dish per day. At that, in order to eat a dish, he needs exactly one clean plate or bowl. We know that Valera can cook only two types of dishes. He can eat dishes of the first type from bowls and dishes of the second type from either bowls or plates. When Valera finishes eating, he leaves a dirty plate/bowl behind. His life philosophy doesn't let him eat from dirty kitchenware. So sometimes he needs to wash his plate/bowl before eating. Find the minimum number of times Valera will need to wash a plate/bowl, if he acts optimally. Input Specification: The first line of the input contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=1000) — the number of the planned days, the number of clean bowls and the number of clean plates. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2). If *a**i* equals one, then on day *i* Valera will eat a first type dish. If *a**i* equals two, then on day *i* Valera will eat a second type dish. Output Specification: Print a single integer — the minimum number of times Valera will need to wash a plate/bowl. Demo Input: ['3 1 1\n1 2 1\n', '4 3 1\n1 1 1 1\n', '3 1 2\n2 2 2\n', '8 2 2\n1 2 1 2 1 2 1 2\n'] Demo Output: ['1\n', '1\n', '0\n', '4\n'] Note: In the first sample Valera will wash a bowl only on the third day, so the answer is one. In the second sample, Valera will have the first type of the dish during all four days, and since there are only three bowls, he will wash a bowl exactly once. In the third sample, Valera will have the second type of dish for all three days, and as they can be eaten from either a plate or a bowl, he will never need to wash a plate/bowl.
```python n, m, k = [int(x) for x in input().split(' ')] dish = [int(x) for x in input().split(' ')] ans = 0 for i in dish: if i == 1: if m!= 0: m = m-1 else: ans = ans +1 else: if k!=0: k = k -1 continue if m!=0: m = m-1 continue else: ans = ans+1 print(ans) ```
3
686
A
Free Ice Cream
PROGRAMMING
800
[ "constructive algorithms", "implementation" ]
null
null
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer. At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue). If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress. Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109). Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
[ "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n", "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n" ]
[ "22 1\n", "3 2\n" ]
Consider the first sample. 1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
500
[ { "input": "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20", "output": "22 1" }, { "input": "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98", "output": "3 2" }, { "input": "6 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000", "output": "7000000000 0" }, { "input": "5 12\n- 12\n+ 7\n- 6\n- 1\n+ 46", "output": "46 0" }, { "input": "11 1000\n- 100\n+ 100\n+ 100\n+ 100\n+ 100\n- 100\n- 100\n- 100\n- 100\n- 100\n- 100", "output": "700 0" }, { "input": "1 0\n- 526403222", "output": "0 1" }, { "input": "1 897986543\n- 371188251", "output": "526798292 0" }, { "input": "1 0\n+ 1", "output": "1 0" }, { "input": "1 0\n- 1", "output": "0 1" }, { "input": "1 10\n+ 10", "output": "20 0" }, { "input": "1 3\n- 5", "output": "3 1" }, { "input": "1 0\n- 5", "output": "0 1" }, { "input": "1 0\n+ 5", "output": "5 0" } ]
1,688,221,835
2,147,483,647
Python 3
OK
TESTS
34
46
0
n ,x =map(int, input().split(' ')) sadKid = 0 for _ in range(n): sign , mount = input().split(' ') mount = int(mount) if sign == '+': x += mount if sign == '-': if (x - mount < 0): sadKid += 1 else: x -= mount print(x ,sadKid)
Title: Free Ice Cream Time Limit: None seconds Memory Limit: None megabytes Problem Description: After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer. At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue). If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress. Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids. Input Specification: The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109). Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place. Output Specification: Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress. Demo Input: ['5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n', '5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n'] Demo Output: ['22 1\n', '3 2\n'] Note: Consider the first sample. 1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
```python n ,x =map(int, input().split(' ')) sadKid = 0 for _ in range(n): sign , mount = input().split(' ') mount = int(mount) if sign == '+': x += mount if sign == '-': if (x - mount < 0): sadKid += 1 else: x -= mount print(x ,sadKid) ```
3
44
A
Indian Summer
PROGRAMMING
900
[ "implementation" ]
A. Indian Summer
2
256
Indian summer is such a beautiful time of the year! A girl named Alyona is walking in the forest and picking a bouquet from fallen leaves. Alyona is very choosy — she doesn't take a leaf if it matches the color and the species of the tree of one of the leaves she already has. Find out how many leaves Alyona has picked.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of leaves Alyona has found. The next *n* lines contain the leaves' descriptions. Each leaf is characterized by the species of the tree it has fallen from and by the color. The species of the trees and colors are given in names, consisting of no more than 10 lowercase Latin letters. A name can not be an empty string. The species of a tree and the color are given in each line separated by a space.
Output the single number — the number of Alyona's leaves.
[ "5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green\n", "3\noak yellow\noak yellow\noak yellow\n" ]
[ "4\n", "1\n" ]
none
0
[ { "input": "5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green", "output": "4" }, { "input": "3\noak yellow\noak yellow\noak yellow", "output": "1" }, { "input": "5\nxbnbkzn hp\nkaqkl vrgzbvqstu\nj aqidx\nhos gyul\nwefxmh tygpluae", "output": "5" }, { "input": "1\nqvwli hz", "output": "1" }, { "input": "4\nsrhk x\nsrhk x\nqfoe vnrjuab\nqfoe vnrjuab", "output": "2" }, { "input": "4\nsddqllmmpk syded\nfprsq fnenjnaz\nn hdej\nsddqllmmpk syded", "output": "3" }, { "input": "17\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw", "output": "1" }, { "input": "18\nb d\nrfdb esp\nrfdb esp\nb d\nrfdb esp\nrfdb esp\nb d\nb d\nrfdb esp\nrfdb esp\nb d\nrfdb esp\nb d\nrfdb esp\nb d\nb d\nrfdb esp\nrfdb esp", "output": "2" }, { "input": "13\nsvpzwtwn rykzfdce\nqweiyeck jkreouy\nhk nnli\ntwxrnbbdt vtuv\nxokqjtylly sz\nesdt dbfidjslq\ng ybqgomvw\nxcpfjmf zcqvz\nifajadhj invzueip\nvdemdnxifb hckwebmi\nsdpnhipam wvowzavh\nuqdlfskhgo vunbpghae\ne dtigwnb", "output": "13" }, { "input": "20\nm vkfh\nvptikamead mvx\nitu mf\nklruxckw aqega\nekqkd enjllwol\ncc uybfdh\nimrfdngvo u\ne uh\ntwt jsslcfuogk\nbljwqsag tuqbdn\nqcv q\nasx gzhvwwmajj\nqcv q\nekqkd enjllwol\nasx gzhvwwmajj\nks vv\nkzyfi cn\ncc uybfdh\nitu mf\ncjbjhtbyvk vatwfmux", "output": "15" }, { "input": "2\nab ab\na bab", "output": "2" } ]
1,651,940,174
2,147,483,647
Python 3
OK
TESTS
29
92
0
n=int(input()) s=1 m=[] for i in range(n): l=input() m.append(l) for i in range(1,len(m)): if(m[i] not in m[0:i]): s+=1 print(s)
Title: Indian Summer Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Indian summer is such a beautiful time of the year! A girl named Alyona is walking in the forest and picking a bouquet from fallen leaves. Alyona is very choosy — she doesn't take a leaf if it matches the color and the species of the tree of one of the leaves she already has. Find out how many leaves Alyona has picked. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of leaves Alyona has found. The next *n* lines contain the leaves' descriptions. Each leaf is characterized by the species of the tree it has fallen from and by the color. The species of the trees and colors are given in names, consisting of no more than 10 lowercase Latin letters. A name can not be an empty string. The species of a tree and the color are given in each line separated by a space. Output Specification: Output the single number — the number of Alyona's leaves. Demo Input: ['5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green\n', '3\noak yellow\noak yellow\noak yellow\n'] Demo Output: ['4\n', '1\n'] Note: none
```python n=int(input()) s=1 m=[] for i in range(n): l=input() m.append(l) for i in range(1,len(m)): if(m[i] not in m[0:i]): s+=1 print(s) ```
3.977
839
C
Journey
PROGRAMMING
1,500
[ "dfs and similar", "dp", "graphs", "probabilities", "trees" ]
null
null
There are *n* cities and *n*<=-<=1 roads in the Seven Kingdoms, each road connects two cities and we can reach any city from any other by the roads. Theon and Yara Greyjoy are on a horse in the first city, they are starting traveling through the roads. But the weather is foggy, so they can’t see where the horse brings them. When the horse reaches a city (including the first one), it goes to one of the cities connected to the current city. But it is a strange horse, it only goes to cities in which they weren't before. In each such city, the horse goes with equal probabilities and it stops when there are no such cities. Let the length of each road be 1. The journey starts in the city 1. What is the expected length (expected value of length) of their journey? You can read about expected (average) value by the link [https://en.wikipedia.org/wiki/Expected_value](https://en.wikipedia.org/wiki/Expected_value).
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100000) — number of cities. Then *n*<=-<=1 lines follow. The *i*-th line of these lines contains two integers *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*, *u**i*<=≠<=*v**i*) — the cities connected by the *i*-th road. It is guaranteed that one can reach any city from any other by the roads.
Print a number — the expected length of their journey. The journey starts in the city 1. Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6. Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if .
[ "4\n1 2\n1 3\n2 4\n", "5\n1 2\n1 3\n3 4\n2 5\n" ]
[ "1.500000000000000\n", "2.000000000000000\n" ]
In the first sample, their journey may end in cities 3 or 4 with equal probability. The distance to city 3 is 1 and to city 4 is 2, so the expected length is 1.5. In the second sample, their journey may end in city 4 or 5. The distance to the both cities is 2, so the expected length is 2.
1,500
[ { "input": "4\n1 2\n1 3\n2 4", "output": "1.500000000000000" }, { "input": "5\n1 2\n1 3\n3 4\n2 5", "output": "2.000000000000000" }, { "input": "70\n1 25\n57 1\n18 1\n65 1\n38 1\n1 41\n1 5\n1 69\n1 3\n31 1\n1 8\n1 9\n53 1\n70 1\n45 1\n1 24\n1 42\n1 30\n1 12\n1 37\n64 1\n1 28\n1 58\n1 22\n11 1\n1 4\n1 27\n1 16\n1 21\n54 1\n1 51\n1 43\n29 1\n56 1\n1 39\n32 1\n1 15\n1 17\n1 19\n1 40\n36 1\n48 1\n63 1\n1 7\n1 47\n1 13\n1 46\n60 1\n1 6\n23 1\n20 1\n1 52\n2 1\n26 1\n1 59\n1 66\n10 1\n1 62\n1 68\n1 55\n50 1\n33 1\n44 1\n1 34\n1 35\n1 61\n14 1\n67 1\n49 1", "output": "1.000000000000000" }, { "input": "10\n8 6\n9 10\n8 7\n1 4\n1 8\n9 5\n9 8\n2 5\n3 1", "output": "1.500000000000000" }, { "input": "1", "output": "0.000000000000000" } ]
1,630,028,722
2,147,483,647
Python 3
OK
TESTS
40
624
23,449,600
import math import heapq import itertools from sys import setrecursionlimit from collections import deque, defaultdict # ANALYSIS # # Let n be the number of cities. This analysis will be done assuming the # impelmentation was recursive, which makes the explanation easier. # # RUNETIME COMPLEXITY: O(n). We visit each of the n cities once. # For each city, we check each edge. There are n - 1 edges and each edge is # checked exactly twice for 2n - 2 checks. # # SPACE COMPLEXITY: O(n). We create a number of data structures that are # linear in size to n or the number of edges, which is n - 1. The stack we # create will not contain duplicate vertices and will grow to be at most size # n. # # CONSTRAINT JUSTIFICATION: Both runtime and space complexities are linear, # which cannot be improved asymptotically as at a minimum we must check each # city. Since the number of cities is low (<= 1e5), the constants in # runtime and space complexity are not an issue. # # Due to the very deep tree (<= 1e5), recursion was not possible. Manual # recursion using heap memory is sufficient as the tree isn't so deep that # it cannot be held in memory. def iteration(graph, seen, stack, stack_var, ret): start, parent = stack[-1] I, res = stack_var.pop() seen[start] = True if len(graph[start]) > 1: for i in range(I, len(graph[start])): adj = graph[start][i] if adj != parent: if not seen[adj]: stack.append((adj, start)) stack_var.append((i, res)) stack_var.append((0, 0)) return ret res += 1 + ret res /= len(graph[start]) - 1 stack.pop() return res def solve(graph, seen): stack = [(0, len(graph))] # start, parent stack_var = [(0, 0)] # i, res ret = 0 while stack: ret = iteration(graph, seen, stack, stack_var, ret) return ret if __name__ == "__main__": n = int(input()) graph = [[] for _ in range(n)] seen = [False] * n graph[0].append(n) for _ in range(n-1): u, v = map(lambda x: int(x) - 1, input().split()) graph[u].append(v) graph[v].append(u) res = solve(graph, seen) print(res)
Title: Journey Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are *n* cities and *n*<=-<=1 roads in the Seven Kingdoms, each road connects two cities and we can reach any city from any other by the roads. Theon and Yara Greyjoy are on a horse in the first city, they are starting traveling through the roads. But the weather is foggy, so they can’t see where the horse brings them. When the horse reaches a city (including the first one), it goes to one of the cities connected to the current city. But it is a strange horse, it only goes to cities in which they weren't before. In each such city, the horse goes with equal probabilities and it stops when there are no such cities. Let the length of each road be 1. The journey starts in the city 1. What is the expected length (expected value of length) of their journey? You can read about expected (average) value by the link [https://en.wikipedia.org/wiki/Expected_value](https://en.wikipedia.org/wiki/Expected_value). Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100000) — number of cities. Then *n*<=-<=1 lines follow. The *i*-th line of these lines contains two integers *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*, *u**i*<=≠<=*v**i*) — the cities connected by the *i*-th road. It is guaranteed that one can reach any city from any other by the roads. Output Specification: Print a number — the expected length of their journey. The journey starts in the city 1. Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6. Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if . Demo Input: ['4\n1 2\n1 3\n2 4\n', '5\n1 2\n1 3\n3 4\n2 5\n'] Demo Output: ['1.500000000000000\n', '2.000000000000000\n'] Note: In the first sample, their journey may end in cities 3 or 4 with equal probability. The distance to city 3 is 1 and to city 4 is 2, so the expected length is 1.5. In the second sample, their journey may end in city 4 or 5. The distance to the both cities is 2, so the expected length is 2.
```python import math import heapq import itertools from sys import setrecursionlimit from collections import deque, defaultdict # ANALYSIS # # Let n be the number of cities. This analysis will be done assuming the # impelmentation was recursive, which makes the explanation easier. # # RUNETIME COMPLEXITY: O(n). We visit each of the n cities once. # For each city, we check each edge. There are n - 1 edges and each edge is # checked exactly twice for 2n - 2 checks. # # SPACE COMPLEXITY: O(n). We create a number of data structures that are # linear in size to n or the number of edges, which is n - 1. The stack we # create will not contain duplicate vertices and will grow to be at most size # n. # # CONSTRAINT JUSTIFICATION: Both runtime and space complexities are linear, # which cannot be improved asymptotically as at a minimum we must check each # city. Since the number of cities is low (<= 1e5), the constants in # runtime and space complexity are not an issue. # # Due to the very deep tree (<= 1e5), recursion was not possible. Manual # recursion using heap memory is sufficient as the tree isn't so deep that # it cannot be held in memory. def iteration(graph, seen, stack, stack_var, ret): start, parent = stack[-1] I, res = stack_var.pop() seen[start] = True if len(graph[start]) > 1: for i in range(I, len(graph[start])): adj = graph[start][i] if adj != parent: if not seen[adj]: stack.append((adj, start)) stack_var.append((i, res)) stack_var.append((0, 0)) return ret res += 1 + ret res /= len(graph[start]) - 1 stack.pop() return res def solve(graph, seen): stack = [(0, len(graph))] # start, parent stack_var = [(0, 0)] # i, res ret = 0 while stack: ret = iteration(graph, seen, stack, stack_var, ret) return ret if __name__ == "__main__": n = int(input()) graph = [[] for _ in range(n)] seen = [False] * n graph[0].append(n) for _ in range(n-1): u, v = map(lambda x: int(x) - 1, input().split()) graph[u].append(v) graph[v].append(u) res = solve(graph, seen) print(res) ```
3
1,010
B
Rocket
PROGRAMMING
1,800
[ "binary search", "interactive" ]
null
null
This is an interactive problem. Natasha is going to fly to Mars. Finally, Natasha sat in the rocket. She flies, flies... but gets bored. She wishes to arrive to Mars already! So she decides to find something to occupy herself. She couldn't think of anything better to do than to calculate the distance to the red planet. Let's define $x$ as the distance to Mars. Unfortunately, Natasha does not know $x$. But it is known that $1 \le x \le m$, where Natasha knows the number $m$. Besides, $x$ and $m$ are positive integers. Natasha can ask the rocket questions. Every question is an integer $y$ ($1 \le y \le m$). The correct answer to the question is $-1$, if $x&lt;y$, $0$, if $x=y$, and $1$, if $x&gt;y$. But the rocket is broken — it does not always answer correctly. Precisely: let the correct answer to the current question be equal to $t$, then, if the rocket answers this question correctly, then it will answer $t$, otherwise it will answer $-t$. In addition, the rocket has a sequence $p$ of length $n$. Each element of the sequence is either $0$ or $1$. The rocket processes this sequence in the cyclic order, that is $1$-st element, $2$-nd, $3$-rd, $\ldots$, $(n-1)$-th, $n$-th, $1$-st, $2$-nd, $3$-rd, $\ldots$, $(n-1)$-th, $n$-th, $\ldots$. If the current element is $1$, the rocket answers correctly, if $0$ — lies. Natasha doesn't know the sequence $p$, but she knows its length — $n$. You can ask the rocket no more than $60$ questions. Help Natasha find the distance to Mars. Assume, that the distance to Mars does not change while Natasha is asking questions. Your solution will not be accepted, if it does not receive an answer $0$ from the rocket (even if the distance to Mars is uniquely determined by the already received rocket's answers).
The first line contains two integers $m$ and $n$ ($1 \le m \le 10^9$, $1 \le n \le 30$) — the maximum distance to Mars and the number of elements in the sequence $p$.
none
[ "5 2\n1\n-1\n-1\n1\n0\n" ]
[ "1\n2\n4\n5\n3\n" ]
In the example, hacking would look like this: 5 2 3 1 0 This means that the current distance to Mars is equal to $3$, Natasha knows that it does not exceed $5$, and the rocket answers in order: correctly, incorrectly, correctly, incorrectly ... Really: on the first query ($1$) the correct answer is $1$, the rocket answered correctly: $1$; on the second query ($2$) the correct answer is $1$, the rocket answered incorrectly: $-1$; on the third query ($4$) the correct answer is $-1$, the rocket answered correctly: $-1$; on the fourth query ($5$) the correct answer is $-1$, the rocket answered incorrectly: $1$; on the fifth query ($3$) the correct and incorrect answer is $0$.
750
[ { "input": "5 2 3\n1 0", "output": "3 queries, x=3" }, { "input": "1 1 1\n1", "output": "1 queries, x=1" }, { "input": "3 2 3\n1 0", "output": "4 queries, x=3" }, { "input": "6 3 5\n1 1 1", "output": "5 queries, x=5" }, { "input": "10 4 3\n0 0 1 0", "output": "6 queries, x=3" }, { "input": "30 5 16\n0 1 1 1 0", "output": "6 queries, x=16" }, { "input": "60 6 21\n1 0 0 1 0 1", "output": "11 queries, x=21" }, { "input": "100 7 73\n0 0 0 1 0 1 1", "output": "14 queries, x=73" }, { "input": "1000000000 29 958572235\n1 1 0 1 1 1 1 0 1 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 1 1 1 0 0", "output": "58 queries, x=958572235" }, { "input": "738009704 30 116044407\n0 0 1 1 0 0 1 0 0 0 1 0 0 0 1 0 0 1 1 0 1 0 1 1 0 0 1 1 1 1", "output": "59 queries, x=116044407" }, { "input": "300 8 165\n1 1 1 0 0 1 1 0", "output": "16 queries, x=165" }, { "input": "600 9 150\n0 0 1 0 1 0 1 0 1", "output": "19 queries, x=150" }, { "input": "1000 10 140\n0 0 0 0 1 0 0 0 0 0", "output": "20 queries, x=140" }, { "input": "3000 11 1896\n1 0 1 1 0 0 0 0 1 1 1", "output": "21 queries, x=1896" }, { "input": "6000 12 4679\n1 0 1 1 1 1 1 0 0 0 0 1", "output": "23 queries, x=4679" }, { "input": "10000 13 4977\n1 0 1 1 0 0 0 1 0 0 1 1 0", "output": "26 queries, x=4977" }, { "input": "30000 14 60\n1 1 1 0 0 1 0 1 0 0 1 0 0 0", "output": "28 queries, x=60" }, { "input": "60000 15 58813\n0 1 1 0 1 1 0 0 0 1 1 1 1 0 1", "output": "27 queries, x=58813" }, { "input": "100000 16 79154\n1 1 1 0 0 0 0 0 1 1 0 1 0 1 0 1", "output": "32 queries, x=79154" }, { "input": "300000 17 11107\n1 0 0 0 1 0 0 0 1 1 1 0 0 1 1 1 0", "output": "34 queries, x=11107" }, { "input": "600000 18 146716\n0 0 0 1 0 0 1 0 0 0 0 0 0 1 0 0 1 1", "output": "37 queries, x=146716" }, { "input": "1000000 19 418016\n1 0 0 1 0 1 0 0 1 1 0 0 0 1 1 1 1 0 0", "output": "38 queries, x=418016" }, { "input": "3000000 20 642518\n1 0 0 1 0 1 1 1 1 1 0 0 0 1 0 1 0 1 0 1", "output": "41 queries, x=642518" }, { "input": "6000000 21 3516807\n0 0 0 1 0 1 0 1 1 0 0 0 0 1 0 1 1 1 0 0 0", "output": "43 queries, x=3516807" }, { "input": "10000000 22 8115129\n1 0 1 0 0 0 0 0 0 1 1 0 1 0 0 0 0 1 1 0 0 1", "output": "42 queries, x=8115129" }, { "input": "30000000 23 10362635\n0 1 0 0 1 1 1 1 0 0 0 1 0 1 1 0 1 1 1 1 0 0 0", "output": "48 queries, x=10362635" }, { "input": "60000000 24 52208533\n1 1 1 0 1 0 0 0 0 0 1 0 0 1 0 1 0 1 1 0 1 1 1 0", "output": "46 queries, x=52208533" }, { "input": "100000000 25 51744320\n0 1 1 1 1 0 1 1 1 1 1 1 0 1 0 1 1 0 0 1 1 0 1 0 1", "output": "50 queries, x=51744320" }, { "input": "300000000 26 264009490\n1 1 1 1 1 1 1 1 0 0 0 1 1 1 1 1 0 1 1 0 1 1 1 0 1 1", "output": "54 queries, x=264009490" }, { "input": "600000000 27 415720732\n1 1 1 1 1 1 0 0 1 1 1 0 1 0 1 1 0 0 1 1 1 1 0 1 0 1 0", "output": "56 queries, x=415720732" }, { "input": "1000000000 28 946835863\n0 0 1 0 1 1 1 0 1 0 1 1 0 1 0 1 1 0 0 0 1 0 1 0 1 1 0 0", "output": "58 queries, x=946835863" }, { "input": "1000000000 29 124919287\n0 0 1 0 0 0 1 0 1 0 0 1 1 0 1 0 1 0 1 1 1 1 0 1 1 0 1 0 0", "output": "59 queries, x=124919287" }, { "input": "1000000000 30 202669473\n1 1 0 1 1 1 0 0 1 0 1 0 1 0 1 0 1 1 0 0 1 1 1 1 1 0 0 0 0 0", "output": "58 queries, x=202669473" }, { "input": "1000000000 13 532121080\n1 1 1 0 1 1 0 0 0 0 1 0 1", "output": "42 queries, x=532121080" }, { "input": "1000000000 27 105669924\n0 1 1 1 0 1 0 1 0 0 0 1 0 0 1 1 0 1 1 0 0 1 0 1 1 1 1", "output": "57 queries, x=105669924" }, { "input": "1000000000 11 533994576\n0 0 1 0 1 1 1 1 0 1 0", "output": "38 queries, x=533994576" }, { "input": "1000000000 9 107543421\n1 0 0 1 1 1 1 1 1", "output": "39 queries, x=107543421" }, { "input": "1000000000 23 976059561\n1 0 0 0 0 1 0 0 1 1 1 1 1 1 1 0 0 0 0 1 0 0 1", "output": "53 queries, x=976059561" }, { "input": "1000000000 7 549608406\n1 1 1 0 1 1 1", "output": "36 queries, x=549608406" }, { "input": "1000000000 21 123157250\n0 1 1 1 1 1 1 0 0 0 1 1 1 1 0 0 0 1 0 0 1", "output": "49 queries, x=123157250" }, { "input": "1000000000 19 696706094\n0 0 0 0 0 1 0 0 0 0 1 0 0 1 0 0 0 0 0", "output": "47 queries, x=696706094" }, { "input": "1000000000 3 125030747\n0 0 0", "output": "33 queries, x=125030747" }, { "input": "1000000000 17 993546887\n1 0 1 0 1 1 1 1 1 1 0 1 0 1 1 1 1", "output": "46 queries, x=993546887" }, { "input": "1000000000 15 567095731\n1 1 1 0 0 1 1 1 0 1 0 0 1 0 0", "output": "45 queries, x=567095731" }, { "input": "1000000000 29 140644576\n1 1 1 1 1 1 0 1 0 0 0 1 0 1 0 1 1 1 0 1 1 1 0 1 1 0 1 0 0", "output": "58 queries, x=140644576" }, { "input": "1000000000 13 714193420\n0 1 0 0 0 1 0 0 0 0 1 1 1", "output": "43 queries, x=714193420" }, { "input": "1000000000 27 142518072\n0 0 0 1 0 1 1 0 1 0 1 0 0 1 1 0 1 1 1 1 0 1 0 0 1 0 0", "output": "52 queries, x=142518072" }, { "input": "1000000000 25 11034213\n0 0 1 0 1 1 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 0 1 0 0", "output": "54 queries, x=11034213" }, { "input": "1000000000 9 584583057\n1 1 1 0 0 1 0 0 0", "output": "35 queries, x=584583057" }, { "input": "1000000000 23 863164606\n1 1 0 1 0 1 0 1 0 1 0 0 1 0 0 0 1 1 1 0 0 1 1", "output": "53 queries, x=863164606" }, { "input": "1000000000 21 731680746\n1 1 0 0 1 1 1 1 1 0 0 1 0 1 1 1 1 0 1 0 1", "output": "51 queries, x=731680746" }, { "input": "1000000000 5 305229590\n0 0 1 1 0", "output": "35 queries, x=305229590" }, { "input": "1000000000 3 28521539\n0 0 1", "output": "31 queries, x=28521539" }, { "input": "1000000000 3 602070383\n0 1 1", "output": "32 queries, x=602070383" }, { "input": "1000000000 2 880651931\n1 1", "output": "30 queries, x=880651931" }, { "input": "1000000000 16 749168072\n1 1 0 0 0 1 0 0 1 1 1 1 1 1 1 0", "output": "46 queries, x=749168072" }, { "input": "1000000000 30 322716916\n1 0 1 1 1 1 0 1 1 0 1 0 0 0 1 0 0 0 0 0 1 1 0 0 1 1 1 1 0 0", "output": "58 queries, x=322716916" }, { "input": "1000000000 14 191233057\n0 0 1 0 0 1 1 1 1 0 0 0 1 1", "output": "43 queries, x=191233057" }, { "input": "1000000000 30 1\n1 1 0 1 1 0 0 1 0 1 1 0 0 1 1 1 0 0 1 1 0 0 0 0 0 1 0 0 0 0", "output": "1 queries, x=1" }, { "input": "1000000000 30 1\n1 0 1 1 1 1 1 1 0 1 0 0 1 1 0 0 1 0 1 0 1 0 1 1 1 0 0 1 1 1", "output": "1 queries, x=1" }, { "input": "1000000000 30 1\n1 0 1 0 0 0 0 1 1 0 0 1 1 0 1 1 1 0 1 0 1 1 1 0 0 0 1 0 1 1", "output": "1 queries, x=1" }, { "input": "1000000000 30 1\n1 0 1 0 0 0 1 1 1 0 1 1 1 1 0 0 0 0 0 1 0 1 0 1 1 0 0 1 1 1", "output": "1 queries, x=1" }, { "input": "1000000000 30 1\n1 1 0 1 1 1 1 1 0 0 1 1 1 0 1 1 0 0 0 0 0 1 1 0 0 0 1 0 0 0", "output": "1 queries, x=1" }, { "input": "1000000000 30 1000000000\n1 1 1 0 0 0 1 1 1 1 0 1 0 0 0 1 1 0 1 1 0 0 0 1 0 0 0 0 1 0", "output": "60 queries, x=1000000000" }, { "input": "1000000000 30 1000000000\n1 1 1 0 0 1 1 1 0 0 1 1 0 0 1 1 1 0 1 0 1 1 0 0 1 0 1 1 1 0", "output": "60 queries, x=1000000000" }, { "input": "1000000000 30 1000000000\n0 0 1 1 1 0 0 1 0 0 1 1 0 1 0 0 1 0 1 1 1 1 1 1 0 0 1 0 1 1", "output": "60 queries, x=1000000000" }, { "input": "1000000000 30 1000000000\n0 0 0 1 1 1 1 1 1 0 1 0 1 0 1 1 0 1 1 0 0 1 0 0 1 0 0 1 0 1", "output": "60 queries, x=1000000000" }, { "input": "1000000000 30 1000000000\n0 0 0 1 1 1 0 1 1 0 0 0 1 1 0 0 0 1 0 0 0 0 1 0 0 1 1 0 0 1", "output": "60 queries, x=1000000000" }, { "input": "1 30 1\n1 1 1 0 1 0 0 0 0 1 1 0 1 0 0 1 0 1 0 1 0 1 0 1 1 0 0 0 1 1", "output": "1 queries, x=1" }, { "input": "1 30 1\n1 1 0 0 0 1 1 0 0 0 0 0 1 0 1 0 0 1 0 0 1 0 1 0 0 0 1 1 0 0", "output": "1 queries, x=1" }, { "input": "1 30 1\n1 0 0 0 0 1 0 0 1 0 0 1 0 1 0 1 1 1 0 1 1 0 0 1 1 0 1 0 0 0", "output": "1 queries, x=1" }, { "input": "1 30 1\n1 0 1 1 1 0 0 0 0 0 0 1 0 0 1 0 1 1 0 1 0 0 0 0 0 1 0 1 0 0", "output": "1 queries, x=1" }, { "input": "1 30 1\n1 0 1 1 1 1 1 0 0 0 1 1 0 1 0 1 1 0 0 0 0 0 1 1 1 1 1 0 1 1", "output": "1 queries, x=1" }, { "input": "2 1 2\n1", "output": "2 queries, x=2" }, { "input": "1000000000 1 1000000000\n1", "output": "31 queries, x=1000000000" }, { "input": "10000 1 10000\n1", "output": "15 queries, x=10000" }, { "input": "1000000000 1 999999999\n1", "output": "30 queries, x=999999999" }, { "input": "100000 2 15\n1 0", "output": "19 queries, x=15" }, { "input": "200000 1 110000\n1", "output": "17 queries, x=110000" }, { "input": "123456789 1 42\n1", "output": "27 queries, x=42" }, { "input": "1000000000 1 9\n1", "output": "30 queries, x=9" }, { "input": "200000 2 100002\n1 0", "output": "19 queries, x=100002" }, { "input": "1000000000 3 234567890\n0 1 0", "output": "31 queries, x=234567890" }, { "input": "1000000000 5 321732193\n1 1 0 1 0", "output": "35 queries, x=321732193" }, { "input": "1000000000 1 804289384\n1", "output": "27 queries, x=804289384" }, { "input": "1000000000 2 999999998\n1 0", "output": "32 queries, x=999999998" }, { "input": "1000000000 5 384618761\n0 1 1 0 1", "output": "33 queries, x=384618761" }, { "input": "100000000 1 100\n0", "output": "28 queries, x=100" }, { "input": "1000000000 1 804289384\n0", "output": "27 queries, x=804289384" }, { "input": "100000000 1 100000000\n1", "output": "28 queries, x=100000000" }, { "input": "40 1 4\n0", "output": "6 queries, x=4" }, { "input": "1000000000 2 999999998\n0 1", "output": "32 queries, x=999999998" }, { "input": "1000000000 1 1000000000\n0", "output": "31 queries, x=1000000000" }, { "input": "1000000000 2 255555555\n1 0", "output": "31 queries, x=255555555" }, { "input": "1000000000 2 1000000000\n0 1", "output": "32 queries, x=1000000000" }, { "input": "1000000000 1 999999999\n0", "output": "30 queries, x=999999999" }, { "input": "1000000000 2 888888888\n0 1", "output": "31 queries, x=888888888" }, { "input": "1000000000 1 77000000\n1", "output": "31 queries, x=77000000" }, { "input": "1000000000 1 123456789\n1", "output": "27 queries, x=123456789" }, { "input": "10000 1 228\n0", "output": "14 queries, x=228" }, { "input": "1000000000 1 12345\n1", "output": "31 queries, x=12345" }, { "input": "1000000000 1 77000000\n0", "output": "31 queries, x=77000000" }, { "input": "1000000000 1 23333\n0", "output": "31 queries, x=23333" }, { "input": "1000000000 4 100\n0 1 0 1", "output": "34 queries, x=100" }, { "input": "100000000 1 200\n1", "output": "27 queries, x=200" }, { "input": "1000000000 3 5\n0 1 0", "output": "33 queries, x=5" }, { "input": "1000000000 12 2\n1 1 1 1 1 1 0 0 1 1 1 1", "output": "41 queries, x=2" }, { "input": "1000000000 1 5\n0", "output": "31 queries, x=5" }, { "input": "100000 2 99999\n0 0", "output": "18 queries, x=99999" }, { "input": "100000 2 2\n0 1", "output": "18 queries, x=2" }, { "input": "1000000 1 91923\n0", "output": "21 queries, x=91923" }, { "input": "1000000 2 1235\n0 1", "output": "22 queries, x=1235" }, { "input": "1000000000 1 5\n1", "output": "31 queries, x=5" }, { "input": "100000000 2 1234567\n0 1", "output": "28 queries, x=1234567" }, { "input": "1000000000 1 1\n1", "output": "1 queries, x=1" }, { "input": "1000000000 4 999999999\n1 0 0 1", "output": "33 queries, x=999999999" }, { "input": "1000000000 4 1000000000\n1 0 1 0", "output": "34 queries, x=1000000000" }, { "input": "1000000000 4 1\n1 0 1 0", "output": "1 queries, x=1" }, { "input": "1000000000 5 500\n1 1 0 0 1", "output": "34 queries, x=500" }, { "input": "1000 1 13\n1", "output": "11 queries, x=13" }, { "input": "999999999 2 123456789\n1 0", "output": "31 queries, x=123456789" }, { "input": "1000000000 5 1000000000\n1 1 1 1 1", "output": "35 queries, x=1000000000" }, { "input": "1000000000 3 123456789\n1 0 1", "output": "29 queries, x=123456789" }, { "input": "1000000000 1 123\n1", "output": "29 queries, x=123" }, { "input": "10 1 9\n1", "output": "4 queries, x=9" }, { "input": "1000000000 1 1\n0", "output": "1 queries, x=1" }, { "input": "100000000 2 12345678\n0 1", "output": "28 queries, x=12345678" }, { "input": "1000000000 30 1000000000\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "60 queries, x=1000000000" }, { "input": "805306369 30 805306369\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "60 queries, x=805306369" }, { "input": "1000000000 2 123\n0 1", "output": "30 queries, x=123" }, { "input": "1000000000 1 9\n0", "output": "30 queries, x=9" }, { "input": "100000 2 90000\n1 0", "output": "18 queries, x=90000" }, { "input": "1000000000 2 123456789\n1 0", "output": "28 queries, x=123456789" }, { "input": "1000000000 2 804289384\n1 0", "output": "28 queries, x=804289384" }, { "input": "1000000000 30 999999970\n1 0 0 1 1 1 1 0 1 1 0 0 0 0 0 1 0 0 1 1 0 0 0 1 0 1 0 0 0 1", "output": "60 queries, x=999999970" } ]
1,536,157,317
1,737
Python 3
OK
TESTS
135
124
307,200
from sys import stdout m, n = map(int, input().split(' ')) ts = [False] * n for i in range(n): print(1) stdout.flush() ans = int(input()) if ans == 0: exit(0) ts[i] = ans > 0 l = 1 r = m j = 0 while True: i = j % n m = (l + r) // 2 print(m) stdout.flush() ans = int(input()) if ans == 0: exit(0) if not ts[i]: ans = -ans if ans > 0: l = m + 1 else: r = m - 1 j += 1
Title: Rocket Time Limit: None seconds Memory Limit: None megabytes Problem Description: This is an interactive problem. Natasha is going to fly to Mars. Finally, Natasha sat in the rocket. She flies, flies... but gets bored. She wishes to arrive to Mars already! So she decides to find something to occupy herself. She couldn't think of anything better to do than to calculate the distance to the red planet. Let's define $x$ as the distance to Mars. Unfortunately, Natasha does not know $x$. But it is known that $1 \le x \le m$, where Natasha knows the number $m$. Besides, $x$ and $m$ are positive integers. Natasha can ask the rocket questions. Every question is an integer $y$ ($1 \le y \le m$). The correct answer to the question is $-1$, if $x&lt;y$, $0$, if $x=y$, and $1$, if $x&gt;y$. But the rocket is broken — it does not always answer correctly. Precisely: let the correct answer to the current question be equal to $t$, then, if the rocket answers this question correctly, then it will answer $t$, otherwise it will answer $-t$. In addition, the rocket has a sequence $p$ of length $n$. Each element of the sequence is either $0$ or $1$. The rocket processes this sequence in the cyclic order, that is $1$-st element, $2$-nd, $3$-rd, $\ldots$, $(n-1)$-th, $n$-th, $1$-st, $2$-nd, $3$-rd, $\ldots$, $(n-1)$-th, $n$-th, $\ldots$. If the current element is $1$, the rocket answers correctly, if $0$ — lies. Natasha doesn't know the sequence $p$, but she knows its length — $n$. You can ask the rocket no more than $60$ questions. Help Natasha find the distance to Mars. Assume, that the distance to Mars does not change while Natasha is asking questions. Your solution will not be accepted, if it does not receive an answer $0$ from the rocket (even if the distance to Mars is uniquely determined by the already received rocket's answers). Input Specification: The first line contains two integers $m$ and $n$ ($1 \le m \le 10^9$, $1 \le n \le 30$) — the maximum distance to Mars and the number of elements in the sequence $p$. Output Specification: none Demo Input: ['5 2\n1\n-1\n-1\n1\n0\n'] Demo Output: ['1\n2\n4\n5\n3\n'] Note: In the example, hacking would look like this: 5 2 3 1 0 This means that the current distance to Mars is equal to $3$, Natasha knows that it does not exceed $5$, and the rocket answers in order: correctly, incorrectly, correctly, incorrectly ... Really: on the first query ($1$) the correct answer is $1$, the rocket answered correctly: $1$; on the second query ($2$) the correct answer is $1$, the rocket answered incorrectly: $-1$; on the third query ($4$) the correct answer is $-1$, the rocket answered correctly: $-1$; on the fourth query ($5$) the correct answer is $-1$, the rocket answered incorrectly: $1$; on the fifth query ($3$) the correct and incorrect answer is $0$.
```python from sys import stdout m, n = map(int, input().split(' ')) ts = [False] * n for i in range(n): print(1) stdout.flush() ans = int(input()) if ans == 0: exit(0) ts[i] = ans > 0 l = 1 r = m j = 0 while True: i = j % n m = (l + r) // 2 print(m) stdout.flush() ans = int(input()) if ans == 0: exit(0) if not ts[i]: ans = -ans if ans > 0: l = m + 1 else: r = m - 1 j += 1 ```
3
334
A
Candy Bags
PROGRAMMING
1,000
[ "implementation" ]
null
null
Gerald has *n* younger brothers and their number happens to be even. One day he bought *n*2 candy bags. One bag has one candy, one bag has two candies, one bag has three candies and so on. In fact, for each integer *k* from 1 to *n*2 he has exactly one bag with *k* candies. Help him give *n* bags of candies to each brother so that all brothers got the same number of candies.
The single line contains a single integer *n* (*n* is even, 2<=≤<=*n*<=≤<=100) — the number of Gerald's brothers.
Let's assume that Gerald indexes his brothers with numbers from 1 to *n*. You need to print *n* lines, on the *i*-th line print *n* integers — the numbers of candies in the bags for the *i*-th brother. Naturally, all these numbers should be distinct and be within limits from 1 to *n*2. You can print the numbers in the lines in any order. It is guaranteed that the solution exists at the given limits.
[ "2\n" ]
[ "1 4\n2 3\n" ]
The sample shows Gerald's actions if he has two brothers. In this case, his bags contain 1, 2, 3 and 4 candies. He can give the bags with 1 and 4 candies to one brother and the bags with 2 and 3 to the other brother.
500
[ { "input": "2", "output": "1 4\n2 3" }, { "input": "4", "output": "1 16 2 15\n3 14 4 13\n5 12 6 11\n7 10 8 9" }, { "input": "6", "output": "1 36 2 35 3 34\n4 33 5 32 6 31\n7 30 8 29 9 28\n10 27 11 26 12 25\n13 24 14 23 15 22\n16 21 17 20 18 19" }, { "input": "8", "output": "1 64 2 63 3 62 4 61\n5 60 6 59 7 58 8 57\n9 56 10 55 11 54 12 53\n13 52 14 51 15 50 16 49\n17 48 18 47 19 46 20 45\n21 44 22 43 23 42 24 41\n25 40 26 39 27 38 28 37\n29 36 30 35 31 34 32 33" }, { "input": "10", "output": "1 100 2 99 3 98 4 97 5 96\n6 95 7 94 8 93 9 92 10 91\n11 90 12 89 13 88 14 87 15 86\n16 85 17 84 18 83 19 82 20 81\n21 80 22 79 23 78 24 77 25 76\n26 75 27 74 28 73 29 72 30 71\n31 70 32 69 33 68 34 67 35 66\n36 65 37 64 38 63 39 62 40 61\n41 60 42 59 43 58 44 57 45 56\n46 55 47 54 48 53 49 52 50 51" }, { "input": "100", "output": "1 10000 2 9999 3 9998 4 9997 5 9996 6 9995 7 9994 8 9993 9 9992 10 9991 11 9990 12 9989 13 9988 14 9987 15 9986 16 9985 17 9984 18 9983 19 9982 20 9981 21 9980 22 9979 23 9978 24 9977 25 9976 26 9975 27 9974 28 9973 29 9972 30 9971 31 9970 32 9969 33 9968 34 9967 35 9966 36 9965 37 9964 38 9963 39 9962 40 9961 41 9960 42 9959 43 9958 44 9957 45 9956 46 9955 47 9954 48 9953 49 9952 50 9951\n51 9950 52 9949 53 9948 54 9947 55 9946 56 9945 57 9944 58 9943 59 9942 60 9941 61 9940 62 9939 63 9938 64 9937 65 993..." }, { "input": "62", "output": "1 3844 2 3843 3 3842 4 3841 5 3840 6 3839 7 3838 8 3837 9 3836 10 3835 11 3834 12 3833 13 3832 14 3831 15 3830 16 3829 17 3828 18 3827 19 3826 20 3825 21 3824 22 3823 23 3822 24 3821 25 3820 26 3819 27 3818 28 3817 29 3816 30 3815 31 3814\n32 3813 33 3812 34 3811 35 3810 36 3809 37 3808 38 3807 39 3806 40 3805 41 3804 42 3803 43 3802 44 3801 45 3800 46 3799 47 3798 48 3797 49 3796 50 3795 51 3794 52 3793 53 3792 54 3791 55 3790 56 3789 57 3788 58 3787 59 3786 60 3785 61 3784 62 3783\n63 3782 64 3781 65 378..." }, { "input": "66", "output": "1 4356 2 4355 3 4354 4 4353 5 4352 6 4351 7 4350 8 4349 9 4348 10 4347 11 4346 12 4345 13 4344 14 4343 15 4342 16 4341 17 4340 18 4339 19 4338 20 4337 21 4336 22 4335 23 4334 24 4333 25 4332 26 4331 27 4330 28 4329 29 4328 30 4327 31 4326 32 4325 33 4324\n34 4323 35 4322 36 4321 37 4320 38 4319 39 4318 40 4317 41 4316 42 4315 43 4314 44 4313 45 4312 46 4311 47 4310 48 4309 49 4308 50 4307 51 4306 52 4305 53 4304 54 4303 55 4302 56 4301 57 4300 58 4299 59 4298 60 4297 61 4296 62 4295 63 4294 64 4293 65 4292..." }, { "input": "18", "output": "1 324 2 323 3 322 4 321 5 320 6 319 7 318 8 317 9 316\n10 315 11 314 12 313 13 312 14 311 15 310 16 309 17 308 18 307\n19 306 20 305 21 304 22 303 23 302 24 301 25 300 26 299 27 298\n28 297 29 296 30 295 31 294 32 293 33 292 34 291 35 290 36 289\n37 288 38 287 39 286 40 285 41 284 42 283 43 282 44 281 45 280\n46 279 47 278 48 277 49 276 50 275 51 274 52 273 53 272 54 271\n55 270 56 269 57 268 58 267 59 266 60 265 61 264 62 263 63 262\n64 261 65 260 66 259 67 258 68 257 69 256 70 255 71 254 72 253\n73 252 7..." }, { "input": "68", "output": "1 4624 2 4623 3 4622 4 4621 5 4620 6 4619 7 4618 8 4617 9 4616 10 4615 11 4614 12 4613 13 4612 14 4611 15 4610 16 4609 17 4608 18 4607 19 4606 20 4605 21 4604 22 4603 23 4602 24 4601 25 4600 26 4599 27 4598 28 4597 29 4596 30 4595 31 4594 32 4593 33 4592 34 4591\n35 4590 36 4589 37 4588 38 4587 39 4586 40 4585 41 4584 42 4583 43 4582 44 4581 45 4580 46 4579 47 4578 48 4577 49 4576 50 4575 51 4574 52 4573 53 4572 54 4571 55 4570 56 4569 57 4568 58 4567 59 4566 60 4565 61 4564 62 4563 63 4562 64 4561 65 4560..." }, { "input": "86", "output": "1 7396 2 7395 3 7394 4 7393 5 7392 6 7391 7 7390 8 7389 9 7388 10 7387 11 7386 12 7385 13 7384 14 7383 15 7382 16 7381 17 7380 18 7379 19 7378 20 7377 21 7376 22 7375 23 7374 24 7373 25 7372 26 7371 27 7370 28 7369 29 7368 30 7367 31 7366 32 7365 33 7364 34 7363 35 7362 36 7361 37 7360 38 7359 39 7358 40 7357 41 7356 42 7355 43 7354\n44 7353 45 7352 46 7351 47 7350 48 7349 49 7348 50 7347 51 7346 52 7345 53 7344 54 7343 55 7342 56 7341 57 7340 58 7339 59 7338 60 7337 61 7336 62 7335 63 7334 64 7333 65 7332..." }, { "input": "96", "output": "1 9216 2 9215 3 9214 4 9213 5 9212 6 9211 7 9210 8 9209 9 9208 10 9207 11 9206 12 9205 13 9204 14 9203 15 9202 16 9201 17 9200 18 9199 19 9198 20 9197 21 9196 22 9195 23 9194 24 9193 25 9192 26 9191 27 9190 28 9189 29 9188 30 9187 31 9186 32 9185 33 9184 34 9183 35 9182 36 9181 37 9180 38 9179 39 9178 40 9177 41 9176 42 9175 43 9174 44 9173 45 9172 46 9171 47 9170 48 9169\n49 9168 50 9167 51 9166 52 9165 53 9164 54 9163 55 9162 56 9161 57 9160 58 9159 59 9158 60 9157 61 9156 62 9155 63 9154 64 9153 65 9152..." }, { "input": "12", "output": "1 144 2 143 3 142 4 141 5 140 6 139\n7 138 8 137 9 136 10 135 11 134 12 133\n13 132 14 131 15 130 16 129 17 128 18 127\n19 126 20 125 21 124 22 123 23 122 24 121\n25 120 26 119 27 118 28 117 29 116 30 115\n31 114 32 113 33 112 34 111 35 110 36 109\n37 108 38 107 39 106 40 105 41 104 42 103\n43 102 44 101 45 100 46 99 47 98 48 97\n49 96 50 95 51 94 52 93 53 92 54 91\n55 90 56 89 57 88 58 87 59 86 60 85\n61 84 62 83 63 82 64 81 65 80 66 79\n67 78 68 77 69 76 70 75 71 74 72 73" }, { "input": "88", "output": "1 7744 2 7743 3 7742 4 7741 5 7740 6 7739 7 7738 8 7737 9 7736 10 7735 11 7734 12 7733 13 7732 14 7731 15 7730 16 7729 17 7728 18 7727 19 7726 20 7725 21 7724 22 7723 23 7722 24 7721 25 7720 26 7719 27 7718 28 7717 29 7716 30 7715 31 7714 32 7713 33 7712 34 7711 35 7710 36 7709 37 7708 38 7707 39 7706 40 7705 41 7704 42 7703 43 7702 44 7701\n45 7700 46 7699 47 7698 48 7697 49 7696 50 7695 51 7694 52 7693 53 7692 54 7691 55 7690 56 7689 57 7688 58 7687 59 7686 60 7685 61 7684 62 7683 63 7682 64 7681 65 7680..." }, { "input": "28", "output": "1 784 2 783 3 782 4 781 5 780 6 779 7 778 8 777 9 776 10 775 11 774 12 773 13 772 14 771\n15 770 16 769 17 768 18 767 19 766 20 765 21 764 22 763 23 762 24 761 25 760 26 759 27 758 28 757\n29 756 30 755 31 754 32 753 33 752 34 751 35 750 36 749 37 748 38 747 39 746 40 745 41 744 42 743\n43 742 44 741 45 740 46 739 47 738 48 737 49 736 50 735 51 734 52 733 53 732 54 731 55 730 56 729\n57 728 58 727 59 726 60 725 61 724 62 723 63 722 64 721 65 720 66 719 67 718 68 717 69 716 70 715\n71 714 72 713 73 712 74 7..." }, { "input": "80", "output": "1 6400 2 6399 3 6398 4 6397 5 6396 6 6395 7 6394 8 6393 9 6392 10 6391 11 6390 12 6389 13 6388 14 6387 15 6386 16 6385 17 6384 18 6383 19 6382 20 6381 21 6380 22 6379 23 6378 24 6377 25 6376 26 6375 27 6374 28 6373 29 6372 30 6371 31 6370 32 6369 33 6368 34 6367 35 6366 36 6365 37 6364 38 6363 39 6362 40 6361\n41 6360 42 6359 43 6358 44 6357 45 6356 46 6355 47 6354 48 6353 49 6352 50 6351 51 6350 52 6349 53 6348 54 6347 55 6346 56 6345 57 6344 58 6343 59 6342 60 6341 61 6340 62 6339 63 6338 64 6337 65 6336..." }, { "input": "48", "output": "1 2304 2 2303 3 2302 4 2301 5 2300 6 2299 7 2298 8 2297 9 2296 10 2295 11 2294 12 2293 13 2292 14 2291 15 2290 16 2289 17 2288 18 2287 19 2286 20 2285 21 2284 22 2283 23 2282 24 2281\n25 2280 26 2279 27 2278 28 2277 29 2276 30 2275 31 2274 32 2273 33 2272 34 2271 35 2270 36 2269 37 2268 38 2267 39 2266 40 2265 41 2264 42 2263 43 2262 44 2261 45 2260 46 2259 47 2258 48 2257\n49 2256 50 2255 51 2254 52 2253 53 2252 54 2251 55 2250 56 2249 57 2248 58 2247 59 2246 60 2245 61 2244 62 2243 63 2242 64 2241 65 224..." }, { "input": "54", "output": "1 2916 2 2915 3 2914 4 2913 5 2912 6 2911 7 2910 8 2909 9 2908 10 2907 11 2906 12 2905 13 2904 14 2903 15 2902 16 2901 17 2900 18 2899 19 2898 20 2897 21 2896 22 2895 23 2894 24 2893 25 2892 26 2891 27 2890\n28 2889 29 2888 30 2887 31 2886 32 2885 33 2884 34 2883 35 2882 36 2881 37 2880 38 2879 39 2878 40 2877 41 2876 42 2875 43 2874 44 2873 45 2872 46 2871 47 2870 48 2869 49 2868 50 2867 51 2866 52 2865 53 2864 54 2863\n55 2862 56 2861 57 2860 58 2859 59 2858 60 2857 61 2856 62 2855 63 2854 64 2853 65 285..." }, { "input": "58", "output": "1 3364 2 3363 3 3362 4 3361 5 3360 6 3359 7 3358 8 3357 9 3356 10 3355 11 3354 12 3353 13 3352 14 3351 15 3350 16 3349 17 3348 18 3347 19 3346 20 3345 21 3344 22 3343 23 3342 24 3341 25 3340 26 3339 27 3338 28 3337 29 3336\n30 3335 31 3334 32 3333 33 3332 34 3331 35 3330 36 3329 37 3328 38 3327 39 3326 40 3325 41 3324 42 3323 43 3322 44 3321 45 3320 46 3319 47 3318 48 3317 49 3316 50 3315 51 3314 52 3313 53 3312 54 3311 55 3310 56 3309 57 3308 58 3307\n59 3306 60 3305 61 3304 62 3303 63 3302 64 3301 65 330..." }, { "input": "64", "output": "1 4096 2 4095 3 4094 4 4093 5 4092 6 4091 7 4090 8 4089 9 4088 10 4087 11 4086 12 4085 13 4084 14 4083 15 4082 16 4081 17 4080 18 4079 19 4078 20 4077 21 4076 22 4075 23 4074 24 4073 25 4072 26 4071 27 4070 28 4069 29 4068 30 4067 31 4066 32 4065\n33 4064 34 4063 35 4062 36 4061 37 4060 38 4059 39 4058 40 4057 41 4056 42 4055 43 4054 44 4053 45 4052 46 4051 47 4050 48 4049 49 4048 50 4047 51 4046 52 4045 53 4044 54 4043 55 4042 56 4041 57 4040 58 4039 59 4038 60 4037 61 4036 62 4035 63 4034 64 4033\n65 403..." }, { "input": "44", "output": "1 1936 2 1935 3 1934 4 1933 5 1932 6 1931 7 1930 8 1929 9 1928 10 1927 11 1926 12 1925 13 1924 14 1923 15 1922 16 1921 17 1920 18 1919 19 1918 20 1917 21 1916 22 1915\n23 1914 24 1913 25 1912 26 1911 27 1910 28 1909 29 1908 30 1907 31 1906 32 1905 33 1904 34 1903 35 1902 36 1901 37 1900 38 1899 39 1898 40 1897 41 1896 42 1895 43 1894 44 1893\n45 1892 46 1891 47 1890 48 1889 49 1888 50 1887 51 1886 52 1885 53 1884 54 1883 55 1882 56 1881 57 1880 58 1879 59 1878 60 1877 61 1876 62 1875 63 1874 64 1873 65 187..." } ]
1,493,401,591
2,147,483,647
Python 3
OK
TESTS
21
124
5,529,600
n=int(input()) l,h=1,n**2 for i in range(n): s="" for j in range(n//2):s+=str(l)+' '+str(h)+' ';l+=1;h-=1 print(s)
Title: Candy Bags Time Limit: None seconds Memory Limit: None megabytes Problem Description: Gerald has *n* younger brothers and their number happens to be even. One day he bought *n*2 candy bags. One bag has one candy, one bag has two candies, one bag has three candies and so on. In fact, for each integer *k* from 1 to *n*2 he has exactly one bag with *k* candies. Help him give *n* bags of candies to each brother so that all brothers got the same number of candies. Input Specification: The single line contains a single integer *n* (*n* is even, 2<=≤<=*n*<=≤<=100) — the number of Gerald's brothers. Output Specification: Let's assume that Gerald indexes his brothers with numbers from 1 to *n*. You need to print *n* lines, on the *i*-th line print *n* integers — the numbers of candies in the bags for the *i*-th brother. Naturally, all these numbers should be distinct and be within limits from 1 to *n*2. You can print the numbers in the lines in any order. It is guaranteed that the solution exists at the given limits. Demo Input: ['2\n'] Demo Output: ['1 4\n2 3\n'] Note: The sample shows Gerald's actions if he has two brothers. In this case, his bags contain 1, 2, 3 and 4 candies. He can give the bags with 1 and 4 candies to one brother and the bags with 2 and 3 to the other brother.
```python n=int(input()) l,h=1,n**2 for i in range(n): s="" for j in range(n//2):s+=str(l)+' '+str(h)+' ';l+=1;h-=1 print(s) ```
3
894
A
QAQ
PROGRAMMING
800
[ "brute force", "dp" ]
null
null
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth. Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!). Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
Print a single integer — the number of subsequences "QAQ" in the string.
[ "QAQAQYSYIOIWIN\n", "QAQQQZZYNOIWIN\n" ]
[ "4\n", "3\n" ]
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
500
[ { "input": "QAQAQYSYIOIWIN", "output": "4" }, { "input": "QAQQQZZYNOIWIN", "output": "3" }, { "input": "QA", "output": "0" }, { "input": "IAQVAQZLQBQVQFTQQQADAQJA", "output": "24" }, { "input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ", "output": "378" }, { "input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ", "output": "1077" }, { "input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA", "output": "568" }, { "input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA", "output": "70" }, { "input": "W", "output": "0" }, { "input": "DBA", "output": "0" }, { "input": "RQAWNACASAAKAGAAAAQ", "output": "10" }, { "input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA", "output": "111" }, { "input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA", "output": "411" }, { "input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ", "output": "625" }, { "input": "QORZOYAQ", "output": "1" }, { "input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA", "output": "13174" }, { "input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT", "output": "10420" }, { "input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ", "output": "12488" }, { "input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA", "output": "9114" }, { "input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ", "output": "35937" }, { "input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE", "output": "254" }, { "input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE", "output": "2174" }, { "input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ", "output": "2962" }, { "input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA", "output": "2482" }, { "input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ", "output": "7768" }, { "input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA", "output": "5422" }, { "input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ", "output": "3024" }, { "input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ", "output": "4527" }, { "input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH", "output": "6416" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA", "output": "14270" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ", "output": "13136" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA", "output": "14270" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA", "output": "14231" }, { "input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA", "output": "15296" }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ", "output": "0" }, { "input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "0" }, { "input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ", "output": "0" }, { "input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA", "output": "20825" }, { "input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ", "output": "20825" }, { "input": "Q", "output": "0" }, { "input": "A", "output": "0" }, { "input": "FFF", "output": "0" }, { "input": "AAAAAA", "output": "0" } ]
1,612,803,887
2,147,483,647
PyPy 3
OK
TESTS
43
109
0
def count(a,b): m = len(a) n = len(b) lookup = [[0] * (n+1) for i in range(m+1)] # print(lookup) for i in range(n+1): lookup[0][i] = 0 # print(lookup) for i in range(m+1): lookup[i][0] = 1 # print(lookup) for i in range(1,m+1): for j in range(1,n+1): if a[i-1] == b[j-1]: lookup[i][j] = lookup[i-1][j-1] + lookup[i-1][j] else: lookup[i][j] = lookup[i-1][j] return lookup[m][n] a = input() b = "QAQ" print(count(a,b))
Title: QAQ Time Limit: None seconds Memory Limit: None megabytes Problem Description: "QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth. Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!). Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact. Input Specification: The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters. Output Specification: Print a single integer — the number of subsequences "QAQ" in the string. Demo Input: ['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n'] Demo Output: ['4\n', '3\n'] Note: In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
```python def count(a,b): m = len(a) n = len(b) lookup = [[0] * (n+1) for i in range(m+1)] # print(lookup) for i in range(n+1): lookup[0][i] = 0 # print(lookup) for i in range(m+1): lookup[i][0] = 1 # print(lookup) for i in range(1,m+1): for j in range(1,n+1): if a[i-1] == b[j-1]: lookup[i][j] = lookup[i-1][j-1] + lookup[i-1][j] else: lookup[i][j] = lookup[i-1][j] return lookup[m][n] a = input() b = "QAQ" print(count(a,b)) ```
3
691
A
Fashion in Berland
PROGRAMMING
1,000
[ "implementation" ]
null
null
According to rules of the Berland fashion, a jacket should be fastened by all the buttons except only one, but not necessarily it should be the last one. Also if the jacket has only one button, it should be fastened, so the jacket will not swinging open. You are given a jacket with *n* buttons. Determine if it is fastened in a right way.
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of buttons on the jacket. The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=1). The number *a**i*<==<=0 if the *i*-th button is not fastened. Otherwise *a**i*<==<=1.
In the only line print the word "YES" if the jacket is fastened in a right way. Otherwise print the word "NO".
[ "3\n1 0 1\n", "3\n1 0 0\n" ]
[ "YES\n", "NO\n" ]
none
0
[ { "input": "3\n1 0 1", "output": "YES" }, { "input": "3\n1 0 0", "output": "NO" }, { "input": "3\n1 1 0", "output": "YES" }, { "input": "3\n1 1 1", "output": "NO" }, { "input": "3\n0 0 1", "output": "NO" }, { "input": "3\n0 0 0", "output": "NO" }, { "input": "3\n0 1 1", "output": "YES" }, { "input": "3\n0 1 0", "output": "NO" }, { "input": "2\n0 1", "output": "YES" }, { "input": "2\n1 0", "output": "YES" }, { "input": "2\n0 0", "output": "NO" }, { "input": "2\n1 1", "output": "NO" }, { "input": "1\n1", "output": "YES" }, { "input": "1\n0", "output": "NO" }, { "input": "10\n1 0 1 1 1 1 1 1 1 1", "output": "YES" }, { "input": "5\n1 1 1 1 0", "output": "YES" }, { "input": "4\n1 0 1 0", "output": "NO" }, { "input": "4\n1 1 0 0", "output": "NO" }, { "input": "10\n0 0 1 1 1 1 1 1 1 1", "output": "NO" }, { "input": "10\n1 1 1 1 1 1 1 1 1 1", "output": "NO" }, { "input": "123\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "NO" }, { "input": "124\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "NO" }, { "input": "94\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "NO" }, { "input": "64\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "NO" }, { "input": "34\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "NO" }, { "input": "35\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "NO" }, { "input": "5\n1 1 1 1 1", "output": "NO" }, { "input": "10\n0 0 0 0 0 0 0 0 0 0", "output": "NO" }, { "input": "231\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "NO" }, { "input": "10\n1 1 0 1 1 1 0 1 1 1", "output": "NO" } ]
1,565,889,690
2,147,483,647
Python 3
OK
TESTS
83
124
0
a = (input(), input())[1].split() flag = a.count('0') == 1 and len(a) != 1 or a == ['1'] print('YNEOS'[not flag:: 2])
Title: Fashion in Berland Time Limit: None seconds Memory Limit: None megabytes Problem Description: According to rules of the Berland fashion, a jacket should be fastened by all the buttons except only one, but not necessarily it should be the last one. Also if the jacket has only one button, it should be fastened, so the jacket will not swinging open. You are given a jacket with *n* buttons. Determine if it is fastened in a right way. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of buttons on the jacket. The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=1). The number *a**i*<==<=0 if the *i*-th button is not fastened. Otherwise *a**i*<==<=1. Output Specification: In the only line print the word "YES" if the jacket is fastened in a right way. Otherwise print the word "NO". Demo Input: ['3\n1 0 1\n', '3\n1 0 0\n'] Demo Output: ['YES\n', 'NO\n'] Note: none
```python a = (input(), input())[1].split() flag = a.count('0') == 1 and len(a) != 1 or a == ['1'] print('YNEOS'[not flag:: 2]) ```
3
552
D
Vanya and Triangles
PROGRAMMING
1,900
[ "brute force", "combinatorics", "data structures", "geometry", "math", "sortings" ]
null
null
Vanya got bored and he painted *n* distinct points on the plane. After that he connected all the points pairwise and saw that as a result many triangles were formed with vertices in the painted points. He asks you to count the number of the formed triangles with the non-zero area.
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000) — the number of the points painted on the plane. Next *n* lines contain two integers each *x**i*,<=*y**i* (<=-<=100<=≤<=*x**i*,<=*y**i*<=≤<=100) — the coordinates of the *i*-th point. It is guaranteed that no two given points coincide.
In the first line print an integer — the number of triangles with the non-zero area among the painted points.
[ "4\n0 0\n1 1\n2 0\n2 2\n", "3\n0 0\n1 1\n2 0\n", "1\n1 1\n" ]
[ "3\n", "1\n", "0\n" ]
Note to the first sample test. There are 3 triangles formed: (0, 0) - (1, 1) - (2, 0); (0, 0) - (2, 2) - (2, 0); (1, 1) - (2, 2) - (2, 0). Note to the second sample test. There is 1 triangle formed: (0, 0) - (1, 1) - (2, 0). Note to the third sample test. A single point doesn't form a single triangle.
2,000
[ { "input": "4\n0 0\n1 1\n2 0\n2 2", "output": "3" }, { "input": "3\n0 0\n1 1\n2 0", "output": "1" }, { "input": "1\n1 1", "output": "0" }, { "input": "5\n0 0\n1 1\n2 2\n3 3\n4 4", "output": "0" }, { "input": "5\n0 0\n1 1\n2 3\n3 6\n4 10", "output": "10" }, { "input": "4\n-100 -100\n-100 100\n100 -100\n100 100", "output": "4" }, { "input": "5\n-100 -100\n-100 100\n100 -100\n100 100\n0 0", "output": "8" }, { "input": "4\n1 -100\n2 -100\n100 -99\n99 -99", "output": "4" }, { "input": "25\n26 -54\n16 56\n-42 -51\n92 -58\n100 52\n57 -98\n-84 -28\n-71 12\n21 -82\n-3 -30\n72 94\n-66 96\n-50 -41\n-77 -41\n-42 -55\n-13 12\n0 -99\n-50 -5\n65 -48\n-96 -80\n73 -92\n72 59\n53 -66\n-67 -75\n2 56", "output": "2300" }, { "input": "5\n-62 -69\n3 -48\n54 54\n8 94\n83 94", "output": "10" }, { "input": "33\n0 81\n20 -16\n-71 38\n-45 28\n-8 -40\n34 -49\n43 -10\n-40 19\n14 -50\n-95 8\n-21 85\n64 98\n-97 -82\n19 -83\n39 -99\n43 71\n67 43\n-54 57\n-7 24\n83 -76\n54 -88\n-43 -9\n-75 24\n74 32\n-68 -1\n71 84\n88 80\n52 67\n-64 21\n-85 97\n33 13\n41 -28\n0 74", "output": "5456" }, { "input": "61\n37 -96\n36 -85\n30 -53\n-98 -40\n2 3\n-88 -69\n88 -26\n78 -69\n48 -3\n-41 66\n-93 -58\n-51 59\n21 -2\n65 29\n-3 35\n-98 46\n42 38\n0 -99\n46 84\n39 -48\n-15 81\n-15 51\n-77 74\n81 -58\n26 -35\n-14 20\n73 74\n-45 83\n90 22\n-8 53\n1 -52\n20 58\n39 -22\n60 -10\n52 22\n-46 6\n8 8\n14 9\n38 -45\n82 13\n43 4\n-25 21\n50 -16\n31 -12\n76 -13\n-82 -2\n-5 -56\n87 -31\n9 -36\n-100 92\n-10 39\n-16 2\n62 -39\n-36 60\n14 21\n-62 40\n98 43\n-54 66\n-34 46\n-47 -65\n21 44", "output": "35985" }, { "input": "9\n-41 -22\n95 53\n81 -61\n22 -74\n-79 38\n-56 -32\n100 -32\n-37 -94\n-59 -9", "output": "84" }, { "input": "33\n21 -99\n11 85\n80 -77\n-31 59\n32 6\n24 -52\n-32 -47\n57 18\n76 -36\n96 -38\n-59 -12\n-98 -32\n-52 32\n-73 -87\n-51 -40\n34 -55\n69 46\n-88 -67\n-68 65\n60 -11\n-45 -41\n91 -21\n45 21\n-75 49\n58 65\n-20 81\n-24 29\n66 -71\n-25 50\n96 74\n-43 -47\n34 -86\n81 14", "output": "5455" }, { "input": "61\n83 52\n28 91\n-45 -68\n-84 -8\n-59 -28\n-98 -72\n38 -38\n-51 -96\n-66 11\n-76 45\n95 45\n-89 5\n-60 -66\n73 26\n9 94\n-5 -80\n44 41\n66 -22\n61 26\n-58 -84\n62 -73\n18 63\n44 71\n32 -41\n-50 -69\n-30 17\n61 47\n45 70\n-97 76\n-27 31\n2 -12\n-87 -75\n-80 -82\n-47 50\n45 -23\n71 54\n79 -7\n35 22\n19 -53\n-65 -72\n-69 68\n-53 48\n-73 -15\n29 38\n-49 -47\n12 -30\n-21 -59\n-28 -11\n-73 -60\n99 74\n32 30\n-9 -7\n-82 95\n58 -32\n39 64\n-42 9\n-21 -76\n39 33\n-63 59\n-66 41\n-54 -69", "output": "35985" }, { "input": "62\n-53 -58\n29 89\n-92 15\n-91 -19\n96 23\n-1 -57\n-83 11\n56 -95\n-39 -47\n-75 77\n52 -95\n-13 -12\n-51 80\n32 -78\n94 94\n-51 81\n53 -28\n-83 -78\n76 -25\n91 -60\n-40 -27\n55 86\n-26 1\n-41 89\n61 -23\n81 31\n-21 82\n-12 47\n20 36\n-95 54\n-81 73\n-19 -83\n52 51\n-60 68\n-58 35\n60 -38\n-98 32\n-10 60\n88 -5\n78 -57\n-12 -43\n-83 36\n51 -63\n-89 -5\n-62 -42\n-29 78\n73 62\n-88 -55\n34 38\n88 -26\n-26 -89\n40 -26\n46 63\n74 -66\n-61 -61\n82 -53\n-75 -62\n-99 -52\n-15 30\n38 -52\n-83 -75\n-31 -38", "output": "37814" }, { "input": "2\n0 0\n1 1", "output": "0" }, { "input": "50\n0 -26\n0 -64\n0 63\n0 -38\n0 47\n0 31\n0 -72\n0 60\n0 -15\n0 -36\n0 50\n0 -77\n0 -89\n0 5\n0 83\n0 -52\n0 -21\n0 39\n0 51\n0 -11\n0 -69\n0 57\n0 -58\n0 64\n0 85\n0 -61\n0 0\n0 69\n0 -83\n0 24\n0 -91\n0 -33\n0 -79\n0 -39\n0 -98\n0 45\n0 4\n0 -8\n0 96\n0 35\n0 9\n0 53\n0 90\n0 15\n0 -19\n0 -48\n0 -56\n0 38\n0 92\n0 76", "output": "0" }, { "input": "20\n12 16\n19 13\n19 15\n20 3\n5 20\n8 3\n9 18\n2 15\n2 3\n16 8\n14 18\n16 20\n13 17\n0 15\n10 12\n10 6\n18 8\n6 1\n6 2\n0 6", "output": "1130" }, { "input": "5\n0 0\n1 1\n2 4\n3 8\n4 16", "output": "10" }, { "input": "3\n-100 -100\n0 0\n100 100", "output": "0" }, { "input": "20\n-2 1\n5 1\n1 -1\n1 4\n-5 -5\n3 1\n-5 -3\n-2 3\n-3 4\n5 -4\n-4 5\n3 3\n1 0\n-4 -4\n3 0\n4 -1\n-3 0\n-2 2\n-2 -5\n-5 -4", "output": "1109" }, { "input": "3\n1 1\n3 3\n2 2", "output": "0" }, { "input": "10\n-52 25\n55 76\n97 88\n92 3\n-98 77\n45 90\n6 85\n-68 -38\n-74 -55\n-48 60", "output": "120" }, { "input": "10\n-1 32\n0 88\n-1 69\n0 62\n-1 52\n0 16\n0 19\n-1 58\n0 38\n0 67", "output": "96" }, { "input": "20\n-100 -100\n-99 -99\n-98 -96\n-97 -91\n-96 -84\n-95 -75\n-94 -64\n-93 -51\n-92 -36\n-91 -19\n100 100\n99 99\n98 96\n97 91\n96 84\n95 75\n94 64\n93 51\n92 36\n91 19", "output": "1136" } ]
1,625,120,346
2,147,483,647
PyPy 3
OK
TESTS
59
1,263
12,083,200
import sys from math import gcd from collections import defaultdict input=sys.stdin.readline n=int(input()) p=[list(map(int,input().split())) for i in range(n)] ans=0 for xi,yi in p: angle=defaultdict(int) for x,y in p: if xi==x and yi==y: continue x-=xi;y-=yi if x<0 or (x==0 and y<0): x=-x;y=-y g=abs(gcd(x,y)) x//=g;y//=g angle[(x,y)]+=1 cnt=0 for i in angle.keys(): cnt+=angle[i]*(n-1-angle[i]) ans+=cnt//2 print(ans//3)
Title: Vanya and Triangles Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vanya got bored and he painted *n* distinct points on the plane. After that he connected all the points pairwise and saw that as a result many triangles were formed with vertices in the painted points. He asks you to count the number of the formed triangles with the non-zero area. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=2000) — the number of the points painted on the plane. Next *n* lines contain two integers each *x**i*,<=*y**i* (<=-<=100<=≤<=*x**i*,<=*y**i*<=≤<=100) — the coordinates of the *i*-th point. It is guaranteed that no two given points coincide. Output Specification: In the first line print an integer — the number of triangles with the non-zero area among the painted points. Demo Input: ['4\n0 0\n1 1\n2 0\n2 2\n', '3\n0 0\n1 1\n2 0\n', '1\n1 1\n'] Demo Output: ['3\n', '1\n', '0\n'] Note: Note to the first sample test. There are 3 triangles formed: (0, 0) - (1, 1) - (2, 0); (0, 0) - (2, 2) - (2, 0); (1, 1) - (2, 2) - (2, 0). Note to the second sample test. There is 1 triangle formed: (0, 0) - (1, 1) - (2, 0). Note to the third sample test. A single point doesn't form a single triangle.
```python import sys from math import gcd from collections import defaultdict input=sys.stdin.readline n=int(input()) p=[list(map(int,input().split())) for i in range(n)] ans=0 for xi,yi in p: angle=defaultdict(int) for x,y in p: if xi==x and yi==y: continue x-=xi;y-=yi if x<0 or (x==0 and y<0): x=-x;y=-y g=abs(gcd(x,y)) x//=g;y//=g angle[(x,y)]+=1 cnt=0 for i in angle.keys(): cnt+=angle[i]*(n-1-angle[i]) ans+=cnt//2 print(ans//3) ```
3
725
A
Jumping Ball
PROGRAMMING
1,000
[ "implementation" ]
null
null
In a new version of the famous Pinball game, one of the most important parts of the game field is a sequence of *n* bumpers. The bumpers are numbered with integers from 1 to *n* from left to right. There are two types of bumpers. They are denoted by the characters '&lt;' and '&gt;'. When the ball hits the bumper at position *i* it goes one position to the right (to the position *i*<=+<=1) if the type of this bumper is '&gt;', or one position to the left (to *i*<=-<=1) if the type of the bumper at position *i* is '&lt;'. If there is no such position, in other words if *i*<=-<=1<=&lt;<=1 or *i*<=+<=1<=&gt;<=*n*, the ball falls from the game field. Depending on the ball's starting position, the ball may eventually fall from the game field or it may stay there forever. You are given a string representing the bumpers' types. Calculate the number of positions such that the ball will eventually fall from the game field if it starts at that position.
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the length of the sequence of bumpers. The second line contains the string, which consists of the characters '&lt;' and '&gt;'. The character at the *i*-th position of this string corresponds to the type of the *i*-th bumper.
Print one integer — the number of positions in the sequence such that the ball will eventually fall from the game field if it starts at that position.
[ "4\n&lt;&lt;&gt;&lt;\n", "5\n&gt;&gt;&gt;&gt;&gt;\n", "4\n&gt;&gt;&lt;&lt;\n" ]
[ "2", "5", "0" ]
In the first sample, the ball will fall from the field if starts at position 1 or position 2. In the second sample, any starting position will result in the ball falling from the field.
500
[ { "input": "4\n<<><", "output": "2" }, { "input": "5\n>>>>>", "output": "5" }, { "input": "4\n>><<", "output": "0" }, { "input": "3\n<<>", "output": "3" }, { "input": "3\n<<<", "output": "3" }, { "input": "3\n><<", "output": "0" }, { "input": "1\n<", "output": "1" }, { "input": "2\n<>", "output": "2" }, { "input": "3\n<>>", "output": "3" }, { "input": "3\n><>", "output": "1" }, { "input": "2\n><", "output": "0" }, { "input": "2\n>>", "output": "2" }, { "input": "2\n<<", "output": "2" }, { "input": "1\n>", "output": "1" }, { "input": "3\n>><", "output": "0" }, { "input": "3\n>>>", "output": "3" }, { "input": "3\n<><", "output": "1" }, { "input": "10\n<<<><<<>>>", "output": "6" }, { "input": "20\n><><<><<<>>>>>>>>>>>", "output": "11" }, { "input": "20\n<<<<<<<<<<><<<<>>>>>", "output": "15" }, { "input": "50\n<<<<<<<<<<<<<<<<<<<<<<<<<>>>>>>>>>>>>>>>>>>>>>>>>>", "output": "50" }, { "input": "100\n<<<<<<<<<<<<<<<<<<<<<<<<>><<>><<<<<>><>><<<>><><<>>><<>>><<<<><><><<><<<<><>>>>>>>>>>>>>>>>>>>>>>>>>", "output": "49" }, { "input": "100\n<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<>>>><<>><>><>><<><><><><>>>><><<<>>>><<<>>>>>>><><", "output": "50" }, { "input": "100\n<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<", "output": "100" }, { "input": "100\n>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>", "output": "100" }, { "input": "12\n<<>><<>><<>>", "output": "4" }, { "input": "6\n<<><>>", "output": "4" }, { "input": "6\n><>>>>", "output": "4" }, { "input": "8\n>>>><<<>", "output": "1" }, { "input": "4\n<><>", "output": "2" }, { "input": "4\n><><", "output": "0" }, { "input": "7\n<<>>><>", "output": "3" }, { "input": "10\n><><>>>>>>", "output": "6" }, { "input": "5\n<><>>", "output": "3" }, { "input": "12\n<><<<<>>>>>>", "output": "7" }, { "input": "6\n<>><<>", "output": "2" }, { "input": "6\n>>><>>", "output": "2" }, { "input": "10\n><><>>>><>", "output": "1" }, { "input": "5\n><>>>", "output": "3" }, { "input": "5\n<<><>", "output": "3" }, { "input": "5\n<><<<", "output": "1" }, { "input": "4\n<><<", "output": "1" }, { "input": "8\n<<>><<>>", "output": "4" }, { "input": "7\n<<><>>>", "output": "5" }, { "input": "5\n><<>>", "output": "2" }, { "input": "10\n<<<<<>>>>>", "output": "10" }, { "input": "6\n><<<<<", "output": "0" }, { "input": "8\n<<><><>>", "output": "4" }, { "input": "10\n<<<<><<<><", "output": "4" }, { "input": "12\n<<<>>>><<>>>", "output": "6" }, { "input": "4\n><>>", "output": "2" }, { "input": "11\n<<><<>><<>>", "output": "4" } ]
1,486,491,744
2,147,483,647
Python 3
OK
TESTS
78
109
6,144,000
##attacking the problem from a simpler angle ##catch the falling positions from the edges num = int(input()) bumper = str(input()) bumperlist = list(bumper) fallright = 0 fallleft = 0 for i in range(num): if bumperlist[i] == '<': fallleft += 1 else: break for i in reversed(range(num)): if bumperlist[i] == '>': fallleft += 1 else: break print(str(fallright + fallleft))
Title: Jumping Ball Time Limit: None seconds Memory Limit: None megabytes Problem Description: In a new version of the famous Pinball game, one of the most important parts of the game field is a sequence of *n* bumpers. The bumpers are numbered with integers from 1 to *n* from left to right. There are two types of bumpers. They are denoted by the characters '&lt;' and '&gt;'. When the ball hits the bumper at position *i* it goes one position to the right (to the position *i*<=+<=1) if the type of this bumper is '&gt;', or one position to the left (to *i*<=-<=1) if the type of the bumper at position *i* is '&lt;'. If there is no such position, in other words if *i*<=-<=1<=&lt;<=1 or *i*<=+<=1<=&gt;<=*n*, the ball falls from the game field. Depending on the ball's starting position, the ball may eventually fall from the game field or it may stay there forever. You are given a string representing the bumpers' types. Calculate the number of positions such that the ball will eventually fall from the game field if it starts at that position. Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the length of the sequence of bumpers. The second line contains the string, which consists of the characters '&lt;' and '&gt;'. The character at the *i*-th position of this string corresponds to the type of the *i*-th bumper. Output Specification: Print one integer — the number of positions in the sequence such that the ball will eventually fall from the game field if it starts at that position. Demo Input: ['4\n&lt;&lt;&gt;&lt;\n', '5\n&gt;&gt;&gt;&gt;&gt;\n', '4\n&gt;&gt;&lt;&lt;\n'] Demo Output: ['2', '5', '0'] Note: In the first sample, the ball will fall from the field if starts at position 1 or position 2. In the second sample, any starting position will result in the ball falling from the field.
```python ##attacking the problem from a simpler angle ##catch the falling positions from the edges num = int(input()) bumper = str(input()) bumperlist = list(bumper) fallright = 0 fallleft = 0 for i in range(num): if bumperlist[i] == '<': fallleft += 1 else: break for i in reversed(range(num)): if bumperlist[i] == '>': fallleft += 1 else: break print(str(fallright + fallleft)) ```
3
513
A
Game
PROGRAMMING
800
[ "constructive algorithms", "math" ]
null
null
Two players play a simple game. Each player is provided with a box with balls. First player's box contains exactly *n*1 balls and second player's box contains exactly *n*2 balls. In one move first player can take from 1 to *k*1 balls from his box and throw them away. Similarly, the second player can take from 1 to *k*2 balls from his box in his move. Players alternate turns and the first player starts the game. The one who can't make a move loses. Your task is to determine who wins if both players play optimally.
The first line contains four integers *n*1,<=*n*2,<=*k*1,<=*k*2. All numbers in the input are from 1 to 50. This problem doesn't have subproblems. You will get 3 points for the correct submission.
Output "First" if the first player wins and "Second" otherwise.
[ "2 2 1 2\n", "2 1 1 1\n" ]
[ "Second\n", "First\n" ]
Consider the first sample test. Each player has a box with 2 balls. The first player draws a single ball from his box in one move and the second player can either take 1 or 2 balls from his box in one move. No matter how the first player acts, the second player can always win if he plays wisely.
3
[ { "input": "2 2 1 2", "output": "Second" }, { "input": "2 1 1 1", "output": "First" }, { "input": "5 7 4 1", "output": "Second" }, { "input": "5 7 1 4", "output": "Second" }, { "input": "5 7 10 10", "output": "Second" }, { "input": "5 7 1 10", "output": "Second" }, { "input": "1 1 1 1", "output": "Second" }, { "input": "50 50 50 50", "output": "Second" }, { "input": "50 49 1 2", "output": "First" }, { "input": "50 48 3 1", "output": "First" }, { "input": "48 50 12 11", "output": "Second" }, { "input": "49 50 11 12", "output": "Second" }, { "input": "49 49 4 1", "output": "Second" }, { "input": "49 49 3 3", "output": "Second" }, { "input": "1 50 1 50", "output": "Second" }, { "input": "1 50 50 50", "output": "Second" }, { "input": "50 1 1 1", "output": "First" }, { "input": "50 1 1 50", "output": "First" }, { "input": "32 31 10 9", "output": "First" }, { "input": "32 4 17 3", "output": "First" } ]
1,464,773,059
2,147,483,647
Python 3
OK
TESTS
20
62
4,608,000
n1,n2,k1,k2 = [int(x) for x in input().split()] if(n2>=n1): print ('Second') else: print ('First')
Title: Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Two players play a simple game. Each player is provided with a box with balls. First player's box contains exactly *n*1 balls and second player's box contains exactly *n*2 balls. In one move first player can take from 1 to *k*1 balls from his box and throw them away. Similarly, the second player can take from 1 to *k*2 balls from his box in his move. Players alternate turns and the first player starts the game. The one who can't make a move loses. Your task is to determine who wins if both players play optimally. Input Specification: The first line contains four integers *n*1,<=*n*2,<=*k*1,<=*k*2. All numbers in the input are from 1 to 50. This problem doesn't have subproblems. You will get 3 points for the correct submission. Output Specification: Output "First" if the first player wins and "Second" otherwise. Demo Input: ['2 2 1 2\n', '2 1 1 1\n'] Demo Output: ['Second\n', 'First\n'] Note: Consider the first sample test. Each player has a box with 2 balls. The first player draws a single ball from his box in one move and the second player can either take 1 or 2 balls from his box in one move. No matter how the first player acts, the second player can always win if he plays wisely.
```python n1,n2,k1,k2 = [int(x) for x in input().split()] if(n2>=n1): print ('Second') else: print ('First') ```
3
723
A
The New Year: Meeting Friends
PROGRAMMING
800
[ "implementation", "math", "sortings" ]
null
null
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year? It's guaranteed that the optimal answer is always integer.
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
Print one integer — the minimum total distance the friends need to travel in order to meet together.
[ "7 1 4\n", "30 20 10\n" ]
[ "6\n", "20\n" ]
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
500
[ { "input": "7 1 4", "output": "6" }, { "input": "30 20 10", "output": "20" }, { "input": "1 4 100", "output": "99" }, { "input": "100 1 91", "output": "99" }, { "input": "1 45 100", "output": "99" }, { "input": "1 2 3", "output": "2" }, { "input": "71 85 88", "output": "17" }, { "input": "30 38 99", "output": "69" }, { "input": "23 82 95", "output": "72" }, { "input": "22 41 47", "output": "25" }, { "input": "9 94 77", "output": "85" }, { "input": "1 53 51", "output": "52" }, { "input": "25 97 93", "output": "72" }, { "input": "42 53 51", "output": "11" }, { "input": "81 96 94", "output": "15" }, { "input": "21 5 93", "output": "88" }, { "input": "50 13 75", "output": "62" }, { "input": "41 28 98", "output": "70" }, { "input": "69 46 82", "output": "36" }, { "input": "87 28 89", "output": "61" }, { "input": "44 45 40", "output": "5" }, { "input": "86 97 68", "output": "29" }, { "input": "43 92 30", "output": "62" }, { "input": "16 70 1", "output": "69" }, { "input": "40 46 19", "output": "27" }, { "input": "71 38 56", "output": "33" }, { "input": "82 21 80", "output": "61" }, { "input": "75 8 35", "output": "67" }, { "input": "75 24 28", "output": "51" }, { "input": "78 23 56", "output": "55" }, { "input": "85 31 10", "output": "75" }, { "input": "76 50 9", "output": "67" }, { "input": "95 37 34", "output": "61" }, { "input": "84 61 35", "output": "49" }, { "input": "87 85 37", "output": "50" }, { "input": "1 3 2", "output": "2" }, { "input": "4 2 6", "output": "4" }, { "input": "6 9 3", "output": "6" }, { "input": "12 4 8", "output": "8" }, { "input": "15 10 5", "output": "10" }, { "input": "1 50 17", "output": "49" }, { "input": "10 5 15", "output": "10" }, { "input": "8 1 9", "output": "8" }, { "input": "3 5 4", "output": "2" }, { "input": "2 1 3", "output": "2" }, { "input": "1 8 2", "output": "7" }, { "input": "1 100 2", "output": "99" }, { "input": "1 4 6", "output": "5" } ]
1,698,830,473
2,147,483,647
PyPy 3-64
OK
TESTS
48
62
0
import sys input = sys.stdin.readline print = sys.stdout.write nums = list(map(int, input().split())) nums.sort() distance = nums[1] - nums[0] + nums[2] - nums[1] print(f"{distance}")
Title: The New Year: Meeting Friends Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year? It's guaranteed that the optimal answer is always integer. Input Specification: The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively. Output Specification: Print one integer — the minimum total distance the friends need to travel in order to meet together. Demo Input: ['7 1 4\n', '30 20 10\n'] Demo Output: ['6\n', '20\n'] Note: In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
```python import sys input = sys.stdin.readline print = sys.stdout.write nums = list(map(int, input().split())) nums.sort() distance = nums[1] - nums[0] + nums[2] - nums[1] print(f"{distance}") ```
3
215
A
Bicycle Chain
PROGRAMMING
900
[ "brute force", "implementation" ]
null
null
Vasya's bicycle chain drive consists of two parts: *n* stars are attached to the pedal axle, *m* stars are attached to the rear wheel axle. The chain helps to rotate the rear wheel by transmitting the pedal rotation. We know that the *i*-th star on the pedal axle has *a**i* (0<=&lt;<=*a*1<=&lt;<=*a*2<=&lt;<=...<=&lt;<=*a**n*) teeth, and the *j*-th star on the rear wheel axle has *b**j* (0<=&lt;<=*b*1<=&lt;<=*b*2<=&lt;<=...<=&lt;<=*b**m*) teeth. Any pair (*i*,<=*j*) (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*) is called a gear and sets the indexes of stars to which the chain is currently attached. Gear (*i*,<=*j*) has a gear ratio, equal to the value . Since Vasya likes integers, he wants to find such gears (*i*,<=*j*), that their ratios are integers. On the other hand, Vasya likes fast driving, so among all "integer" gears (*i*,<=*j*) he wants to choose a gear with the maximum ratio. Help him to find the number of such gears. In the problem, fraction denotes division in real numbers, that is, no rounding is performed.
The first input line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stars on the bicycle's pedal axle. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) in the order of strict increasing. The third input line contains integer *m* (1<=≤<=*m*<=≤<=50) — the number of stars on the rear wheel axle. The fourth line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=104) in the order of strict increasing. It is guaranteed that there exists at least one gear (*i*,<=*j*), that its gear ratio is an integer. The numbers on the lines are separated by spaces.
Print the number of "integer" gears with the maximum ratio among all "integer" gears.
[ "2\n4 5\n3\n12 13 15\n", "4\n1 2 3 4\n5\n10 11 12 13 14\n" ]
[ "2\n", "1\n" ]
In the first sample the maximum "integer" gear ratio equals 3. There are two gears that have such gear ratio. For one of them *a*<sub class="lower-index">1</sub> = 4, *b*<sub class="lower-index">1</sub> = 12, and for the other *a*<sub class="lower-index">2</sub> = 5, *b*<sub class="lower-index">3</sub> = 15.
500
[ { "input": "2\n4 5\n3\n12 13 15", "output": "2" }, { "input": "4\n1 2 3 4\n5\n10 11 12 13 14", "output": "1" }, { "input": "1\n1\n1\n1", "output": "1" }, { "input": "2\n1 2\n1\n1", "output": "1" }, { "input": "1\n1\n2\n1 2", "output": "1" }, { "input": "4\n3 7 11 13\n4\n51 119 187 221", "output": "4" }, { "input": "4\n2 3 4 5\n3\n1 2 3", "output": "2" }, { "input": "10\n6 12 13 20 48 53 74 92 96 97\n10\n1 21 32 36 47 54 69 75 95 97", "output": "1" }, { "input": "10\n5 9 10 14 15 17 19 22 24 26\n10\n2 11 17 19 21 22 24 25 27 28", "output": "1" }, { "input": "10\n24 53 56 126 354 432 442 740 795 856\n10\n273 438 494 619 689 711 894 947 954 958", "output": "1" }, { "input": "10\n3 4 6 7 8 10 14 16 19 20\n10\n3 4 5 7 8 10 15 16 18 20", "output": "1" }, { "input": "10\n1 6 8 14 15 17 25 27 34 39\n10\n1 8 16 17 19 22 32 39 44 50", "output": "1" }, { "input": "10\n5 21 22 23 25 32 35 36 38 39\n10\n3 7 8 9 18 21 23 24 36 38", "output": "4" }, { "input": "50\n5 8 13 16 19 20 21 22 24 27 28 29 30 32 33 34 35 43 45 48 50 51 54 55 58 59 60 61 62 65 70 71 72 76 78 79 80 81 83 84 85 87 89 91 92 94 97 98 99 100\n50\n2 3 5 6 7 10 15 16 17 20 23 28 29 30 31 34 36 37 40 42 45 46 48 54 55 56 58 59 61 62 69 70 71 72 75 76 78 82 84 85 86 87 88 89 90 91 92 97 99 100", "output": "1" }, { "input": "50\n3 5 6 8 9 11 13 19 21 23 24 32 34 35 42 50 51 52 56 58 59 69 70 72 73 75 76 77 78 80 83 88 90 95 96 100 101 102 108 109 113 119 124 135 138 141 142 143 145 150\n50\n5 8 10 11 18 19 23 30 35 43 51 53 55 58 63 68 69 71 77 78 79 82 83 86 88 89 91 92 93 94 96 102 103 105 109 110 113 114 116 123 124 126 127 132 133 135 136 137 142 149", "output": "1" }, { "input": "50\n6 16 24 25 27 33 36 40 51 60 62 65 71 72 75 77 85 87 91 93 98 102 103 106 117 118 120 121 122 123 125 131 134 136 143 148 155 157 160 161 164 166 170 178 184 187 188 192 194 197\n50\n5 9 17 23 27 34 40 44 47 59 62 70 81 82 87 88 89 90 98 101 102 110 113 114 115 116 119 122 124 128 130 137 138 140 144 150 152 155 159 164 166 169 171 175 185 186 187 189 190 193", "output": "1" }, { "input": "50\n14 22 23 31 32 35 48 63 76 79 88 97 101 102 103 104 106 113 114 115 116 126 136 138 145 152 155 156 162 170 172 173 179 180 182 203 208 210 212 222 226 229 231 232 235 237 245 246 247 248\n50\n2 5 6 16 28 44 45 46 54 55 56 63 72 80 87 93 94 96 97 100 101 103 132 135 140 160 164 165 167 168 173 180 182 185 186 192 194 198 199 202 203 211 213 216 217 227 232 233 236 245", "output": "1" }, { "input": "50\n14 19 33 35 38 41 51 54 69 70 71 73 76 80 84 94 102 104 105 106 107 113 121 128 131 168 180 181 187 191 195 201 205 207 210 216 220 238 249 251 263 271 272 275 281 283 285 286 291 294\n50\n2 3 5 20 21 35 38 40 43 48 49 52 55 64 73 77 82 97 109 113 119 121 125 132 137 139 145 146 149 180 182 197 203 229 234 241 244 251 264 271 274 281 284 285 287 291 292 293 294 298", "output": "1" }, { "input": "50\n2 4 5 16 18 19 22 23 25 26 34 44 48 54 67 79 80 84 92 110 116 133 138 154 163 171 174 202 205 218 228 229 234 245 247 249 250 263 270 272 274 275 277 283 289 310 312 334 339 342\n50\n1 5 17 18 25 37 46 47 48 59 67 75 80 83 84 107 115 122 137 141 159 162 175 180 184 204 221 224 240 243 247 248 249 258 259 260 264 266 269 271 274 293 294 306 329 330 334 335 342 350", "output": "1" }, { "input": "50\n6 9 11 21 28 39 42 56 60 63 81 88 91 95 105 110 117 125 149 165 174 176 185 189 193 196 205 231 233 268 278 279 281 286 289 292 298 303 305 306 334 342 350 353 361 371 372 375 376 378\n50\n6 17 20 43 45 52 58 59 82 83 88 102 111 118 121 131 145 173 190 191 200 216 224 225 232 235 243 256 260 271 290 291 321 322 323 329 331 333 334 341 343 348 351 354 356 360 366 379 387 388", "output": "1" }, { "input": "10\n17 239 443 467 661 1069 1823 2333 3767 4201\n20\n51 83 97 457 593 717 997 1329 1401 1459 1471 1983 2371 2539 3207 3251 3329 5469 6637 6999", "output": "8" }, { "input": "20\n179 359 401 467 521 601 919 941 1103 1279 1709 1913 1949 2003 2099 2143 2179 2213 2399 4673\n20\n151 181 191 251 421 967 1109 1181 1249 1447 1471 1553 1619 2327 2551 2791 3049 3727 6071 7813", "output": "3" }, { "input": "20\n79 113 151 709 809 983 1291 1399 1409 1429 2377 2659 2671 2897 3217 3511 3557 3797 3823 4363\n10\n19 101 659 797 1027 1963 2129 2971 3299 9217", "output": "3" }, { "input": "30\n19 47 109 179 307 331 389 401 461 509 547 569 617 853 883 1249 1361 1381 1511 1723 1741 1783 2459 2531 2621 3533 3821 4091 5557 6217\n20\n401 443 563 941 967 997 1535 1567 1655 1747 1787 1945 1999 2251 2305 2543 2735 4415 6245 7555", "output": "8" }, { "input": "30\n3 43 97 179 257 313 353 359 367 389 397 457 547 599 601 647 1013 1021 1063 1433 1481 1531 1669 3181 3373 3559 3769 4157 4549 5197\n50\n13 15 17 19 29 79 113 193 197 199 215 223 271 293 359 485 487 569 601 683 895 919 941 967 1283 1285 1289 1549 1565 1765 1795 1835 1907 1931 1945 1985 1993 2285 2731 2735 2995 3257 4049 4139 5105 5315 7165 7405 7655 8345", "output": "20" }, { "input": "50\n11 17 23 53 59 109 137 149 173 251 353 379 419 421 439 503 593 607 661 773 821 877 941 997 1061 1117 1153 1229 1289 1297 1321 1609 1747 2311 2389 2543 2693 3041 3083 3137 3181 3209 3331 3373 3617 3767 4201 4409 4931 6379\n50\n55 59 67 73 85 89 101 115 211 263 295 353 545 599 607 685 739 745 997 1031 1255 1493 1523 1667 1709 1895 1949 2161 2195 2965 3019 3035 3305 3361 3373 3673 3739 3865 3881 4231 4253 4385 4985 5305 5585 5765 6145 6445 8045 8735", "output": "23" }, { "input": "5\n33 78 146 3055 4268\n5\n2211 2584 5226 9402 9782", "output": "3" }, { "input": "5\n35 48 52 86 8001\n10\n332 3430 3554 4704 4860 5096 6215 7583 8228 8428", "output": "4" }, { "input": "10\n97 184 207 228 269 2084 4450 6396 7214 9457\n16\n338 1179 1284 1545 1570 2444 3167 3395 3397 5550 6440 7245 7804 7980 9415 9959", "output": "5" }, { "input": "30\n25 30 41 57 58 62 70 72 76 79 84 85 88 91 98 101 104 109 119 129 136 139 148 151 926 1372 3093 3936 5423 7350\n25\n1600 1920 2624 3648 3712 3968 4480 4608 4864 5056 5376 5440 5632 5824 6272 6464 6656 6934 6976 7616 8256 8704 8896 9472 9664", "output": "24" }, { "input": "5\n33 78 146 3055 4268\n5\n2211 2584 5226 9402 9782", "output": "3" }, { "input": "5\n35 48 52 86 8001\n10\n332 3430 3554 4704 4860 5096 6215 7583 8228 8428", "output": "4" }, { "input": "10\n97 184 207 228 269 2084 4450 6396 7214 9457\n16\n338 1179 1284 1545 1570 2444 3167 3395 3397 5550 6440 7245 7804 7980 9415 9959", "output": "5" }, { "input": "30\n25 30 41 57 58 62 70 72 76 79 84 85 88 91 98 101 104 109 119 129 136 139 148 151 926 1372 3093 3936 5423 7350\n25\n1600 1920 2624 3648 3712 3968 4480 4608 4864 5056 5376 5440 5632 5824 6272 6464 6656 6934 6976 7616 8256 8704 8896 9472 9664", "output": "24" }, { "input": "47\n66 262 357 457 513 530 538 540 592 691 707 979 1015 1242 1246 1667 1823 1886 1963 2133 2649 2679 2916 2949 3413 3523 3699 3958 4393 4922 5233 5306 5799 6036 6302 6629 7208 7282 7315 7822 7833 7927 8068 8150 8870 8962 9987\n39\n167 199 360 528 1515 1643 1986 1988 2154 2397 2856 3552 3656 3784 3980 4096 4104 4240 4320 4736 4951 5266 5656 5849 5850 6169 6517 6875 7244 7339 7689 7832 8120 8716 9503 9509 9933 9936 9968", "output": "12" }, { "input": "1\n94\n50\n423 446 485 1214 1468 1507 1853 1930 1999 2258 2271 2285 2425 2543 2715 2743 2992 3196 4074 4108 4448 4475 4652 5057 5250 5312 5356 5375 5731 5986 6298 6501 6521 7146 7255 7276 7332 7481 7998 8141 8413 8665 8908 9221 9336 9491 9504 9677 9693 9706", "output": "1" }, { "input": "50\n51 67 75 186 194 355 512 561 720 876 1077 1221 1503 1820 2153 2385 2568 2608 2937 2969 3271 3311 3481 4081 4093 4171 4255 4256 4829 5020 5192 5636 5817 6156 6712 6717 7153 7436 7608 7612 7866 7988 8264 8293 8867 9311 9879 9882 9889 9908\n1\n5394", "output": "1" }, { "input": "50\n26 367 495 585 675 789 855 1185 1312 1606 2037 2241 2587 2612 2628 2807 2873 2924 3774 4067 4376 4668 4902 5001 5082 5100 5104 5209 5345 5515 5661 5777 5902 5907 6155 6323 6675 6791 7503 8159 8207 8254 8740 8848 8855 8933 9069 9164 9171 9586\n5\n1557 6246 7545 8074 8284", "output": "1" }, { "input": "5\n25 58 91 110 2658\n50\n21 372 909 1172 1517 1554 1797 1802 1843 1977 2006 2025 2137 2225 2317 2507 2645 2754 2919 3024 3202 3212 3267 3852 4374 4487 4553 4668 4883 4911 4916 5016 5021 5068 5104 5162 5683 5856 6374 6871 7333 7531 8099 8135 8173 8215 8462 8776 9433 9790", "output": "4" }, { "input": "45\n37 48 56 59 69 70 79 83 85 86 99 114 131 134 135 145 156 250 1739 1947 2116 2315 2449 3104 3666 4008 4406 4723 4829 5345 5836 6262 6296 6870 7065 7110 7130 7510 7595 8092 8442 8574 9032 9091 9355\n50\n343 846 893 1110 1651 1837 2162 2331 2596 3012 3024 3131 3294 3394 3528 3717 3997 4125 4347 4410 4581 4977 5030 5070 5119 5229 5355 5413 5418 5474 5763 5940 6151 6161 6164 6237 6506 6519 6783 7182 7413 7534 8069 8253 8442 8505 9135 9308 9828 9902", "output": "17" }, { "input": "50\n17 20 22 28 36 38 46 47 48 50 52 57 58 62 63 69 70 74 75 78 79 81 82 86 87 90 93 95 103 202 292 442 1756 1769 2208 2311 2799 2957 3483 4280 4324 4932 5109 5204 6225 6354 6561 7136 8754 9670\n40\n68 214 957 1649 1940 2078 2134 2716 3492 3686 4462 4559 4656 4756 4850 5044 5490 5529 5592 5626 6014 6111 6693 6790 7178 7275 7566 7663 7702 7857 7954 8342 8511 8730 8957 9021 9215 9377 9445 9991", "output": "28" }, { "input": "39\n10 13 21 25 36 38 47 48 58 64 68 69 73 79 86 972 2012 2215 2267 2503 3717 3945 4197 4800 5266 6169 6612 6824 7023 7322 7582 7766 8381 8626 8879 9079 9088 9838 9968\n50\n432 877 970 1152 1202 1223 1261 1435 1454 1578 1843 1907 2003 2037 2183 2195 2215 2425 3065 3492 3615 3637 3686 3946 4189 4415 4559 4656 4665 4707 4886 4887 5626 5703 5955 6208 6521 6581 6596 6693 6985 7013 7081 7343 7663 8332 8342 8637 9207 9862", "output": "15" }, { "input": "50\n7 144 269 339 395 505 625 688 709 950 1102 1152 1350 1381 1641 1830 1977 1999 2093 2180 2718 3308 3574 4168 4232 4259 4393 4689 4982 5154 5476 5581 5635 5721 6159 6302 6741 7010 7152 7315 7417 7482 8116 8239 8640 9347 9395 9614 9661 9822\n20\n84 162 292 1728 1866 2088 3228 3470 4068 5318 5470 6060 6380 6929 7500 8256 8399 8467 8508 9691", "output": "8" }, { "input": "50\n159 880 1070 1139 1358 1608 1691 1841 2073 2171 2213 2597 2692 2759 2879 2931 3173 3217 3441 4201 4878 5106 5129 5253 5395 5647 5968 6019 6130 6276 6286 6330 6409 6728 7488 7713 7765 7828 7899 8064 8264 8457 8483 8685 8900 8946 8965 9133 9187 9638\n45\n57 159 1070 1139 1391 1608 1691 1841 2171 2213 2692 2759 2931 3173 3217 3441 4201 4878 5106 5129 5253 5647 5968 6130 6276 6286 6409 7488 7694 7713 7765 7828 7899 8003 8064 8081 8244 8264 8685 8900 8946 8965 9133 9638 9673", "output": "38" }, { "input": "3\n3 4 5\n3\n6 20 25", "output": "2" }, { "input": "4\n2 3 5 8\n4\n2 6 8 10", "output": "1" }, { "input": "4\n3 5 7 11\n4\n3 5 7 22", "output": "1" }, { "input": "2\n2 3\n3\n20 30 50", "output": "1" }, { "input": "3\n1 2 3\n4\n2 4 6 49", "output": "1" }, { "input": "2\n4 5\n3\n12 15 20", "output": "1" }, { "input": "3\n2 5 7\n3\n4 5 7", "output": "1" }, { "input": "3\n3 5 8\n3\n6 8 10", "output": "2" }, { "input": "2\n2 3\n4\n4 6 9 33", "output": "1" }, { "input": "2\n2 3\n4\n4 6 21 40", "output": "1" }, { "input": "3\n4 9 10\n3\n8 9 10", "output": "1" }, { "input": "5\n1 5 6 9 51\n5\n5 12 18 27 10000", "output": "1" }, { "input": "13\n1 2 3 4 5 6 7 8 9 10 11 12 13\n1\n14", "output": "1" } ]
1,419,202,736
2,147,483,647
Python 3
OK
TESTS
57
342
5,836,800
from fractions import Fraction C=1 def main(): n = int(input()) aa = list(map(int, input().split())) m = int(input()) bb = list(map(int, input().split())) l = [Fraction(b, a) for b in bb for a in aa] l.sort() while l[-1].denominator != 1: del l[-1] x, cnt = l.pop(), 1 while l and l[-1] == x: del l[-1] cnt += 1 print(cnt) if __name__ == '__main__': main()
Title: Bicycle Chain Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya's bicycle chain drive consists of two parts: *n* stars are attached to the pedal axle, *m* stars are attached to the rear wheel axle. The chain helps to rotate the rear wheel by transmitting the pedal rotation. We know that the *i*-th star on the pedal axle has *a**i* (0<=&lt;<=*a*1<=&lt;<=*a*2<=&lt;<=...<=&lt;<=*a**n*) teeth, and the *j*-th star on the rear wheel axle has *b**j* (0<=&lt;<=*b*1<=&lt;<=*b*2<=&lt;<=...<=&lt;<=*b**m*) teeth. Any pair (*i*,<=*j*) (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*) is called a gear and sets the indexes of stars to which the chain is currently attached. Gear (*i*,<=*j*) has a gear ratio, equal to the value . Since Vasya likes integers, he wants to find such gears (*i*,<=*j*), that their ratios are integers. On the other hand, Vasya likes fast driving, so among all "integer" gears (*i*,<=*j*) he wants to choose a gear with the maximum ratio. Help him to find the number of such gears. In the problem, fraction denotes division in real numbers, that is, no rounding is performed. Input Specification: The first input line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stars on the bicycle's pedal axle. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) in the order of strict increasing. The third input line contains integer *m* (1<=≤<=*m*<=≤<=50) — the number of stars on the rear wheel axle. The fourth line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=104) in the order of strict increasing. It is guaranteed that there exists at least one gear (*i*,<=*j*), that its gear ratio is an integer. The numbers on the lines are separated by spaces. Output Specification: Print the number of "integer" gears with the maximum ratio among all "integer" gears. Demo Input: ['2\n4 5\n3\n12 13 15\n', '4\n1 2 3 4\n5\n10 11 12 13 14\n'] Demo Output: ['2\n', '1\n'] Note: In the first sample the maximum "integer" gear ratio equals 3. There are two gears that have such gear ratio. For one of them *a*<sub class="lower-index">1</sub> = 4, *b*<sub class="lower-index">1</sub> = 12, and for the other *a*<sub class="lower-index">2</sub> = 5, *b*<sub class="lower-index">3</sub> = 15.
```python from fractions import Fraction C=1 def main(): n = int(input()) aa = list(map(int, input().split())) m = int(input()) bb = list(map(int, input().split())) l = [Fraction(b, a) for b in bb for a in aa] l.sort() while l[-1].denominator != 1: del l[-1] x, cnt = l.pop(), 1 while l and l[-1] == x: del l[-1] cnt += 1 print(cnt) if __name__ == '__main__': main() ```
3
926
A
2-3-numbers
PROGRAMMING
1,300
[ "implementation", "math" ]
null
null
A positive integer is called a 2-3-integer, if it is equal to 2*x*·3*y* for some non-negative integers *x* and *y*. In other words, these integers are such integers that only have 2 and 3 among their prime divisors. For example, integers 1, 6, 9, 16 and 108 — are 2-3 integers, while 5, 10, 21 and 120 are not. Print the number of 2-3-integers on the given segment [*l*,<=*r*], i. e. the number of sich 2-3-integers *t* that *l*<=≤<=*t*<=≤<=*r*.
The only line contains two integers *l* and *r* (1<=≤<=*l*<=≤<=*r*<=≤<=2·109).
Print a single integer the number of 2-3-integers on the segment [*l*,<=*r*].
[ "1 10\n", "100 200\n", "1 2000000000\n" ]
[ "7\n", "5\n", "326\n" ]
In the first example the 2-3-integers are 1, 2, 3, 4, 6, 8 and 9. In the second example the 2-3-integers are 108, 128, 144, 162 and 192.
0
[ { "input": "1 10", "output": "7" }, { "input": "100 200", "output": "5" }, { "input": "1 2000000000", "output": "326" }, { "input": "1088391168 1934917632", "output": "17" }, { "input": "1088391167 1934917632", "output": "17" }, { "input": "1088391169 1934917632", "output": "16" }, { "input": "1088391168 1934917631", "output": "16" }, { "input": "1088391168 1934917633", "output": "17" }, { "input": "4 134217728", "output": "250" }, { "input": "209952 43046722", "output": "112" }, { "input": "25165825 43046719", "output": "13" }, { "input": "5183 25165825", "output": "153" }, { "input": "388645 455910", "output": "3" }, { "input": "472069 972050", "output": "14" }, { "input": "1 1", "output": "1" }, { "input": "2 2", "output": "1" }, { "input": "12 1999999931", "output": "319" }, { "input": "1999999999 1999999999", "output": "0" }, { "input": "2000000000 2000000000", "output": "0" }, { "input": "1934917632 1934917632", "output": "1" }, { "input": "1836660096 1836660096", "output": "1" }, { "input": "1811939328 1811939328", "output": "1" }, { "input": "1719926784 1719926784", "output": "1" }, { "input": "1632586752 1632586752", "output": "1" }, { "input": "1610612736 1610612736", "output": "1" }, { "input": "1207959552 1207959552", "output": "1" }, { "input": "129140163 129140163", "output": "1" }, { "input": "12345 54321", "output": "21" }, { "input": "1889569 25165826", "output": "56" }, { "input": "73 7077888", "output": "165" }, { "input": "7077888 45349631", "output": "43" }, { "input": "6144 7077886", "output": "122" }, { "input": "3779135 4194302", "output": "2" }, { "input": "214 161243134", "output": "232" }, { "input": "214 18874369", "output": "180" }, { "input": "28 863", "output": "26" }, { "input": "1417174 172186886", "output": "112" }, { "input": "27 102036671", "output": "234" }, { "input": "147458 102036672", "output": "138" }, { "input": "33554431 102036671", "output": "28" }, { "input": "1572863 33554433", "output": "68" }, { "input": "33554434 181398528", "output": "43" }, { "input": "373247 17915905", "output": "81" }, { "input": "4251526 68024450", "output": "65" }, { "input": "553599 555493", "output": "0" }, { "input": "69739 671621", "output": "40" }, { "input": "618583 755045", "output": "4" }, { "input": "838469 943236", "output": "2" }, { "input": "509607936 1836660096", "output": "38" }, { "input": "509607935 1836660096", "output": "38" }, { "input": "509607937 1836660096", "output": "37" }, { "input": "509607936 1836660095", "output": "37" }, { "input": "509607936 1836660097", "output": "38" } ]
1,557,898,934
2,147,483,647
Python 3
OK
TESTS
53
109
0
l, r = [int(x) for x in input().split()] l2 = {2**x for x in range(32)} l3 = {3**x for x in range(21)} svv = {x*y for x in l2 for y in l3} counter = 0 for val in svv: if l <= val <= r: counter += 1 print(counter)
Title: 2-3-numbers Time Limit: None seconds Memory Limit: None megabytes Problem Description: A positive integer is called a 2-3-integer, if it is equal to 2*x*·3*y* for some non-negative integers *x* and *y*. In other words, these integers are such integers that only have 2 and 3 among their prime divisors. For example, integers 1, 6, 9, 16 and 108 — are 2-3 integers, while 5, 10, 21 and 120 are not. Print the number of 2-3-integers on the given segment [*l*,<=*r*], i. e. the number of sich 2-3-integers *t* that *l*<=≤<=*t*<=≤<=*r*. Input Specification: The only line contains two integers *l* and *r* (1<=≤<=*l*<=≤<=*r*<=≤<=2·109). Output Specification: Print a single integer the number of 2-3-integers on the segment [*l*,<=*r*]. Demo Input: ['1 10\n', '100 200\n', '1 2000000000\n'] Demo Output: ['7\n', '5\n', '326\n'] Note: In the first example the 2-3-integers are 1, 2, 3, 4, 6, 8 and 9. In the second example the 2-3-integers are 108, 128, 144, 162 and 192.
```python l, r = [int(x) for x in input().split()] l2 = {2**x for x in range(32)} l3 = {3**x for x in range(21)} svv = {x*y for x in l2 for y in l3} counter = 0 for val in svv: if l <= val <= r: counter += 1 print(counter) ```
3
376
B
I.O.U.
PROGRAMMING
1,300
[ "implementation" ]
null
null
Imagine that there is a group of three friends: A, B and С. A owes B 20 rubles and B owes C 20 rubles. The total sum of the debts is 40 rubles. You can see that the debts are not organized in a very optimal manner. Let's rearrange them like that: assume that A owes C 20 rubles and B doesn't owe anything to anybody. The debts still mean the same but the total sum of the debts now equals 20 rubles. This task is a generalisation of a described example. Imagine that your group of friends has *n* people and you know the debts between the people. Optimize the given debts without changing their meaning. In other words, finally for each friend the difference between the total money he should give and the total money he should take must be the same. Print the minimum sum of all debts in the optimal rearrangement of the debts. See the notes to the test samples to better understand the problem.
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 0<=≤<=*m*<=≤<=104). The next *m* lines contain the debts. The *i*-th line contains three integers *a**i*,<=*b**i*,<=*c**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*; *a**i*<=≠<=*b**i*; 1<=≤<=*c**i*<=≤<=100), which mean that person *a**i* owes person *b**i* *c**i* rubles. Assume that the people are numbered by integers from 1 to *n*. It is guaranteed that the same pair of people occurs at most once in the input. The input doesn't simultaneously contain pair of people (*x*,<=*y*) and pair of people (*y*,<=*x*).
Print a single integer — the minimum sum of debts in the optimal rearrangement.
[ "5 3\n1 2 10\n2 3 1\n2 4 1\n", "3 0\n", "4 3\n1 2 1\n2 3 1\n3 1 1\n" ]
[ "10\n", "0\n", "0\n" ]
In the first sample, you can assume that person number 1 owes 8 rubles to person number 2, 1 ruble to person number 3 and 1 ruble to person number 4. He doesn't owe anybody else anything. In the end, the total debt equals 10. In the second sample, there are no debts. In the third sample, you can annul all the debts.
1,000
[ { "input": "5 3\n1 2 10\n2 3 1\n2 4 1", "output": "10" }, { "input": "3 0", "output": "0" }, { "input": "4 3\n1 2 1\n2 3 1\n3 1 1", "output": "0" }, { "input": "20 28\n1 5 6\n1 12 7\n1 13 4\n1 15 7\n1 20 3\n2 4 1\n2 15 6\n3 5 3\n3 8 10\n3 13 8\n3 20 6\n4 6 10\n4 12 8\n4 19 5\n5 17 8\n6 9 9\n6 16 2\n6 19 9\n7 14 6\n8 9 3\n8 16 10\n9 11 7\n9 17 8\n11 13 8\n11 17 17\n11 19 1\n15 20 2\n17 20 1", "output": "124" }, { "input": "20 36\n1 2 13\n1 3 1\n1 6 4\n1 12 8\n1 13 9\n1 15 3\n1 18 4\n2 10 2\n2 15 2\n2 18 6\n3 7 8\n3 16 19\n4 7 1\n4 18 4\n5 9 2\n5 15 9\n5 17 4\n5 18 5\n6 11 7\n6 13 1\n6 14 9\n7 10 4\n7 12 10\n7 15 9\n7 17 8\n8 14 4\n10 13 8\n10 19 9\n11 12 5\n12 17 6\n13 15 8\n13 19 4\n14 15 9\n14 16 8\n17 19 8\n17 20 7", "output": "147" }, { "input": "20 40\n1 13 4\n2 3 3\n2 4 5\n2 7 7\n2 17 10\n3 5 3\n3 6 9\n3 10 4\n3 12 2\n3 13 2\n3 14 3\n4 5 4\n4 8 7\n4 13 9\n5 6 14\n5 14 5\n7 11 5\n7 12 13\n7 15 7\n8 14 5\n8 16 7\n8 18 17\n9 11 8\n9 19 19\n10 12 4\n10 16 3\n10 18 10\n10 20 9\n11 13 9\n11 20 2\n12 13 8\n12 18 2\n12 20 3\n13 17 1\n13 20 4\n14 16 8\n16 19 3\n18 19 3\n18 20 7\n19 20 10", "output": "165" }, { "input": "50 10\n1 5 1\n2 34 2\n3 8 10\n5 28 4\n7 28 6\n13 49 9\n15 42 7\n16 26 7\n18 47 5\n20 41 10", "output": "60" }, { "input": "50 46\n1 6 10\n1 18 1\n1 24 10\n1 33 2\n1 40 8\n3 16 7\n4 26 8\n4 32 2\n4 34 6\n5 29 8\n6 44 3\n8 20 5\n8 42 13\n10 13 5\n10 25 7\n10 27 9\n10 29 10\n11 23 4\n12 28 7\n12 30 10\n12 40 10\n13 18 2\n13 33 2\n14 15 7\n14 43 10\n14 47 3\n16 27 10\n17 21 6\n17 30 9\n19 40 4\n22 24 8\n22 25 7\n22 38 18\n25 38 1\n27 31 7\n27 40 8\n30 36 8\n31 34 1\n32 49 6\n33 35 4\n33 50 7\n38 47 1\n42 47 2\n42 50 5\n43 44 9\n47 50 5", "output": "228" }, { "input": "100 48\n1 56 6\n2 42 3\n3 52 1\n9 50 8\n10 96 8\n11 39 2\n12 51 6\n12 68 7\n13 40 5\n14 18 10\n14 70 6\n15 37 4\n15 38 8\n15 82 6\n15 85 5\n16 48 4\n16 50 9\n16 71 9\n17 18 3\n17 100 10\n20 73 3\n22 32 9\n22 89 9\n23 53 3\n24 53 1\n27 78 10\n30 50 5\n33 94 8\n34 87 9\n35 73 3\n36 51 8\n37 88 10\n37 97 2\n40 47 8\n40 90 6\n44 53 3\n44 65 3\n47 48 8\n48 72 10\n49 98 2\n53 68 10\n53 71 9\n57 62 2\n63 76 10\n66 90 9\n71 76 8\n72 80 5\n75 77 7", "output": "253" }, { "input": "4 3\n1 4 1\n2 3 1\n4 2 2", "output": "2" } ]
1,572,088,733
2,147,483,647
Python 3
OK
TESTS
29
124
307,200
#BISMILLAH sumi = 0 n, m = map(int, input().strip().split()) debt = [0] * (n+1) crdt = [0] * (n+1) for i in range(0, m): a, b, c = map(int, input().strip().split()) debt[a] += c crdt[b] += c for i in range(0, len(debt)): if crdt[i] > debt[i]: sumi += crdt[i] - debt[i] print(sumi) #ALHAMDULILLAH
Title: I.O.U. Time Limit: None seconds Memory Limit: None megabytes Problem Description: Imagine that there is a group of three friends: A, B and С. A owes B 20 rubles and B owes C 20 rubles. The total sum of the debts is 40 rubles. You can see that the debts are not organized in a very optimal manner. Let's rearrange them like that: assume that A owes C 20 rubles and B doesn't owe anything to anybody. The debts still mean the same but the total sum of the debts now equals 20 rubles. This task is a generalisation of a described example. Imagine that your group of friends has *n* people and you know the debts between the people. Optimize the given debts without changing their meaning. In other words, finally for each friend the difference between the total money he should give and the total money he should take must be the same. Print the minimum sum of all debts in the optimal rearrangement of the debts. See the notes to the test samples to better understand the problem. Input Specification: The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 0<=≤<=*m*<=≤<=104). The next *m* lines contain the debts. The *i*-th line contains three integers *a**i*,<=*b**i*,<=*c**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*; *a**i*<=≠<=*b**i*; 1<=≤<=*c**i*<=≤<=100), which mean that person *a**i* owes person *b**i* *c**i* rubles. Assume that the people are numbered by integers from 1 to *n*. It is guaranteed that the same pair of people occurs at most once in the input. The input doesn't simultaneously contain pair of people (*x*,<=*y*) and pair of people (*y*,<=*x*). Output Specification: Print a single integer — the minimum sum of debts in the optimal rearrangement. Demo Input: ['5 3\n1 2 10\n2 3 1\n2 4 1\n', '3 0\n', '4 3\n1 2 1\n2 3 1\n3 1 1\n'] Demo Output: ['10\n', '0\n', '0\n'] Note: In the first sample, you can assume that person number 1 owes 8 rubles to person number 2, 1 ruble to person number 3 and 1 ruble to person number 4. He doesn't owe anybody else anything. In the end, the total debt equals 10. In the second sample, there are no debts. In the third sample, you can annul all the debts.
```python #BISMILLAH sumi = 0 n, m = map(int, input().strip().split()) debt = [0] * (n+1) crdt = [0] * (n+1) for i in range(0, m): a, b, c = map(int, input().strip().split()) debt[a] += c crdt[b] += c for i in range(0, len(debt)): if crdt[i] > debt[i]: sumi += crdt[i] - debt[i] print(sumi) #ALHAMDULILLAH ```
3
731
A
Night at the Museum
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition. Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture: After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'. Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input.
[ "zeus\n", "map\n", "ares\n" ]
[ "18\n", "35\n", "34\n" ]
To print the string from the first sample it would be optimal to perform the following sequence of rotations: 1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
500
[ { "input": "zeus", "output": "18" }, { "input": "map", "output": "35" }, { "input": "ares", "output": "34" }, { "input": "l", "output": "11" }, { "input": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv", "output": "99" }, { "input": "gngvi", "output": "44" }, { "input": "aaaaa", "output": "0" }, { "input": "a", "output": "0" }, { "input": "z", "output": "1" }, { "input": "vyadeehhikklnoqrs", "output": "28" }, { "input": "jjiihhhhgggfedcccbazyxx", "output": "21" }, { "input": "fyyptqqxuciqvwdewyppjdzur", "output": "117" }, { "input": "fqcnzmzmbobmancqcoalzmanaobpdse", "output": "368" }, { "input": "zzzzzaaaaaaazzzzzzaaaaaaazzzzzzaaaazzzza", "output": "8" }, { "input": "aucnwhfixuruefkypvrvnvznwtjgwlghoqtisbkhuwxmgzuljvqhmnwzisnsgjhivnjmbknptxatdkelhzkhsuxzrmlcpeoyukiy", "output": "644" }, { "input": "sssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss", "output": "8" }, { "input": "nypjygrdtpzpigzyrisqeqfriwgwlengnezppgttgtndbrryjdl", "output": "421" }, { "input": "pnllnnmmmmoqqqqqrrtssssuuvtsrpopqoonllmonnnpppopnonoopooqpnopppqppqstuuuwwwwvxzxzzaa", "output": "84" }, { "input": "btaoahqgxnfsdmzsjxgvdwjukcvereqeskrdufqfqgzqfsftdqcthtkcnaipftcnco", "output": "666" }, { "input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeerrrrrrrrrrrrrrrrwwwwwwwwww", "output": "22" }, { "input": "uyknzcrwjyzmscqucclvacmorepdgmnyhmakmmnygqwglrxkxhkpansbmruwxdeoprxzmpsvwackopujxbbkpwyeggsvjykpxh", "output": "643" }, { "input": "gzwpooohffcxwtpjgfzwtooiccxsrrokezutoojdzwsrmmhecaxwrojcbyrqlfdwwrliiib", "output": "245" }, { "input": "dbvnkktasjdwqsrzfwwtmjgbcxggdxsoeilecihduypktkkbwfbruxzzhlttrssicgdwqruddwrlbtxgmhdbatzvdxbbro", "output": "468" }, { "input": "mdtvowlktxzzbuaeiuebfeorgbdczauxsovbucactkvyvemsknsjfhifqgycqredzchipmkvzbxdjkcbyukomjlzvxzoswumned", "output": "523" }, { "input": "kkkkkkkaaaaxxaaaaaaaxxxxxxxxaaaaaaxaaaaaaaaaakkkkkkkkkaaaaaaannnnnxxxxkkkkkkkkaannnnnnna", "output": "130" }, { "input": "dffiknqqrsvwzcdgjkmpqtuwxadfhkkkmpqrtwxyadfggjmpppsuuwyyzcdgghhknnpsvvvwwwyabccffiloqruwwyyzabeeehh", "output": "163" }, { "input": "qpppmmkjihgecbyvvsppnnnkjiffeebaaywutrrqpmkjhgddbzzzywtssssqnmmljheddbbaxvusrqonmlifedbbzyywwtqnkheb", "output": "155" }, { "input": "wvvwwwvvwxxxyyyxxwwvwwvuttttttuvvwxxwxxyxxwwwwwvvuttssrssstsssssrqpqqppqrssrsrrssrssssrrsrqqrrqpppqp", "output": "57" }, { "input": "dqcpcobpcobnznamznamzlykxkxlxlylzmaobnaobpbnanbpcoaobnboaoboanzlymzmykylymylzlylymanboanaocqdqesfrfs", "output": "1236" }, { "input": "nnnnnnnnnnnnnnnnnnnnaaaaaaaaaaaaaaaaaaaakkkkkkkkkkkkkkkkkkkkkkaaaaaaaaaaaaaaaaaaaaxxxxxxxxxxxxxxxxxx", "output": "49" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "0" }, { "input": "cgilqsuwzaffilptwwbgmnttyyejkorxzflqvzbddhmnrvxchijpuwaeiimosxyycejlpquuwbfkpvbgijkqvxybdjjjptxcfkqt", "output": "331" }, { "input": "ufsepwgtzgtgjssxaitgpailuvgqweoppszjwhoxdhhhpwwdorwfrdjwcdekxiktwziqwbkvbknrtvajpyeqbjvhiikxxaejjpte", "output": "692" }, { "input": "uhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuh", "output": "1293" }, { "input": "vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvgggggggggggggggggggggggggggggggggggggggggggggggggg", "output": "16" }, { "input": "lyidmjyzbszgiwkxhhpnnthfwcvvstueionspfrvqgkvngmwyhezlosrpdnbvtcjjxxsykixwnepbumaacdzadlqhnjlcejovple", "output": "616" }, { "input": "etzqqbaveffalkdguunfmyyrzkccnxmlluxeasqmopxzfvlkbhipqdwjgrttoemruohgwukfisdhznqyvhswbbypoxgtxyappcrl", "output": "605" }, { "input": "lizussgedcbdjhrbeskhgatyozvwwekanlggcstijrniivupmcoofbaxfqrxddyzzptwxcftlhajsmmkkriarrqtkoauhcqefyud", "output": "549" }, { "input": "dvjuvgfdogpknmbowlsfjzcimnygbtjiucyeeroqwhmzwpjqxlbjkqawrdtmvxbiqufllfuqibxvmtdrwaqkjblxqjpwzmhwqore", "output": "688" }, { "input": "eeycuijtbgynmiczjfslwobmnkpgodfgvujvduyfeqchuaoktqrrairkkmmsjahltfcxwtpzzyddxrqfxabfoocmpuviinrjitsc", "output": "604" }, { "input": "cgglnakewwvzoytaghksebrhjdbcdegssuzilrcppayxtgxopybbwshvyqnzhdsifkuwghourmeottrgjwdqpihbklvfzxpomqsa", "output": "572" }, { "input": "aexullmxncckzryymfnuugdklaffevabqqztelpvojecljnhqldazdcaamubpenwxikysxxjjctvbndprsolzehywmgnvkgqvrfp", "output": "609" }, { "input": "psnoieutsvvcwfhtnnphhxkwigzsbzyjmdiyl", "output": "223" }, { "input": "aa", "output": "0" } ]
1,645,806,765
2,147,483,647
PyPy 3-64
OK
TESTS
44
62
0
s = input() count = 0 cu = "a" for c in s: a = abs(ord(c)- ord(cu)) if a > 13: count += 26-a else: count += a cu = c print(count)
Title: Night at the Museum Time Limit: None seconds Memory Limit: None megabytes Problem Description: Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition. Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture: After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'. Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it. Input Specification: The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters. Output Specification: Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input. Demo Input: ['zeus\n', 'map\n', 'ares\n'] Demo Output: ['18\n', '35\n', '34\n'] Note: To print the string from the first sample it would be optimal to perform the following sequence of rotations: 1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
```python s = input() count = 0 cu = "a" for c in s: a = abs(ord(c)- ord(cu)) if a > 13: count += 26-a else: count += a cu = c print(count) ```
3
485
A
Factory
PROGRAMMING
1,400
[ "implementation", "math", "matrices" ]
null
null
One industrial factory is reforming working plan. The director suggested to set a mythical detail production norm. If at the beginning of the day there were *x* details in the factory storage, then by the end of the day the factory has to produce (remainder after dividing *x* by *m*) more details. Unfortunately, no customer has ever bought any mythical detail, so all the details produced stay on the factory. The board of directors are worried that the production by the given plan may eventually stop (that means that there will be а moment when the current number of details on the factory is divisible by *m*). Given the number of details *a* on the first day and number *m* check if the production stops at some moment.
The first line contains two integers *a* and *m* (1<=≤<=*a*,<=*m*<=≤<=105).
Print "Yes" (without quotes) if the production will eventually stop, otherwise print "No".
[ "1 5\n", "3 6\n" ]
[ "No\n", "Yes\n" ]
none
1,000
[ { "input": "1 5", "output": "No" }, { "input": "3 6", "output": "Yes" }, { "input": "1 8", "output": "Yes" }, { "input": "2 3", "output": "No" }, { "input": "3 24", "output": "Yes" }, { "input": "1 1", "output": "Yes" }, { "input": "100000 100000", "output": "Yes" }, { "input": "1 99989", "output": "No" }, { "input": "512 2", "output": "Yes" }, { "input": "100 24", "output": "No" }, { "input": "1 100000", "output": "No" }, { "input": "100000 1", "output": "Yes" }, { "input": "3 99929", "output": "No" }, { "input": "99961 99971", "output": "No" }, { "input": "1 65536", "output": "Yes" }, { "input": "4 65536", "output": "Yes" }, { "input": "3 65536", "output": "Yes" }, { "input": "32768 65536", "output": "Yes" }, { "input": "65535 65536", "output": "Yes" }, { "input": "1 65535", "output": "No" }, { "input": "98812 100000", "output": "No" }, { "input": "10 5", "output": "Yes" }, { "input": "6 8", "output": "Yes" } ]
1,633,150,707
2,147,483,647
Python 3
OK
TESTS
23
77
6,758,400
x, m = map(int, input().split()) for k in range(1, 21): if (x*2**k)%m == 0: print('Yes') exit() print('No')
Title: Factory Time Limit: None seconds Memory Limit: None megabytes Problem Description: One industrial factory is reforming working plan. The director suggested to set a mythical detail production norm. If at the beginning of the day there were *x* details in the factory storage, then by the end of the day the factory has to produce (remainder after dividing *x* by *m*) more details. Unfortunately, no customer has ever bought any mythical detail, so all the details produced stay on the factory. The board of directors are worried that the production by the given plan may eventually stop (that means that there will be а moment when the current number of details on the factory is divisible by *m*). Given the number of details *a* on the first day and number *m* check if the production stops at some moment. Input Specification: The first line contains two integers *a* and *m* (1<=≤<=*a*,<=*m*<=≤<=105). Output Specification: Print "Yes" (without quotes) if the production will eventually stop, otherwise print "No". Demo Input: ['1 5\n', '3 6\n'] Demo Output: ['No\n', 'Yes\n'] Note: none
```python x, m = map(int, input().split()) for k in range(1, 21): if (x*2**k)%m == 0: print('Yes') exit() print('No') ```
3
501
A
Contest
PROGRAMMING
900
[ "implementation" ]
null
null
Misha and Vasya participated in a Codeforces contest. Unfortunately, each of them solved only one problem, though successfully submitted it at the first attempt. Misha solved the problem that costs *a* points and Vasya solved the problem that costs *b* points. Besides, Misha submitted the problem *c* minutes after the contest started and Vasya submitted the problem *d* minutes after the contest started. As you know, on Codeforces the cost of a problem reduces as a round continues. That is, if you submit a problem that costs *p* points *t* minutes after the contest started, you get points. Misha and Vasya are having an argument trying to find out who got more points. Help them to find out the truth.
The first line contains four integers *a*, *b*, *c*, *d* (250<=≤<=*a*,<=*b*<=≤<=3500, 0<=≤<=*c*,<=*d*<=≤<=180). It is guaranteed that numbers *a* and *b* are divisible by 250 (just like on any real Codeforces round).
Output on a single line: "Misha" (without the quotes), if Misha got more points than Vasya. "Vasya" (without the quotes), if Vasya got more points than Misha. "Tie" (without the quotes), if both of them got the same number of points.
[ "500 1000 20 30\n", "1000 1000 1 1\n", "1500 1000 176 177\n" ]
[ "Vasya\n", "Tie\n", "Misha\n" ]
none
500
[ { "input": "500 1000 20 30", "output": "Vasya" }, { "input": "1000 1000 1 1", "output": "Tie" }, { "input": "1500 1000 176 177", "output": "Misha" }, { "input": "1500 1000 74 177", "output": "Misha" }, { "input": "750 2500 175 178", "output": "Vasya" }, { "input": "750 1000 54 103", "output": "Tie" }, { "input": "2000 1250 176 130", "output": "Tie" }, { "input": "1250 1750 145 179", "output": "Tie" }, { "input": "2000 2000 176 179", "output": "Tie" }, { "input": "1500 1500 148 148", "output": "Tie" }, { "input": "2750 1750 134 147", "output": "Misha" }, { "input": "3250 250 175 173", "output": "Misha" }, { "input": "500 500 170 176", "output": "Misha" }, { "input": "250 1000 179 178", "output": "Vasya" }, { "input": "3250 1000 160 138", "output": "Misha" }, { "input": "3000 2000 162 118", "output": "Tie" }, { "input": "1500 1250 180 160", "output": "Tie" }, { "input": "1250 2500 100 176", "output": "Tie" }, { "input": "3500 3500 177 178", "output": "Tie" }, { "input": "3000 3250 16 34", "output": "Tie" }, { "input": "1750 3000 137 49", "output": "Vasya" }, { "input": "500 1500 179 71", "output": "Vasya" }, { "input": "1250 2000 101 180", "output": "Misha" }, { "input": "250 750 180 176", "output": "Vasya" }, { "input": "2250 2250 163 145", "output": "Vasya" }, { "input": "3000 3000 176 78", "output": "Vasya" }, { "input": "250 3500 8 178", "output": "Vasya" }, { "input": "1750 1250 179 180", "output": "Misha" }, { "input": "2750 1750 13 164", "output": "Misha" }, { "input": "1750 2250 178 53", "output": "Vasya" }, { "input": "2500 2750 73 179", "output": "Misha" }, { "input": "1000 3500 178 175", "output": "Vasya" }, { "input": "1000 500 7 162", "output": "Misha" }, { "input": "1000 250 175 48", "output": "Misha" }, { "input": "1750 500 166 177", "output": "Misha" }, { "input": "250 250 0 0", "output": "Tie" }, { "input": "250 3500 0 0", "output": "Vasya" }, { "input": "250 3500 0 180", "output": "Vasya" }, { "input": "3500 3500 180 180", "output": "Tie" }, { "input": "3500 250 0 180", "output": "Misha" } ]
1,690,878,533
2,147,483,647
PyPy 3-64
OK
TESTS
40
62
0
a,b,c,d = list(map(int,input().split())) if(max(3*a//10 , a - a//250*c) > max(3*b//10 , b - b//250*d)): print("Misha") elif(max(3*a//10 , a - a//250*c) < max(3*b//10 , b - b//250*d)): print("Vasya") else: print("Tie")
Title: Contest Time Limit: None seconds Memory Limit: None megabytes Problem Description: Misha and Vasya participated in a Codeforces contest. Unfortunately, each of them solved only one problem, though successfully submitted it at the first attempt. Misha solved the problem that costs *a* points and Vasya solved the problem that costs *b* points. Besides, Misha submitted the problem *c* minutes after the contest started and Vasya submitted the problem *d* minutes after the contest started. As you know, on Codeforces the cost of a problem reduces as a round continues. That is, if you submit a problem that costs *p* points *t* minutes after the contest started, you get points. Misha and Vasya are having an argument trying to find out who got more points. Help them to find out the truth. Input Specification: The first line contains four integers *a*, *b*, *c*, *d* (250<=≤<=*a*,<=*b*<=≤<=3500, 0<=≤<=*c*,<=*d*<=≤<=180). It is guaranteed that numbers *a* and *b* are divisible by 250 (just like on any real Codeforces round). Output Specification: Output on a single line: "Misha" (without the quotes), if Misha got more points than Vasya. "Vasya" (without the quotes), if Vasya got more points than Misha. "Tie" (without the quotes), if both of them got the same number of points. Demo Input: ['500 1000 20 30\n', '1000 1000 1 1\n', '1500 1000 176 177\n'] Demo Output: ['Vasya\n', 'Tie\n', 'Misha\n'] Note: none
```python a,b,c,d = list(map(int,input().split())) if(max(3*a//10 , a - a//250*c) > max(3*b//10 , b - b//250*d)): print("Misha") elif(max(3*a//10 , a - a//250*c) < max(3*b//10 , b - b//250*d)): print("Vasya") else: print("Tie") ```
3
742
A
Arpa’s hard exam and Mehrdad’s naive cheat
PROGRAMMING
1,000
[ "implementation", "math", "number theory" ]
null
null
There exists an island called Arpa’s land, some beautiful girls live there, as ugly ones do. Mehrdad wants to become minister of Arpa’s land. Arpa has prepared an exam. Exam has only one question, given *n*, print the last digit of 1378*n*. Mehrdad has become quite confused and wants you to help him. Please help, although it's a naive cheat.
The single line of input contains one integer *n* (0<=<=≤<=<=*n*<=<=≤<=<=109).
Print single integer — the last digit of 1378*n*.
[ "1\n", "2\n" ]
[ "8", "4" ]
In the first example, last digit of 1378<sup class="upper-index">1</sup> = 1378 is 8. In the second example, last digit of 1378<sup class="upper-index">2</sup> = 1378·1378 = 1898884 is 4.
500
[ { "input": "1", "output": "8" }, { "input": "2", "output": "4" }, { "input": "1000", "output": "6" }, { "input": "3", "output": "2" }, { "input": "4", "output": "6" }, { "input": "1000000000", "output": "6" }, { "input": "5", "output": "8" }, { "input": "6", "output": "4" }, { "input": "999999999", "output": "2" }, { "input": "1378", "output": "4" }, { "input": "13781378", "output": "4" }, { "input": "51202278", "output": "4" }, { "input": "999999998", "output": "4" }, { "input": "999999997", "output": "8" }, { "input": "12193721", "output": "8" }, { "input": "0", "output": "1" }, { "input": "989898989", "output": "8" }, { "input": "7", "output": "2" }, { "input": "8", "output": "6" }, { "input": "9", "output": "8" }, { "input": "10", "output": "4" }, { "input": "11", "output": "2" }, { "input": "12", "output": "6" }, { "input": "13", "output": "8" }, { "input": "14", "output": "4" }, { "input": "15", "output": "2" }, { "input": "16", "output": "6" }, { "input": "999999996", "output": "6" }, { "input": "999999995", "output": "2" }, { "input": "999999994", "output": "4" } ]
1,658,720,952
2,147,483,647
Python 3
OK
TESTS
30
46
0
x = int(input()) if(x == 0): print(1) else : x = (x - 1) % 4 units = [8 , 4 , 2 ,6] print(units[x])
Title: Arpa’s hard exam and Mehrdad’s naive cheat Time Limit: None seconds Memory Limit: None megabytes Problem Description: There exists an island called Arpa’s land, some beautiful girls live there, as ugly ones do. Mehrdad wants to become minister of Arpa’s land. Arpa has prepared an exam. Exam has only one question, given *n*, print the last digit of 1378*n*. Mehrdad has become quite confused and wants you to help him. Please help, although it's a naive cheat. Input Specification: The single line of input contains one integer *n* (0<=<=≤<=<=*n*<=<=≤<=<=109). Output Specification: Print single integer — the last digit of 1378*n*. Demo Input: ['1\n', '2\n'] Demo Output: ['8', '4'] Note: In the first example, last digit of 1378<sup class="upper-index">1</sup> = 1378 is 8. In the second example, last digit of 1378<sup class="upper-index">2</sup> = 1378·1378 = 1898884 is 4.
```python x = int(input()) if(x == 0): print(1) else : x = (x - 1) % 4 units = [8 , 4 , 2 ,6] print(units[x]) ```
3
893
A
Chess For Three
PROGRAMMING
900
[ "implementation" ]
null
null
Alex, Bob and Carl will soon participate in a team chess tournament. Since they are all in the same team, they have decided to practise really hard before the tournament. But it's a bit difficult for them because chess is a game for two players, not three. So they play with each other according to following rules: - Alex and Bob play the first game, and Carl is spectating; - When the game ends, the one who lost the game becomes the spectator in the next game, and the one who was spectating plays against the winner. Alex, Bob and Carl play in such a way that there are no draws. Today they have played *n* games, and for each of these games they remember who was the winner. They decided to make up a log of games describing who won each game. But now they doubt if the information in the log is correct, and they want to know if the situation described in the log they made up was possible (that is, no game is won by someone who is spectating if Alex, Bob and Carl play according to the rules). Help them to check it!
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of games Alex, Bob and Carl played. Then *n* lines follow, describing the game log. *i*-th line contains one integer *a**i* (1<=≤<=*a**i*<=≤<=3) which is equal to 1 if Alex won *i*-th game, to 2 if Bob won *i*-th game and 3 if Carl won *i*-th game.
Print YES if the situation described in the log was possible. Otherwise print NO.
[ "3\n1\n1\n2\n", "2\n1\n2\n" ]
[ "YES\n", "NO\n" ]
In the first example the possible situation is: 1. Alex wins, Carl starts playing instead of Bob; 1. Alex wins, Bob replaces Carl; 1. Bob wins. The situation in the second example is impossible because Bob loses the first game, so he cannot win the second one.
0
[ { "input": "3\n1\n1\n2", "output": "YES" }, { "input": "2\n1\n2", "output": "NO" }, { "input": "100\n2\n3\n1\n2\n3\n3\n3\n1\n1\n1\n1\n3\n3\n3\n3\n1\n2\n3\n3\n3\n3\n3\n3\n3\n1\n2\n2\n2\n3\n1\n1\n3\n3\n3\n3\n3\n3\n3\n3\n1\n2\n3\n3\n3\n1\n1\n1\n1\n3\n3\n3\n3\n1\n2\n3\n1\n2\n2\n2\n3\n3\n2\n1\n3\n3\n1\n2\n3\n1\n1\n1\n2\n2\n2\n3\n1\n1\n1\n1\n1\n1\n3\n2\n2\n2\n2\n2\n2\n3\n1\n2\n2\n2\n2\n2\n3\n3\n2\n1\n1", "output": "YES" }, { "input": "99\n1\n3\n2\n2\n3\n1\n1\n3\n3\n3\n3\n3\n3\n1\n1\n3\n3\n3\n3\n1\n1\n3\n2\n1\n1\n1\n1\n1\n1\n1\n3\n2\n2\n2\n1\n3\n3\n1\n1\n3\n2\n1\n3\n3\n1\n2\n3\n3\n3\n1\n2\n2\n2\n3\n3\n3\n3\n3\n3\n2\n2\n2\n2\n3\n3\n3\n1\n1\n3\n2\n1\n1\n2\n2\n2\n3\n3\n2\n1\n1\n2\n2\n1\n3\n2\n1\n1\n2\n3\n3\n3\n3\n2\n2\n2\n2\n2\n1\n3", "output": "YES" }, { "input": "100\n2\n2\n1\n3\n1\n3\n3\n1\n1\n3\n1\n1\n3\n2\n1\n3\n1\n1\n3\n3\n2\n2\n3\n1\n1\n2\n3\n2\n2\n3\n1\n1\n2\n3\n2\n1\n2\n2\n3\n3\n1\n1\n3\n1\n2\n1\n3\n1\n1\n3\n2\n2\n2\n1\n1\n1\n3\n1\n3\n2\n1\n2\n2\n2\n3\n3\n2\n1\n1\n3\n3\n2\n1\n2\n1\n1\n3\n1\n2\n3\n2\n3\n3\n3\n2\n2\n1\n3\n1\n2\n3\n1\n2\n3\n3\n1\n2\n1\n3\n1", "output": "NO" }, { "input": "10\n2\n3\n3\n3\n3\n2\n2\n2\n3\n2", "output": "NO" }, { "input": "100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1", "output": "YES" }, { "input": "1\n3", "output": "NO" }, { "input": "1\n2", "output": "YES" }, { "input": "42\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1", "output": "YES" }, { "input": "4\n2\n3\n3\n3", "output": "YES" }, { "input": "3\n1\n2\n3", "output": "NO" }, { "input": "5\n1\n1\n1\n1\n3", "output": "NO" }, { "input": "5\n2\n3\n3\n3\n3", "output": "YES" }, { "input": "2\n3\n3", "output": "NO" }, { "input": "4\n1\n2\n2\n1", "output": "NO" }, { "input": "3\n2\n2\n3", "output": "NO" }, { "input": "5\n2\n3\n3\n1\n1", "output": "NO" }, { "input": "3\n3\n1\n3", "output": "NO" }, { "input": "3\n3\n3\n1", "output": "NO" }, { "input": "2\n2\n1", "output": "NO" }, { "input": "3\n1\n1\n3", "output": "NO" }, { "input": "6\n2\n2\n2\n3\n1\n3", "output": "NO" }, { "input": "2\n3\n1", "output": "NO" }, { "input": "2\n3\n2", "output": "NO" }, { "input": "2\n1\n3", "output": "YES" }, { "input": "3\n1\n3\n1", "output": "NO" }, { "input": "5\n1\n1\n2\n2\n3", "output": "NO" }, { "input": "3\n2\n1\n1", "output": "NO" }, { "input": "2\n2\n2", "output": "YES" }, { "input": "3\n2\n2\n1", "output": "YES" }, { "input": "5\n2\n2\n2\n2\n2", "output": "YES" }, { "input": "8\n1\n1\n1\n1\n1\n1\n1\n1", "output": "YES" }, { "input": "3\n3\n2\n2", "output": "NO" }, { "input": "3\n3\n2\n3", "output": "NO" }, { "input": "7\n2\n2\n2\n2\n2\n2\n2", "output": "YES" }, { "input": "3\n2\n2\n2", "output": "YES" } ]
1,626,945,988
688
PyPy 3
OK
TESTS
37
140
20,172,800
n = int(input()) now, win , loss = 3, 1, 2 f = True; for _ in range(n): x = int(input()) if _ == 0: if x == 3: f = False else: win = x loss = (1+2-x) now = 3 else : if x == loss: f = False else : t = (loss + 0) loss = (win + now - x) win = x now = t if f == True: print("YES") else : print("NO")
Title: Chess For Three Time Limit: None seconds Memory Limit: None megabytes Problem Description: Alex, Bob and Carl will soon participate in a team chess tournament. Since they are all in the same team, they have decided to practise really hard before the tournament. But it's a bit difficult for them because chess is a game for two players, not three. So they play with each other according to following rules: - Alex and Bob play the first game, and Carl is spectating; - When the game ends, the one who lost the game becomes the spectator in the next game, and the one who was spectating plays against the winner. Alex, Bob and Carl play in such a way that there are no draws. Today they have played *n* games, and for each of these games they remember who was the winner. They decided to make up a log of games describing who won each game. But now they doubt if the information in the log is correct, and they want to know if the situation described in the log they made up was possible (that is, no game is won by someone who is spectating if Alex, Bob and Carl play according to the rules). Help them to check it! Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of games Alex, Bob and Carl played. Then *n* lines follow, describing the game log. *i*-th line contains one integer *a**i* (1<=≤<=*a**i*<=≤<=3) which is equal to 1 if Alex won *i*-th game, to 2 if Bob won *i*-th game and 3 if Carl won *i*-th game. Output Specification: Print YES if the situation described in the log was possible. Otherwise print NO. Demo Input: ['3\n1\n1\n2\n', '2\n1\n2\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first example the possible situation is: 1. Alex wins, Carl starts playing instead of Bob; 1. Alex wins, Bob replaces Carl; 1. Bob wins. The situation in the second example is impossible because Bob loses the first game, so he cannot win the second one.
```python n = int(input()) now, win , loss = 3, 1, 2 f = True; for _ in range(n): x = int(input()) if _ == 0: if x == 3: f = False else: win = x loss = (1+2-x) now = 3 else : if x == loss: f = False else : t = (loss + 0) loss = (win + now - x) win = x now = t if f == True: print("YES") else : print("NO") ```
3
686
A
Free Ice Cream
PROGRAMMING
800
[ "constructive algorithms", "implementation" ]
null
null
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer. At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue). If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress. Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109). Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
[ "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n", "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n" ]
[ "22 1\n", "3 2\n" ]
Consider the first sample. 1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
500
[ { "input": "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20", "output": "22 1" }, { "input": "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98", "output": "3 2" }, { "input": "6 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000", "output": "7000000000 0" }, { "input": "5 12\n- 12\n+ 7\n- 6\n- 1\n+ 46", "output": "46 0" }, { "input": "11 1000\n- 100\n+ 100\n+ 100\n+ 100\n+ 100\n- 100\n- 100\n- 100\n- 100\n- 100\n- 100", "output": "700 0" }, { "input": "1 0\n- 526403222", "output": "0 1" }, { "input": "1 897986543\n- 371188251", "output": "526798292 0" }, { "input": "1 0\n+ 1", "output": "1 0" }, { "input": "1 0\n- 1", "output": "0 1" }, { "input": "1 10\n+ 10", "output": "20 0" }, { "input": "1 3\n- 5", "output": "3 1" }, { "input": "1 0\n- 5", "output": "0 1" }, { "input": "1 0\n+ 5", "output": "5 0" } ]
1,665,759,124
2,147,483,647
Python 3
OK
TESTS
34
46
0
n,x=list(map(int,input().split())) counter=0 for i in range(n): operation,new_x=input().split() if operation=='+': x+=int(new_x) else: if int(new_x) <=x: x-=int(new_x) else : counter+=1 print(x,counter)
Title: Free Ice Cream Time Limit: None seconds Memory Limit: None megabytes Problem Description: After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer. At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue). If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress. Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids. Input Specification: The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109). Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place. Output Specification: Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress. Demo Input: ['5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n', '5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n'] Demo Output: ['22 1\n', '3 2\n'] Note: Consider the first sample. 1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
```python n,x=list(map(int,input().split())) counter=0 for i in range(n): operation,new_x=input().split() if operation=='+': x+=int(new_x) else: if int(new_x) <=x: x-=int(new_x) else : counter+=1 print(x,counter) ```
3
686
A
Free Ice Cream
PROGRAMMING
800
[ "constructive algorithms", "implementation" ]
null
null
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer. At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue). If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress. Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109). Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
[ "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n", "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n" ]
[ "22 1\n", "3 2\n" ]
Consider the first sample. 1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
500
[ { "input": "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20", "output": "22 1" }, { "input": "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98", "output": "3 2" }, { "input": "6 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000", "output": "7000000000 0" }, { "input": "5 12\n- 12\n+ 7\n- 6\n- 1\n+ 46", "output": "46 0" }, { "input": "11 1000\n- 100\n+ 100\n+ 100\n+ 100\n+ 100\n- 100\n- 100\n- 100\n- 100\n- 100\n- 100", "output": "700 0" }, { "input": "1 0\n- 526403222", "output": "0 1" }, { "input": "1 897986543\n- 371188251", "output": "526798292 0" }, { "input": "1 0\n+ 1", "output": "1 0" }, { "input": "1 0\n- 1", "output": "0 1" }, { "input": "1 10\n+ 10", "output": "20 0" }, { "input": "1 3\n- 5", "output": "3 1" }, { "input": "1 0\n- 5", "output": "0 1" }, { "input": "1 0\n+ 5", "output": "5 0" } ]
1,655,015,997
2,147,483,647
PyPy 3-64
OK
TESTS
34
109
2,355,200
n,x=map(int,input().split()) cnt=0 for i in range(n): c,dx=input().split() dx=int(dx) if c=='+':x+=dx else: if dx>x:cnt+=1 else:x-=dx print(x,cnt)
Title: Free Ice Cream Time Limit: None seconds Memory Limit: None megabytes Problem Description: After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer. At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue). If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress. Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids. Input Specification: The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109). Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place. Output Specification: Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress. Demo Input: ['5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n', '5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n'] Demo Output: ['22 1\n', '3 2\n'] Note: Consider the first sample. 1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
```python n,x=map(int,input().split()) cnt=0 for i in range(n): c,dx=input().split() dx=int(dx) if c=='+':x+=dx else: if dx>x:cnt+=1 else:x-=dx print(x,cnt) ```
3
272
D
Dima and Two Sequences
PROGRAMMING
1,600
[ "combinatorics", "math", "sortings" ]
null
null
Little Dima has two sequences of points with integer coordinates: sequence (*a*1,<=1),<=(*a*2,<=2),<=...,<=(*a**n*,<=*n*) and sequence (*b*1,<=1),<=(*b*2,<=2),<=...,<=(*b**n*,<=*n*). Now Dima wants to count the number of distinct sequences of points of length 2·*n* that can be assembled from these sequences, such that the *x*-coordinates of points in the assembled sequence will not decrease. Help him with that. Note that each element of the initial sequences should be used exactly once in the assembled sequence. Dima considers two assembled sequences (*p*1,<=*q*1),<=(*p*2,<=*q*2),<=...,<=(*p*2·*n*,<=*q*2·*n*) and (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x*2·*n*,<=*y*2·*n*) distinct, if there is such *i* (1<=≤<=*i*<=≤<=2·*n*), that (*p**i*,<=*q**i*)<=≠<=(*x**i*,<=*y**i*). As the answer can be rather large, print the remainder from dividing the answer by number *m*.
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109). The third line contains *n* integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=109). The numbers in the lines are separated by spaces. The last line contains integer *m* (2<=≤<=*m*<=≤<=109<=+<=7).
In the single line print the remainder after dividing the answer to the problem by number *m*.
[ "1\n1\n2\n7\n", "2\n1 2\n2 3\n11\n" ]
[ "1\n", "2\n" ]
In the first sample you can get only one sequence: (1, 1), (2, 1). In the second sample you can get such sequences : (1, 1), (2, 2), (2, 1), (3, 2); (1, 1), (2, 1), (2, 2), (3, 2). Thus, the answer is 2.
2,000
[ { "input": "1\n1\n2\n7", "output": "1" }, { "input": "2\n1 2\n2 3\n11", "output": "2" }, { "input": "100\n1 8 10 6 5 3 2 3 4 2 3 7 1 1 5 1 4 1 8 1 5 5 6 5 3 7 4 5 5 3 8 7 8 6 8 9 10 7 8 5 8 9 1 3 7 2 6 1 7 7 2 8 1 5 4 2 10 4 9 8 1 10 1 5 9 8 1 9 5 1 5 7 1 6 7 8 8 2 2 3 3 7 2 10 6 3 6 3 5 3 10 4 4 6 9 9 3 2 6 6\n4 3 8 4 4 2 4 6 6 3 3 5 8 4 1 6 2 7 6 1 6 10 7 9 2 9 2 9 10 1 1 1 1 7 4 5 3 6 8 6 10 4 3 4 8 6 5 3 1 2 2 4 1 9 1 3 1 9 6 8 9 4 8 8 4 2 1 4 6 2 6 3 4 7 7 7 8 10 7 8 8 6 4 10 10 7 4 5 5 8 3 8 2 8 6 4 5 2 10 2\n29056621", "output": "5236748" }, { "input": "100\n6 1 10 4 8 7 7 3 2 4 6 3 2 5 3 7 1 6 9 8 3 10 1 6 8 1 4 2 5 6 3 5 4 6 3 10 2 8 10 4 2 6 4 5 3 1 8 6 9 8 5 2 7 1 10 5 10 2 9 1 6 4 9 5 2 4 6 7 10 10 10 6 6 9 2 3 3 1 2 4 1 6 9 8 4 10 10 9 9 2 5 7 10 1 9 7 6 6 4 5\n4 9 2 5 5 4 6 9 1 2 6 3 8 9 4 4 4 3 1 3 6 2 9 1 10 6 5 1 9 10 6 2 10 9 8 7 8 2 1 5 8 4 3 2 10 9 5 7 1 8 4 4 4 2 1 3 4 5 3 6 10 3 8 9 5 6 3 9 3 6 5 1 9 1 4 3 8 4 4 8 10 6 4 9 8 4 2 3 1 9 9 1 4 1 8 4 7 9 10 9\n66921358", "output": "12938646" }, { "input": "100\n2 2 10 3 5 6 4 7 9 8 2 7 5 5 1 7 5 9 2 2 10 3 6 10 9 9 10 7 3 9 7 8 8 3 9 3 9 3 3 6 3 7 9 9 7 10 9 1 1 3 6 2 9 5 9 9 6 2 6 5 6 8 2 10 1 1 6 8 8 4 5 2 6 8 8 5 9 2 3 3 7 7 10 5 4 2 10 6 7 6 5 4 10 6 10 3 9 9 1 5\n3 5 6 4 2 3 2 9 3 8 3 1 10 7 4 3 6 9 3 5 9 5 3 10 4 7 9 7 4 3 3 6 9 8 1 1 10 9 1 6 8 8 8 2 1 6 10 1 8 6 3 5 7 7 10 4 6 6 9 1 5 3 5 10 4 4 1 7 9 7 5 10 6 5 4 1 9 6 4 5 7 3 1 10 2 10 6 6 1 10 7 5 1 4 2 9 2 7 3 10\n727992321", "output": "340960284" }, { "input": "100\n2 5 5 6 5 2 8 10 6 1 5 3 10 3 8 6 4 5 7 9 7 1 3 3 5 2 3 7 9 3 7 2 7 6 7 10 5 9 2 4 8 2 3 8 6 6 8 4 1 2 10 5 2 8 4 3 1 3 8 3 2 4 4 6 8 1 9 8 9 9 1 7 1 9 2 4 6 2 1 9 2 7 9 6 6 7 1 9 3 1 6 10 3 9 10 5 3 3 9 8\n6 5 3 1 3 3 8 6 5 4 2 3 9 3 9 9 10 5 10 6 7 8 8 7 8 4 2 4 4 9 1 3 1 5 8 4 8 9 7 9 7 8 4 9 9 9 4 2 9 1 3 10 6 4 5 3 2 8 1 5 1 8 10 10 3 3 7 1 2 4 4 3 3 5 9 8 9 8 5 9 4 8 10 6 7 4 1 9 4 7 1 8 3 3 5 9 8 6 5 4\n608692736", "output": "550164992" }, { "input": "2\n1 2\n1 2\n4", "output": "1" }, { "input": "4\n1 2 3 4\n4 3 2 1\n1009", "output": "16" }, { "input": "5\n1 2 3 3 5\n1 2 3 5 3\n12", "output": "0" }, { "input": "1\n1000000000\n1000000000\n2", "output": "1" }, { "input": "2\n1 2\n2 2\n4", "output": "3" } ]
1,612,203,991
2,147,483,647
PyPy 3
OK
TESTS
51
654
15,769,600
from sys import stdin,stdout nmbr = lambda: int(stdin.readline()) lst = lambda: list(map(int,stdin.readline().split())) for _ in range(1):#nmbr()): n=nmbr() a=lst() b=lst() M=nmbr() tot={} ans=1 mp={} for v,v1 in zip(a,b): tot[v]=tot.get(v,0)+1 tot[v1]=tot.get(v1,0)+1 if v==v1: mp[v]=mp.get(v,0)+1 for k,same_category in tot.items(): fact=1 for v in range(1,same_category+1): new=v while new&1==0 and mp.get(k,0)>0: new>>=1 mp[k]-=1 fact=(fact*new)%M ans=(ans*fact)%M print(ans)
Title: Dima and Two Sequences Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Dima has two sequences of points with integer coordinates: sequence (*a*1,<=1),<=(*a*2,<=2),<=...,<=(*a**n*,<=*n*) and sequence (*b*1,<=1),<=(*b*2,<=2),<=...,<=(*b**n*,<=*n*). Now Dima wants to count the number of distinct sequences of points of length 2·*n* that can be assembled from these sequences, such that the *x*-coordinates of points in the assembled sequence will not decrease. Help him with that. Note that each element of the initial sequences should be used exactly once in the assembled sequence. Dima considers two assembled sequences (*p*1,<=*q*1),<=(*p*2,<=*q*2),<=...,<=(*p*2·*n*,<=*q*2·*n*) and (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x*2·*n*,<=*y*2·*n*) distinct, if there is such *i* (1<=≤<=*i*<=≤<=2·*n*), that (*p**i*,<=*q**i*)<=≠<=(*x**i*,<=*y**i*). As the answer can be rather large, print the remainder from dividing the answer by number *m*. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109). The third line contains *n* integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=109). The numbers in the lines are separated by spaces. The last line contains integer *m* (2<=≤<=*m*<=≤<=109<=+<=7). Output Specification: In the single line print the remainder after dividing the answer to the problem by number *m*. Demo Input: ['1\n1\n2\n7\n', '2\n1 2\n2 3\n11\n'] Demo Output: ['1\n', '2\n'] Note: In the first sample you can get only one sequence: (1, 1), (2, 1). In the second sample you can get such sequences : (1, 1), (2, 2), (2, 1), (3, 2); (1, 1), (2, 1), (2, 2), (3, 2). Thus, the answer is 2.
```python from sys import stdin,stdout nmbr = lambda: int(stdin.readline()) lst = lambda: list(map(int,stdin.readline().split())) for _ in range(1):#nmbr()): n=nmbr() a=lst() b=lst() M=nmbr() tot={} ans=1 mp={} for v,v1 in zip(a,b): tot[v]=tot.get(v,0)+1 tot[v1]=tot.get(v1,0)+1 if v==v1: mp[v]=mp.get(v,0)+1 for k,same_category in tot.items(): fact=1 for v in range(1,same_category+1): new=v while new&1==0 and mp.get(k,0)>0: new>>=1 mp[k]-=1 fact=(fact*new)%M ans=(ans*fact)%M print(ans) ```
3
41
A
Translation
PROGRAMMING
800
[ "implementation", "strings" ]
A. Translation
2
256
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
[ "code\nedoc\n", "abb\naba\n", "code\ncode\n" ]
[ "YES\n", "NO\n", "NO\n" ]
none
500
[ { "input": "code\nedoc", "output": "YES" }, { "input": "abb\naba", "output": "NO" }, { "input": "code\ncode", "output": "NO" }, { "input": "abacaba\nabacaba", "output": "YES" }, { "input": "q\nq", "output": "YES" }, { "input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk", "output": "NO" }, { "input": "z\na", "output": "NO" }, { "input": "asd\ndsa", "output": "YES" }, { "input": "abcdef\nfecdba", "output": "NO" }, { "input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu", "output": "NO" }, { "input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf", "output": "NO" }, { "input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp", "output": "NO" }, { "input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb", "output": "NO" }, { "input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom", "output": "NO" }, { "input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh", "output": "NO" }, { "input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy", "output": "NO" }, { "input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko", "output": "NO" }, { "input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv", "output": "NO" }, { "input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd", "output": "NO" }, { "input": "w\nw", "output": "YES" }, { "input": "vz\nzv", "output": "YES" }, { "input": "ry\nyr", "output": "YES" }, { "input": "xou\nuox", "output": "YES" }, { "input": "axg\ngax", "output": "NO" }, { "input": "zdsl\nlsdz", "output": "YES" }, { "input": "kudl\nldku", "output": "NO" }, { "input": "zzlzwnqlcl\nlclqnwzlzz", "output": "YES" }, { "input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv", "output": "YES" }, { "input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar", "output": "NO" }, { "input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn", "output": "YES" }, { "input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum", "output": "YES" }, { "input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv", "output": "YES" }, { "input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm", "output": "NO" }, { "input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd", "output": "NO" }, { "input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg", "output": "YES" }, { "input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis", "output": "YES" }, { "input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy", "output": "NO" }, { "input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw", "output": "YES" }, { "input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi", "output": "YES" }, { "input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib", "output": "YES" } ]
1,659,382,733
2,147,483,647
PyPy 3-64
OK
TESTS
40
124
0
one = input() two = input() if two == one[::-1]: print("YES") else: print("NO")
Title: Translation Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. Input Specification: The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. Output Specification: If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. Demo Input: ['code\nedoc\n', 'abb\naba\n', 'code\ncode\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none
```python one = input() two = input() if two == one[::-1]: print("YES") else: print("NO") ```
3.969
322
B
Ciel and Flowers
PROGRAMMING
1,600
[ "combinatorics", "math" ]
null
null
Fox Ciel has some flowers: *r* red flowers, *g* green flowers and *b* blue flowers. She wants to use these flowers to make several bouquets. There are 4 types of bouquets: - To make a "red bouquet", it needs 3 red flowers. - To make a "green bouquet", it needs 3 green flowers. - To make a "blue bouquet", it needs 3 blue flowers. - To make a "mixing bouquet", it needs 1 red, 1 green and 1 blue flower. Help Fox Ciel to find the maximal number of bouquets she can make.
The first line contains three integers *r*, *g* and *b* (0<=≤<=*r*,<=*g*,<=*b*<=≤<=109) — the number of red, green and blue flowers.
Print the maximal number of bouquets Fox Ciel can make.
[ "3 6 9\n", "4 4 4\n", "0 0 0\n" ]
[ "6\n", "4\n", "0\n" ]
In test case 1, we can make 1 red bouquet, 2 green bouquets and 3 blue bouquets. In test case 2, we can make 1 red, 1 green, 1 blue and 1 mixing bouquet.
1,000
[ { "input": "3 6 9", "output": "6" }, { "input": "4 4 4", "output": "4" }, { "input": "0 0 0", "output": "0" }, { "input": "0 3 6", "output": "3" }, { "input": "7 8 9", "output": "7" }, { "input": "8 8 9", "output": "8" }, { "input": "15 3 999", "output": "339" }, { "input": "32 62 92", "output": "62" }, { "input": "123456789 123456789 123456789", "output": "123456789" }, { "input": "3 5 5", "output": "4" }, { "input": "666806767 385540591 357848286", "output": "470065214" }, { "input": "80010646 727118126 817880463", "output": "541669744" }, { "input": "829651016 732259171 572879931", "output": "711596705" }, { "input": "242854896 442432924 180395753", "output": "288561190" }, { "input": "139978911 5123031 935395222", "output": "360165721" }, { "input": "553182792 10264076 395427398", "output": "319624755" }, { "input": "597790453 720437830 855459575", "output": "724562619" }, { "input": "494914467 356982656 757942689", "output": "536613270" }, { "input": "908118348 67156409 217974865", "output": "397749873" }, { "input": "952726009 629846517 972974334", "output": "851848953" }, { "input": "775140200 616574841 630329230", "output": "674014756" }, { "input": "524780569 326748594 90361407", "output": "313963523" }, { "input": "937984449 184405994 992844522", "output": "705078321" }, { "input": "835108464 525983528 452876698", "output": "604656229" }, { "input": "879716125 531124573 207876166", "output": "539572288" }, { "input": "292920005 241298326 667908343", "output": "400708891" }, { "input": "1000000000 1000000000 1000000000", "output": "1000000000" }, { "input": "1000000000 999999999 999999998", "output": "999999998" }, { "input": "999999998 999999998 999999999", "output": "999999998" }, { "input": "0 1 1", "output": "0" }, { "input": "0 1000000000 0", "output": "333333333" }, { "input": "0 1 0", "output": "0" }, { "input": "1 0 0", "output": "0" }, { "input": "0 2 2", "output": "0" }, { "input": "3 3 5", "output": "3" }, { "input": "2 2 0", "output": "0" }, { "input": "0 5 5", "output": "2" }, { "input": "2 0 11", "output": "3" }, { "input": "9 9 7", "output": "8" }, { "input": "65 30 74", "output": "56" } ]
1,586,520,598
2,147,483,647
Python 3
OK
TESTS
40
218
0
r,g,b=[*map(int,input().split())] if ({r%3,g%3,b%3}=={0,1,2}) or (0 in {r,g,b}): print(r//3+g//3+b//3) else: print((r+g+b)//3)
Title: Ciel and Flowers Time Limit: None seconds Memory Limit: None megabytes Problem Description: Fox Ciel has some flowers: *r* red flowers, *g* green flowers and *b* blue flowers. She wants to use these flowers to make several bouquets. There are 4 types of bouquets: - To make a "red bouquet", it needs 3 red flowers. - To make a "green bouquet", it needs 3 green flowers. - To make a "blue bouquet", it needs 3 blue flowers. - To make a "mixing bouquet", it needs 1 red, 1 green and 1 blue flower. Help Fox Ciel to find the maximal number of bouquets she can make. Input Specification: The first line contains three integers *r*, *g* and *b* (0<=≤<=*r*,<=*g*,<=*b*<=≤<=109) — the number of red, green and blue flowers. Output Specification: Print the maximal number of bouquets Fox Ciel can make. Demo Input: ['3 6 9\n', '4 4 4\n', '0 0 0\n'] Demo Output: ['6\n', '4\n', '0\n'] Note: In test case 1, we can make 1 red bouquet, 2 green bouquets and 3 blue bouquets. In test case 2, we can make 1 red, 1 green, 1 blue and 1 mixing bouquet.
```python r,g,b=[*map(int,input().split())] if ({r%3,g%3,b%3}=={0,1,2}) or (0 in {r,g,b}): print(r//3+g//3+b//3) else: print((r+g+b)//3) ```
3
182
D
Common Divisors
PROGRAMMING
1,400
[ "brute force", "hashing", "implementation", "math", "strings" ]
null
null
Vasya has recently learned at school what a number's divisor is and decided to determine a string's divisor. Here is what he came up with. String *a* is the divisor of string *b* if and only if there exists a positive integer *x* such that if we write out string *a* consecutively *x* times, we get string *b*. For example, string "abab" has two divisors — "ab" and "abab". Now Vasya wants to write a program that calculates the number of common divisors of two strings. Please help him.
The first input line contains a non-empty string *s*1. The second input line contains a non-empty string *s*2. Lengths of strings *s*1 and *s*2 are positive and do not exceed 105. The strings only consist of lowercase Latin letters.
Print the number of common divisors of strings *s*1 and *s*2.
[ "abcdabcd\nabcdabcdabcdabcd\n", "aaa\naa\n" ]
[ "2\n", "1\n" ]
In first sample the common divisors are strings "abcd" and "abcdabcd". In the second sample the common divisor is a single string "a". String "aa" isn't included in the answer as it isn't a divisor of string "aaa".
1,000
[ { "input": "abcdabcd\nabcdabcdabcdabcd", "output": "2" }, { "input": "aaa\naa", "output": "1" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaa\naaaaaaaaaaaaaaaaaaaaaaaaa", "output": "3" }, { "input": "aaaaaaaaaaaaaa\naaaaaaaaaaaaaa", "output": "4" }, { "input": "a\nb", "output": "0" }, { "input": "a\na", "output": "1" }, { "input": "ab\nac", "output": "0" }, { "input": "asdkjjaskldjklasjdhasjdasdas\nasdjahsgdjslkdaygsudhasdkasnjdbayusvduasdklmaklsd", "output": "0" }, { "input": "aaa\naaaaab", "output": "0" }, { "input": "ab\naa", "output": "0" }, { "input": "aa\naac", "output": "0" }, { "input": "aba\nabaaba", "output": "1" }, { "input": "aa\nbb", "output": "0" }, { "input": "abababab\ncdcdcdcd", "output": "0" }, { "input": "ab\nab", "output": "1" }, { "input": "abcabcabc\nertert", "output": "0" }, { "input": "aaaa\nbbbb", "output": "0" }, { "input": "abc\ncde", "output": "0" }, { "input": "abc\nabcabcab", "output": "0" }, { "input": "aba\naaa", "output": "0" }, { "input": "abcabc\nabdabdabd", "output": "0" }, { "input": "aaaaaa\naaaaaaaaa", "output": "2" }, { "input": "aaa\nbbb", "output": "0" } ]
1,433,893,222
2,147,483,647
PyPy 3
OK
TESTS
75
622
16,998,400
t = 0 from fractions import gcd x = input() y = input() lx = len(x) ly = len(y) g = gcd(lx, ly) for i in range(1, g+1): if g % i == 0: rep = x[:i] if x == (lx//i) * rep and y == (ly//i) * rep: t += 1 print(t)
Title: Common Divisors Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya has recently learned at school what a number's divisor is and decided to determine a string's divisor. Here is what he came up with. String *a* is the divisor of string *b* if and only if there exists a positive integer *x* such that if we write out string *a* consecutively *x* times, we get string *b*. For example, string "abab" has two divisors — "ab" and "abab". Now Vasya wants to write a program that calculates the number of common divisors of two strings. Please help him. Input Specification: The first input line contains a non-empty string *s*1. The second input line contains a non-empty string *s*2. Lengths of strings *s*1 and *s*2 are positive and do not exceed 105. The strings only consist of lowercase Latin letters. Output Specification: Print the number of common divisors of strings *s*1 and *s*2. Demo Input: ['abcdabcd\nabcdabcdabcdabcd\n', 'aaa\naa\n'] Demo Output: ['2\n', '1\n'] Note: In first sample the common divisors are strings "abcd" and "abcdabcd". In the second sample the common divisor is a single string "a". String "aa" isn't included in the answer as it isn't a divisor of string "aaa".
```python t = 0 from fractions import gcd x = input() y = input() lx = len(x) ly = len(y) g = gcd(lx, ly) for i in range(1, g+1): if g % i == 0: rep = x[:i] if x == (lx//i) * rep and y == (ly//i) * rep: t += 1 print(t) ```
3
268
A
Games
PROGRAMMING
800
[ "brute force" ]
null
null
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
In a single line print the number of games where the host team is going to play in the guest uniform.
[ "3\n1 2\n2 4\n3 4\n", "4\n100 42\n42 100\n5 42\n100 5\n", "2\n1 2\n1 2\n" ]
[ "1\n", "5\n", "0\n" ]
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
500
[ { "input": "3\n1 2\n2 4\n3 4", "output": "1" }, { "input": "4\n100 42\n42 100\n5 42\n100 5", "output": "5" }, { "input": "2\n1 2\n1 2", "output": "0" }, { "input": "7\n4 7\n52 55\n16 4\n55 4\n20 99\n3 4\n7 52", "output": "6" }, { "input": "10\n68 42\n1 35\n25 70\n59 79\n65 63\n46 6\n28 82\n92 62\n43 96\n37 28", "output": "1" }, { "input": "30\n10 39\n89 1\n78 58\n75 99\n36 13\n77 50\n6 97\n79 28\n27 52\n56 5\n93 96\n40 21\n33 74\n26 37\n53 59\n98 56\n61 65\n42 57\n9 7\n25 63\n74 34\n96 84\n95 47\n12 23\n34 21\n71 6\n27 13\n15 47\n64 14\n12 77", "output": "6" }, { "input": "30\n46 100\n87 53\n34 84\n44 66\n23 20\n50 34\n90 66\n17 39\n13 22\n94 33\n92 46\n63 78\n26 48\n44 61\n3 19\n41 84\n62 31\n65 89\n23 28\n58 57\n19 85\n26 60\n75 66\n69 67\n76 15\n64 15\n36 72\n90 89\n42 69\n45 35", "output": "4" }, { "input": "2\n46 6\n6 46", "output": "2" }, { "input": "29\n8 18\n33 75\n69 22\n97 95\n1 97\n78 10\n88 18\n13 3\n19 64\n98 12\n79 92\n41 72\n69 15\n98 31\n57 74\n15 56\n36 37\n15 66\n63 100\n16 42\n47 56\n6 4\n73 15\n30 24\n27 71\n12 19\n88 69\n85 6\n50 11", "output": "10" }, { "input": "23\n43 78\n31 28\n58 80\n66 63\n20 4\n51 95\n40 20\n50 14\n5 34\n36 39\n77 42\n64 97\n62 89\n16 56\n8 34\n58 16\n37 35\n37 66\n8 54\n50 36\n24 8\n68 48\n85 33", "output": "6" }, { "input": "13\n76 58\n32 85\n99 79\n23 58\n96 59\n72 35\n53 43\n96 55\n41 78\n75 10\n28 11\n72 7\n52 73", "output": "0" }, { "input": "18\n6 90\n70 79\n26 52\n67 81\n29 95\n41 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 2", "output": "1" }, { "input": "18\n6 90\n100 79\n26 100\n67 100\n29 100\n100 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 100", "output": "8" }, { "input": "30\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "450" }, { "input": "30\n100 99\n58 59\n56 57\n54 55\n52 53\n50 51\n48 49\n46 47\n44 45\n42 43\n40 41\n38 39\n36 37\n34 35\n32 33\n30 31\n28 29\n26 27\n24 25\n22 23\n20 21\n18 19\n16 17\n14 15\n12 13\n10 11\n8 9\n6 7\n4 5\n2 3", "output": "0" }, { "input": "15\n9 3\n2 6\n7 6\n5 10\n9 5\n8 1\n10 5\n2 8\n4 5\n9 8\n5 3\n3 8\n9 8\n4 10\n8 5", "output": "20" }, { "input": "15\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n1 2", "output": "108" }, { "input": "25\n2 1\n1 2\n1 2\n1 2\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n1 2\n2 1\n2 1\n2 1\n2 1\n1 2", "output": "312" }, { "input": "25\n91 57\n2 73\n54 57\n2 57\n23 57\n2 6\n57 54\n57 23\n91 54\n91 23\n57 23\n91 57\n54 2\n6 91\n57 54\n2 57\n57 91\n73 91\n57 23\n91 57\n2 73\n91 2\n23 6\n2 73\n23 6", "output": "96" }, { "input": "28\n31 66\n31 91\n91 31\n97 66\n31 66\n31 66\n66 91\n91 31\n97 31\n91 97\n97 31\n66 31\n66 97\n91 31\n31 66\n31 66\n66 31\n31 97\n66 97\n97 31\n31 91\n66 91\n91 66\n31 66\n91 66\n66 31\n66 31\n91 97", "output": "210" }, { "input": "29\n78 27\n50 68\n24 26\n68 43\n38 78\n26 38\n78 28\n28 26\n27 24\n23 38\n24 26\n24 43\n61 50\n38 78\n27 23\n61 26\n27 28\n43 23\n28 78\n43 27\n43 78\n27 61\n28 38\n61 78\n50 26\n43 27\n26 78\n28 50\n43 78", "output": "73" }, { "input": "29\n80 27\n69 80\n27 80\n69 80\n80 27\n80 27\n80 27\n80 69\n27 69\n80 69\n80 27\n27 69\n69 27\n80 69\n27 69\n69 80\n27 69\n80 69\n80 27\n69 27\n27 69\n27 80\n80 27\n69 80\n27 69\n80 69\n69 80\n69 80\n27 80", "output": "277" }, { "input": "30\n19 71\n7 89\n89 71\n21 7\n19 21\n7 89\n19 71\n89 8\n89 21\n19 8\n21 7\n8 89\n19 89\n7 21\n19 8\n19 7\n7 19\n8 21\n71 21\n71 89\n7 19\n7 19\n21 7\n21 19\n21 19\n71 8\n21 8\n71 19\n19 71\n8 21", "output": "154" }, { "input": "30\n44 17\n44 17\n44 17\n17 44\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n44 17\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n17 44\n44 17\n44 17\n44 17\n17 44\n17 44\n44 17\n17 44\n44 17\n44 17\n44 17", "output": "418" }, { "input": "22\n78 92\n15 92\n92 78\n78 80\n92 16\n24 80\n92 16\n16 92\n78 16\n24 78\n80 78\n92 80\n16 80\n80 78\n15 78\n92 16\n24 15\n24 80\n80 16\n16 80\n92 80\n24 80", "output": "74" }, { "input": "24\n9 83\n90 31\n83 3\n83 3\n21 31\n83 3\n32 31\n12 21\n31 21\n90 32\n32 21\n12 9\n12 31\n9 83\n83 12\n32 3\n32 83\n90 31\n9 32\n31 21\n83 90\n32 21\n21 3\n32 9", "output": "59" }, { "input": "30\n67 21\n85 39\n85 87\n21 39\n66 85\n10 95\n10 21\n87 85\n82 21\n67 21\n95 10\n21 39\n82 21\n21 66\n66 39\n95 30\n67 85\n66 82\n85 82\n21 66\n10 39\n67 10\n21 85\n10 82\n85 95\n10 85\n21 39\n85 39\n39 10\n95 67", "output": "100" }, { "input": "4\n8 7\n8 7\n7 8\n7 8", "output": "8" }, { "input": "6\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1", "output": "10" }, { "input": "12\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "72" }, { "input": "4\n1 2\n1 2\n2 1\n2 1", "output": "8" } ]
1,691,376,360
2,147,483,647
Python 3
OK
TESTS
31
92
0
n=int(input()) d1={} d2={} for _ in range(n): h,a=map(int,input().split()) if h in d1: d1[h]+=1 else: d1[h]=1 if a in d2: d2[a]+=1 else: d2[a]=1 c=0 for i in d1: if i in d2: c+=d2[i]*d1[i] print(c)
Title: Games Time Limit: None seconds Memory Limit: None megabytes Problem Description: Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question. Input Specification: The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively. Output Specification: In a single line print the number of games where the host team is going to play in the guest uniform. Demo Input: ['3\n1 2\n2 4\n3 4\n', '4\n100 42\n42 100\n5 42\n100 5\n', '2\n1 2\n1 2\n'] Demo Output: ['1\n', '5\n', '0\n'] Note: In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
```python n=int(input()) d1={} d2={} for _ in range(n): h,a=map(int,input().split()) if h in d1: d1[h]+=1 else: d1[h]=1 if a in d2: d2[a]+=1 else: d2[a]=1 c=0 for i in d1: if i in d2: c+=d2[i]*d1[i] print(c) ```
3
821
C
Okabe and Boxes
PROGRAMMING
1,500
[ "data structures", "greedy", "trees" ]
null
null
Okabe and Super Hacker Daru are stacking and removing boxes. There are *n* boxes numbered from 1 to *n*. Initially there are no boxes on the stack. Okabe, being a control freak, gives Daru 2*n* commands: *n* of which are to add a box to the top of the stack, and *n* of which are to remove a box from the top of the stack and throw it in the trash. Okabe wants Daru to throw away the boxes in the order from 1 to *n*. Of course, this means that it might be impossible for Daru to perform some of Okabe's remove commands, because the required box is not on the top of the stack. That's why Daru can decide to wait until Okabe looks away and then reorder the boxes in the stack in any way he wants. He can do it at any point of time between Okabe's commands, but he can't add or remove boxes while he does it. Tell Daru the minimum number of times he needs to reorder the boxes so that he can successfully complete all of Okabe's commands. It is guaranteed that every box is added before it is required to be removed.
The first line of input contains the integer *n* (1<=≤<=*n*<=≤<=3·105) — the number of boxes. Each of the next 2*n* lines of input starts with a string "add" or "remove". If the line starts with the "add", an integer *x* (1<=≤<=*x*<=≤<=*n*) follows, indicating that Daru should add the box with number *x* to the top of the stack. It is guaranteed that exactly *n* lines contain "add" operations, all the boxes added are distinct, and *n* lines contain "remove" operations. It is also guaranteed that a box is always added before it is required to be removed.
Print the minimum number of times Daru needs to reorder the boxes to successfully complete all of Okabe's commands.
[ "3\nadd 1\nremove\nadd 2\nadd 3\nremove\nremove\n", "7\nadd 3\nadd 2\nadd 1\nremove\nadd 4\nremove\nremove\nremove\nadd 6\nadd 7\nadd 5\nremove\nremove\nremove\n" ]
[ "1\n", "2\n" ]
In the first sample, Daru should reorder the boxes after adding box 3 to the stack. In the second sample, Daru should reorder the boxes after adding box 4 and box 7 to the stack.
1,500
[ { "input": "3\nadd 1\nremove\nadd 2\nadd 3\nremove\nremove", "output": "1" }, { "input": "7\nadd 3\nadd 2\nadd 1\nremove\nadd 4\nremove\nremove\nremove\nadd 6\nadd 7\nadd 5\nremove\nremove\nremove", "output": "2" }, { "input": "4\nadd 1\nadd 3\nremove\nadd 4\nadd 2\nremove\nremove\nremove", "output": "2" }, { "input": "2\nadd 1\nremove\nadd 2\nremove", "output": "0" }, { "input": "1\nadd 1\nremove", "output": "0" }, { "input": "15\nadd 12\nadd 7\nadd 10\nadd 11\nadd 5\nadd 2\nadd 1\nadd 6\nadd 8\nremove\nremove\nadd 15\nadd 4\nadd 13\nadd 9\nadd 3\nadd 14\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove", "output": "2" }, { "input": "14\nadd 7\nadd 2\nadd 13\nadd 5\nadd 12\nadd 6\nadd 4\nadd 1\nadd 14\nremove\nadd 10\nremove\nadd 9\nadd 8\nadd 11\nadd 3\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove", "output": "3" }, { "input": "11\nadd 10\nadd 9\nadd 11\nadd 1\nadd 5\nadd 6\nremove\nadd 3\nadd 8\nadd 2\nadd 4\nremove\nremove\nremove\nremove\nremove\nadd 7\nremove\nremove\nremove\nremove\nremove", "output": "2" }, { "input": "3\nadd 3\nadd 2\nadd 1\nremove\nremove\nremove", "output": "0" }, { "input": "4\nadd 1\nadd 3\nadd 4\nremove\nadd 2\nremove\nremove\nremove", "output": "1" }, { "input": "6\nadd 3\nadd 4\nadd 5\nadd 1\nadd 6\nremove\nadd 2\nremove\nremove\nremove\nremove\nremove", "output": "1" }, { "input": "16\nadd 1\nadd 2\nadd 3\nadd 4\nadd 5\nadd 6\nadd 7\nadd 8\nadd 9\nadd 10\nadd 11\nadd 12\nadd 13\nadd 14\nadd 15\nadd 16\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove", "output": "1" }, { "input": "2\nadd 2\nadd 1\nremove\nremove", "output": "0" }, { "input": "17\nadd 1\nadd 2\nadd 3\nadd 4\nadd 5\nadd 6\nadd 7\nadd 8\nadd 9\nadd 10\nadd 11\nadd 12\nadd 13\nadd 14\nadd 15\nadd 16\nadd 17\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove", "output": "1" }, { "input": "18\nadd 1\nadd 2\nadd 3\nadd 4\nadd 5\nadd 6\nadd 7\nadd 8\nadd 9\nadd 10\nadd 11\nadd 12\nadd 13\nadd 14\nadd 15\nadd 16\nadd 17\nadd 18\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove", "output": "1" }, { "input": "4\nadd 1\nadd 2\nremove\nremove\nadd 4\nadd 3\nremove\nremove", "output": "1" }, { "input": "19\nadd 1\nadd 2\nadd 3\nadd 4\nadd 5\nadd 6\nadd 7\nadd 8\nadd 9\nadd 10\nadd 11\nadd 12\nadd 13\nadd 14\nadd 15\nadd 16\nadd 17\nadd 18\nadd 19\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove\nremove", "output": "1" }, { "input": "5\nadd 4\nadd 3\nadd 1\nremove\nadd 2\nremove\nremove\nadd 5\nremove\nremove", "output": "1" }, { "input": "7\nadd 4\nadd 6\nadd 1\nadd 5\nadd 7\nremove\nadd 2\nremove\nadd 3\nremove\nremove\nremove\nremove\nremove", "output": "1" }, { "input": "8\nadd 1\nadd 2\nadd 3\nadd 7\nadd 8\nremove\nremove\nremove\nadd 6\nadd 5\nadd 4\nremove\nremove\nremove\nremove\nremove", "output": "1" }, { "input": "4\nadd 1\nadd 4\nremove\nadd 3\nadd 2\nremove\nremove\nremove", "output": "1" }, { "input": "7\nadd 1\nadd 2\nadd 3\nadd 5\nadd 7\nremove\nremove\nremove\nadd 4\nremove\nremove\nadd 6\nremove\nremove", "output": "1" }, { "input": "4\nadd 4\nadd 1\nadd 2\nremove\nremove\nadd 3\nremove\nremove", "output": "1" }, { "input": "5\nadd 1\nadd 3\nadd 4\nadd 5\nremove\nadd 2\nremove\nremove\nremove\nremove", "output": "1" }, { "input": "5\nadd 2\nadd 1\nremove\nremove\nadd 5\nadd 3\nremove\nadd 4\nremove\nremove", "output": "0" }, { "input": "9\nadd 3\nadd 2\nadd 1\nadd 4\nadd 6\nadd 9\nremove\nremove\nremove\nremove\nadd 5\nremove\nremove\nadd 8\nadd 7\nremove\nremove\nremove", "output": "1" }, { "input": "10\nadd 9\nadd 10\nadd 4\nadd 3\nadd 2\nadd 1\nremove\nremove\nremove\nremove\nadd 8\nadd 7\nadd 5\nadd 6\nremove\nremove\nremove\nremove\nremove\nremove", "output": "1" } ]
1,631,029,840
2,147,483,647
Python 3
OK
TESTS
89
967
14,540,800
n=int(input()) l=[] tmp=0 c=0 for _ in range(2*n): s=input().split() if s[0]=='add': l.append(int(s[1])) else: tmp+=1 m=len(l) if m>0 and l[-1]==tmp: l.pop() elif m>0: l=[] c+=1 print(c)
Title: Okabe and Boxes Time Limit: None seconds Memory Limit: None megabytes Problem Description: Okabe and Super Hacker Daru are stacking and removing boxes. There are *n* boxes numbered from 1 to *n*. Initially there are no boxes on the stack. Okabe, being a control freak, gives Daru 2*n* commands: *n* of which are to add a box to the top of the stack, and *n* of which are to remove a box from the top of the stack and throw it in the trash. Okabe wants Daru to throw away the boxes in the order from 1 to *n*. Of course, this means that it might be impossible for Daru to perform some of Okabe's remove commands, because the required box is not on the top of the stack. That's why Daru can decide to wait until Okabe looks away and then reorder the boxes in the stack in any way he wants. He can do it at any point of time between Okabe's commands, but he can't add or remove boxes while he does it. Tell Daru the minimum number of times he needs to reorder the boxes so that he can successfully complete all of Okabe's commands. It is guaranteed that every box is added before it is required to be removed. Input Specification: The first line of input contains the integer *n* (1<=≤<=*n*<=≤<=3·105) — the number of boxes. Each of the next 2*n* lines of input starts with a string "add" or "remove". If the line starts with the "add", an integer *x* (1<=≤<=*x*<=≤<=*n*) follows, indicating that Daru should add the box with number *x* to the top of the stack. It is guaranteed that exactly *n* lines contain "add" operations, all the boxes added are distinct, and *n* lines contain "remove" operations. It is also guaranteed that a box is always added before it is required to be removed. Output Specification: Print the minimum number of times Daru needs to reorder the boxes to successfully complete all of Okabe's commands. Demo Input: ['3\nadd 1\nremove\nadd 2\nadd 3\nremove\nremove\n', '7\nadd 3\nadd 2\nadd 1\nremove\nadd 4\nremove\nremove\nremove\nadd 6\nadd 7\nadd 5\nremove\nremove\nremove\n'] Demo Output: ['1\n', '2\n'] Note: In the first sample, Daru should reorder the boxes after adding box 3 to the stack. In the second sample, Daru should reorder the boxes after adding box 4 and box 7 to the stack.
```python n=int(input()) l=[] tmp=0 c=0 for _ in range(2*n): s=input().split() if s[0]=='add': l.append(int(s[1])) else: tmp+=1 m=len(l) if m>0 and l[-1]==tmp: l.pop() elif m>0: l=[] c+=1 print(c) ```
3
837
A
Text Volume
PROGRAMMING
800
[ "implementation" ]
null
null
You are given a text of single-space separated words, consisting of small and capital Latin letters. Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text. Calculate the volume of the given text.
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text. The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters.
Print one integer number — volume of text.
[ "7\nNonZERO\n", "24\nthis is zero answer text\n", "24\nHarbour Space University\n" ]
[ "5\n", "0\n", "1\n" ]
In the first example there is only one word, there are 5 capital letters in it. In the second example all of the words contain 0 capital letters.
0
[ { "input": "7\nNonZERO", "output": "5" }, { "input": "24\nthis is zero answer text", "output": "0" }, { "input": "24\nHarbour Space University", "output": "1" }, { "input": "2\nWM", "output": "2" }, { "input": "200\nLBmJKQLCKUgtTxMoDsEerwvLOXsxASSydOqWyULsRcjMYDWdDCgaDvBfATIWPVSXlbcCLHPYahhxMEYUiaxoCebghJqvmRnaNHYTKLeOiaLDnATPZAOgSNfBzaxLymTGjfzvTegbXsAthTxyDTcmBUkqyGlVGZhoazQzVSoKbTFcCRvYsgSCwjGMxBfWEwMHuagTBxkz", "output": "105" }, { "input": "199\no A r v H e J q k J k v w Q F p O R y R Z o a K R L Z E H t X y X N y y p b x B m r R S q i A x V S u i c L y M n N X c C W Z m S j e w C w T r I S X T D F l w o k f t X u n W w p Z r A k I Y E h s g", "output": "1" }, { "input": "200\nhCyIdivIiISmmYIsCLbpKcTyHaOgTUQEwnQACXnrLdHAVFLtvliTEMlzBVzTesQbhXmcqvwPDeojglBMIjOXANfyQxCSjOJyO SIqOTnRzVzseGIDDYNtrwIusScWSuEhPyEmgQIVEzXofRptjeMzzhtUQxJgcUWILUhEaaRmYRBVsjoqgmyPIKwSajdlNPccOOtWrez", "output": "50" }, { "input": "1\ne", "output": "0" }, { "input": "1\nA", "output": "1" }, { "input": "200\nABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU VWXYZABCDE KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KZ", "output": "10" }, { "input": "200\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "200" }, { "input": "200\nffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff", "output": "0" }, { "input": "24\nHarbour Space UniversitY", "output": "2" }, { "input": "5\naA AA", "output": "2" }, { "input": "10\nas AS ASDA", "output": "4" }, { "input": "10\nas AS ASDZ", "output": "4" }, { "input": "3\na A", "output": "1" }, { "input": "24\nHarbour space UniversitY", "output": "2" }, { "input": "10\nas AS ASAa", "output": "3" }, { "input": "15\naAb ABCDFGRHTJS", "output": "11" }, { "input": "53\nsdfAZEZR AZE dfdf dsdRFGSDF ZZDZSD dfsd ERBGF dsfsdfR", "output": "6" }, { "input": "10\nABC ABc AB", "output": "3" }, { "input": "10\nA c de CDE", "output": "3" }, { "input": "4\nA AB", "output": "2" }, { "input": "18\nHARbour Space UNIV", "output": "4" }, { "input": "13\na b c d e f A", "output": "1" }, { "input": "6\nA B CA", "output": "2" }, { "input": "4\naa A", "output": "1" }, { "input": "3\nA a", "output": "1" } ]
1,503,310,042
2,147,483,647
Python 3
OK
TESTS
29
93
0
l = int(input()) sList = input().split() vol = 0 for i in sList: tempVol = 0 for j in i: if j.isupper(): tempVol += 1 if tempVol > vol: vol = tempVol print(vol)
Title: Text Volume Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a text of single-space separated words, consisting of small and capital Latin letters. Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text. Calculate the volume of the given text. Input Specification: The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text. The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters. Output Specification: Print one integer number — volume of text. Demo Input: ['7\nNonZERO\n', '24\nthis is zero answer text\n', '24\nHarbour Space University\n'] Demo Output: ['5\n', '0\n', '1\n'] Note: In the first example there is only one word, there are 5 capital letters in it. In the second example all of the words contain 0 capital letters.
```python l = int(input()) sList = input().split() vol = 0 for i in sList: tempVol = 0 for j in i: if j.isupper(): tempVol += 1 if tempVol > vol: vol = tempVol print(vol) ```
3
267
A
Subtractions
PROGRAMMING
900
[ "math", "number theory" ]
null
null
You've got two numbers. As long as they are both larger than zero, they go through the same operation: subtract the lesser number from the larger one. If they equal substract one number from the another. For example, one operation transforms pair (4,17) to pair (4,13), it transforms (5,5) to (0,5). You've got some number of pairs (*a**i*,<=*b**i*). How many operations will be performed for each of them?
The first line contains the number of pairs *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000). Then follow *n* lines, each line contains a pair of positive integers *a**i*,<=*b**i* (1<=<=≤<=<=*a**i*,<=<=*b**i*<=<=≤<=<=109).
Print the sought number of operations for each pair on a single line.
[ "2\n4 17\n7 987654321\n" ]
[ "8\n141093479\n" ]
none
500
[ { "input": "2\n4 17\n7 987654321", "output": "8\n141093479" }, { "input": "10\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321", "output": "141093479\n141093479\n141093479\n141093479\n141093479\n141093479\n141093479\n141093479\n141093479\n141093479" }, { "input": "1\n536870912 32", "output": "16777216" }, { "input": "20\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999", "output": "1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000" }, { "input": "3\n1000000000 1\n1000000000 1\n1 100000000", "output": "1000000000\n1000000000\n100000000" } ]
1,459,954,537
2,147,483,647
Python 3
OK
TESTS
35
93
5,120,000
__author__ = 'markdaniel' def main(): num1, num2 = [int(x) for x in input().split(' ')] maxval = max(num1, num2) minval = min(num1, num2) ops = 0 while maxval > 0 and minval > 0: remainderMultiple = ((maxval - minval) // minval) maxval -= remainderMultiple * minval ops += remainderMultiple maxval -= minval ops += 1 if maxval < minval: temp = maxval maxval = minval minval = temp return ops if __name__ == '__main__': cases = int(input()) for i in range(cases): print(main())
Title: Subtractions Time Limit: None seconds Memory Limit: None megabytes Problem Description: You've got two numbers. As long as they are both larger than zero, they go through the same operation: subtract the lesser number from the larger one. If they equal substract one number from the another. For example, one operation transforms pair (4,17) to pair (4,13), it transforms (5,5) to (0,5). You've got some number of pairs (*a**i*,<=*b**i*). How many operations will be performed for each of them? Input Specification: The first line contains the number of pairs *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000). Then follow *n* lines, each line contains a pair of positive integers *a**i*,<=*b**i* (1<=<=≤<=<=*a**i*,<=<=*b**i*<=<=≤<=<=109). Output Specification: Print the sought number of operations for each pair on a single line. Demo Input: ['2\n4 17\n7 987654321\n'] Demo Output: ['8\n141093479\n'] Note: none
```python __author__ = 'markdaniel' def main(): num1, num2 = [int(x) for x in input().split(' ')] maxval = max(num1, num2) minval = min(num1, num2) ops = 0 while maxval > 0 and minval > 0: remainderMultiple = ((maxval - minval) // minval) maxval -= remainderMultiple * minval ops += remainderMultiple maxval -= minval ops += 1 if maxval < minval: temp = maxval maxval = minval minval = temp return ops if __name__ == '__main__': cases = int(input()) for i in range(cases): print(main()) ```
3
27
A
Next Test
PROGRAMMING
1,200
[ "implementation", "sortings" ]
A. Next Test
2
256
«Polygon» is a system which allows to create programming tasks in a simple and professional way. When you add a test to the problem, the corresponding form asks you for the test index. As in most cases it is clear which index the next test will have, the system suggests the default value of the index. It is calculated as the smallest positive integer which is not used as an index for some previously added test. You are to implement this feature. Create a program which determines the default index of the next test, given the indexes of the previously added tests.
The first line contains one integer *n* (1<=≤<=*n*<=≤<=3000) — the amount of previously added tests. The second line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=3000) — indexes of these tests.
Output the required default value for the next test index.
[ "3\n1 7 2\n" ]
[ "3\n" ]
none
500
[ { "input": "1\n1", "output": "2" }, { "input": "2\n2 1", "output": "3" }, { "input": "3\n3 4 1", "output": "2" }, { "input": "4\n6 4 3 5", "output": "1" }, { "input": "5\n3 2 1 7 4", "output": "5" }, { "input": "6\n4 1 2 5 3 7", "output": "6" }, { "input": "7\n3 2 1 6 5 7 4", "output": "8" }, { "input": "8\n2 8 3 7 6 9 1 5", "output": "4" }, { "input": "9\n10 5 9 3 8 7 1 2 4", "output": "6" }, { "input": "10\n7 2 3 8 9 6 5 4 1 10", "output": "11" }, { "input": "1\n1", "output": "2" }, { "input": "2\n1 2", "output": "3" }, { "input": "3\n2 4 1", "output": "3" }, { "input": "4\n4 2 3 1", "output": "5" }, { "input": "5\n3 1 4 2 5", "output": "6" }, { "input": "6\n1 3 6 7 2 4", "output": "5" }, { "input": "7\n1 5 4 7 2 3 6", "output": "8" }, { "input": "8\n12 1 6 5 2 8 3 4", "output": "7" }, { "input": "9\n3 2 7 5 6 4 1 9 10", "output": "8" }, { "input": "10\n1 7 13 6 5 10 3 8 2 4", "output": "9" }, { "input": "1\n2", "output": "1" }, { "input": "1\n3", "output": "1" }, { "input": "1\n3000", "output": "1" }, { "input": "2\n2 3", "output": "1" }, { "input": "2\n3000 1", "output": "2" } ]
1,418,117,628
2,147,483,647
Python 3
OK
TESTS
30
124
307,200
n = int(input()) my_list = input().split(" ") for x in range(len(my_list)): my_list[x] = int(my_list[x]) my_list.sort() flag = False for i in range(n): if my_list[i] == i+1: continue else: print(i+1) flag = True break if flag: pass else: print(n+1)
Title: Next Test Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: «Polygon» is a system which allows to create programming tasks in a simple and professional way. When you add a test to the problem, the corresponding form asks you for the test index. As in most cases it is clear which index the next test will have, the system suggests the default value of the index. It is calculated as the smallest positive integer which is not used as an index for some previously added test. You are to implement this feature. Create a program which determines the default index of the next test, given the indexes of the previously added tests. Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=3000) — the amount of previously added tests. The second line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=3000) — indexes of these tests. Output Specification: Output the required default value for the next test index. Demo Input: ['3\n1 7 2\n'] Demo Output: ['3\n'] Note: none
```python n = int(input()) my_list = input().split(" ") for x in range(len(my_list)): my_list[x] = int(my_list[x]) my_list.sort() flag = False for i in range(n): if my_list[i] == i+1: continue else: print(i+1) flag = True break if flag: pass else: print(n+1) ```
3.968428
810
A
Straight <<A>>
PROGRAMMING
900
[ "implementation", "math" ]
null
null
Noora is a student of one famous high school. It's her final year in school — she is going to study in university next year. However, she has to get an «A» graduation certificate in order to apply to a prestigious one. In school, where Noora is studying, teachers are putting down marks to the online class register, which are integers from 1 to *k*. The worst mark is 1, the best is *k*. Mark that is going to the certificate, is calculated as an average of all the marks, rounded to the closest integer. If several answers are possible, rounding up is produced. For example, 7.3 is rounded to 7, but 7.5 and 7.8784 — to 8. For instance, if Noora has marks [8,<=9], then the mark to the certificate is 9, because the average is equal to 8.5 and rounded to 9, but if the marks are [8,<=8,<=9], Noora will have graduation certificate with 8. To graduate with «A» certificate, Noora has to have mark *k*. Noora got *n* marks in register this year. However, she is afraid that her marks are not enough to get final mark *k*. Noora decided to ask for help in the internet, where hacker Leha immediately responded to her request. He is ready to hack class register for Noora and to add Noora any number of additional marks from 1 to *k*. At the same time, Leha want his hack be unseen to everyone, so he decided to add as less as possible additional marks. Please help Leha to calculate the minimal number of marks he has to add, so that final Noora's mark will become equal to *k*.
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*k*<=≤<=100) denoting the number of marks, received by Noora and the value of highest possible mark. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*k*) denoting marks received by Noora before Leha's hack.
Print a single integer — minimal number of additional marks, that Leha has to add in order to change Noora's final mark to *k*.
[ "2 10\n8 9\n", "3 5\n4 4 4\n" ]
[ "4", "3" ]
Consider the first example testcase. Maximal mark is 10, Noora received two marks — 8 and 9, so current final mark is 9. To fix it, Leha can add marks [10, 10, 10, 10] (4 marks in total) to the registry, achieving Noora having average mark equal to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1b961585522f76271546da990a6228e7c666277f.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Consequently, new final mark is 10. Less number of marks won't fix the situation. In the second example Leha can add [5, 5, 5] to the registry, so that making average mark equal to 4.5, which is enough to have 5 in the certificate.
500
[ { "input": "2 10\n8 9", "output": "4" }, { "input": "3 5\n4 4 4", "output": "3" }, { "input": "3 10\n10 8 9", "output": "3" }, { "input": "2 23\n21 23", "output": "2" }, { "input": "5 10\n5 10 10 9 10", "output": "7" }, { "input": "12 50\n18 10 26 22 22 23 14 21 27 18 25 12", "output": "712" }, { "input": "38 12\n2 7 10 8 5 3 5 6 3 6 5 1 9 7 7 8 3 4 4 4 5 2 3 6 6 1 6 7 4 4 8 7 4 5 3 6 6 6", "output": "482" }, { "input": "63 86\n32 31 36 29 36 26 28 38 39 32 29 26 33 38 36 38 36 28 43 48 28 33 25 39 39 27 34 25 37 28 40 26 30 31 42 32 36 44 29 36 30 35 48 40 26 34 30 33 33 46 42 24 36 38 33 51 33 41 38 29 29 32 28", "output": "6469" }, { "input": "100 38\n30 24 38 31 31 33 32 32 29 34 29 22 27 23 34 25 32 30 30 26 16 27 38 33 38 38 37 34 32 27 33 23 33 32 24 24 30 36 29 30 33 30 29 30 36 33 33 35 28 24 30 32 38 29 30 36 31 30 27 38 31 36 15 37 32 27 29 24 38 33 28 29 34 21 37 35 32 31 27 25 27 28 31 31 36 38 35 35 36 29 35 22 38 31 38 28 31 27 34 31", "output": "1340" }, { "input": "33 69\n60 69 68 69 69 60 64 60 62 59 54 47 60 62 69 69 69 58 67 69 62 69 68 53 69 69 66 66 57 58 65 69 61", "output": "329" }, { "input": "39 92\n19 17 16 19 15 30 21 25 14 17 19 19 23 16 14 15 17 19 29 15 11 25 19 14 18 20 10 16 11 15 18 20 20 17 18 16 12 17 16", "output": "5753" }, { "input": "68 29\n29 29 29 29 29 28 29 29 29 27 29 29 29 29 29 29 29 23 29 29 26 29 29 29 29 29 29 29 29 29 29 29 29 29 29 29 26 29 29 29 29 29 29 29 29 29 29 29 29 22 29 29 29 29 29 29 29 29 29 29 29 29 29 28 29 29 29 29", "output": "0" }, { "input": "75 30\n22 18 21 26 23 18 28 30 24 24 19 25 28 30 23 29 18 23 23 30 26 30 17 30 18 19 25 26 26 15 27 23 30 21 19 26 25 30 25 28 20 22 22 21 26 17 23 23 24 15 25 19 18 22 30 30 29 21 30 28 28 30 27 25 24 15 22 19 30 21 20 30 18 20 25", "output": "851" }, { "input": "78 43\n2 7 6 5 5 6 4 5 3 4 6 8 4 5 5 4 3 1 2 4 4 6 5 6 4 4 6 4 8 4 6 5 6 1 4 5 6 3 2 5 2 5 3 4 8 8 3 3 4 4 6 6 5 4 5 5 7 9 3 9 6 4 7 3 6 9 6 5 1 7 2 5 6 3 6 2 5 4", "output": "5884" }, { "input": "82 88\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 2 1 1 2 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1", "output": "14170" }, { "input": "84 77\n28 26 36 38 37 44 48 34 40 22 42 35 40 37 30 31 33 35 36 55 47 36 33 47 40 38 27 38 36 33 35 31 47 33 30 38 38 47 49 24 38 37 28 43 39 36 34 33 29 38 36 43 48 38 36 34 33 34 35 31 26 33 39 37 37 37 35 52 47 30 24 46 38 26 43 46 41 50 33 40 36 41 37 30", "output": "6650" }, { "input": "94 80\n21 19 15 16 27 16 20 18 19 19 15 15 20 19 19 21 20 19 13 17 15 9 17 15 23 15 12 18 12 13 15 12 14 13 14 17 20 20 14 21 15 6 10 23 24 8 18 18 13 23 17 22 17 19 19 18 17 24 8 16 18 20 24 19 10 19 15 10 13 14 19 15 16 19 20 15 14 21 16 16 14 14 22 19 12 11 14 13 19 32 16 16 13 20", "output": "11786" }, { "input": "96 41\n13 32 27 34 28 34 30 26 21 24 29 20 25 34 25 16 27 15 22 22 34 22 25 19 23 17 17 22 26 24 23 20 21 27 19 33 13 24 22 18 30 30 27 14 26 24 20 20 22 11 19 31 19 29 18 28 30 22 17 15 28 32 17 24 17 24 24 19 26 23 22 29 18 22 23 29 19 32 26 23 22 22 24 23 27 30 24 25 21 21 33 19 35 27 34 28", "output": "3182" }, { "input": "1 26\n26", "output": "0" }, { "input": "99 39\n25 28 30 28 32 34 31 28 29 28 29 30 33 19 33 31 27 33 29 24 27 30 25 38 28 34 35 31 34 37 30 22 21 24 34 27 34 33 34 33 26 26 36 19 30 22 35 30 21 28 23 35 33 29 21 22 36 31 34 32 34 32 30 32 27 33 38 25 35 26 39 27 29 29 19 33 28 29 34 38 26 30 36 26 29 30 26 34 22 32 29 38 25 27 24 17 25 28 26", "output": "1807" }, { "input": "100 12\n7 6 6 3 5 5 9 8 7 7 4 7 12 6 9 5 6 3 4 7 9 10 7 7 5 3 9 6 9 9 6 7 4 10 4 8 8 6 9 8 6 5 7 4 10 7 5 6 8 9 3 4 8 5 4 8 6 10 5 8 7 5 9 8 5 8 5 6 9 11 4 9 5 5 11 4 6 6 7 3 8 9 6 7 10 4 7 6 9 4 8 11 5 4 10 8 5 10 11 4", "output": "946" }, { "input": "100 18\n1 2 2 2 2 2 1 1 1 2 3 1 3 1 1 4 2 4 1 2 1 2 1 3 2 1 2 1 1 1 2 1 2 2 1 1 4 3 1 1 2 1 3 3 2 1 2 2 1 1 1 1 3 1 1 2 2 1 1 1 5 1 2 1 3 2 2 1 4 2 2 1 1 1 1 1 1 1 1 2 2 1 2 1 1 1 2 1 2 2 2 1 1 3 1 1 2 1 1 2", "output": "3164" }, { "input": "100 27\n16 20 21 10 16 17 18 25 19 18 20 12 11 21 21 23 20 26 20 21 27 16 25 18 25 21 27 12 20 27 18 17 27 13 21 26 12 22 15 21 25 21 18 27 24 15 16 18 23 21 24 27 19 17 24 14 21 16 24 26 13 14 25 18 27 26 22 16 27 27 17 25 17 12 22 10 19 27 19 20 23 22 25 23 17 25 14 20 22 10 22 27 21 20 15 26 24 27 12 16", "output": "1262" }, { "input": "100 29\n20 18 23 24 14 14 16 23 22 17 18 22 21 21 19 19 14 11 18 19 16 22 25 20 14 13 21 24 18 16 18 29 17 25 12 10 18 28 11 16 17 14 15 20 17 20 18 22 10 16 16 20 18 19 29 18 25 27 17 19 24 15 24 25 16 23 19 16 16 20 19 15 12 21 20 13 21 15 15 23 16 23 17 13 17 21 13 18 17 18 18 20 16 12 19 15 27 14 11 18", "output": "2024" }, { "input": "100 30\n16 10 20 11 14 27 15 17 22 26 24 17 15 18 19 22 22 15 21 22 14 21 22 22 21 22 15 17 17 22 18 19 26 18 22 20 22 25 18 18 17 23 18 18 20 13 19 30 17 24 22 19 29 20 20 21 17 18 26 25 22 19 15 18 18 20 19 19 18 18 24 16 19 17 12 21 20 16 23 21 16 17 26 23 25 28 22 20 9 21 17 24 15 19 17 21 29 13 18 15", "output": "1984" }, { "input": "100 59\n56 58 53 59 59 48 59 54 46 59 59 58 48 59 55 59 59 50 59 56 59 59 59 59 59 59 59 57 59 53 45 53 50 59 50 55 58 54 59 56 54 59 59 59 59 48 56 59 59 57 59 59 48 43 55 57 39 59 46 55 55 52 58 57 51 59 59 59 59 53 59 43 51 54 46 59 57 43 50 59 47 58 59 59 59 55 46 56 55 59 56 47 56 56 46 51 47 48 59 55", "output": "740" }, { "input": "100 81\n6 7 6 6 7 6 6 6 3 9 4 5 4 3 4 6 6 6 1 3 9 5 2 3 8 5 6 9 6 6 6 5 4 4 7 7 3 6 11 7 6 4 8 7 12 6 4 10 2 4 9 11 7 4 7 7 8 8 6 7 9 8 4 5 8 13 6 6 6 8 6 2 5 6 7 5 4 4 4 4 2 6 4 8 3 4 7 7 6 7 7 10 5 10 6 7 4 11 8 4", "output": "14888" }, { "input": "100 100\n30 35 23 43 28 49 31 32 30 44 32 37 33 34 38 28 43 32 33 32 50 32 41 38 33 20 40 36 29 21 42 25 23 34 43 32 37 31 30 27 36 32 45 37 33 29 38 34 35 33 28 19 37 33 28 41 31 29 41 27 32 39 30 34 37 40 33 38 35 32 32 34 35 34 28 39 28 34 40 45 31 25 42 28 29 31 33 21 36 33 34 37 40 42 39 30 36 34 34 40", "output": "13118" }, { "input": "100 100\n71 87 100 85 89 98 90 90 71 65 76 75 85 100 81 100 91 80 73 89 86 78 82 89 77 92 78 90 100 81 85 89 73 100 66 60 72 88 91 73 93 76 88 81 86 78 83 77 74 93 97 94 85 78 82 78 91 91 100 78 89 76 78 82 81 78 83 88 87 83 78 98 85 97 98 89 88 75 76 86 74 81 70 76 86 84 99 100 89 94 72 84 82 88 83 89 78 99 87 76", "output": "3030" }, { "input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "19700" }, { "input": "100 100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "0" }, { "input": "100 100\n1 1 2 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "19696" }, { "input": "100 100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99", "output": "0" }, { "input": "100 100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 98 100 100 100 100 98 100 100 100 100 100 100 99 98 100 100 93 100 100 98 100 100 100 100 93 100 96 100 100 100 94 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 95 88 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "0" }, { "input": "100 100\n95 100 100 100 100 100 100 100 100 100 100 100 100 100 87 100 100 100 94 100 100 100 100 100 100 100 100 100 100 100 100 99 100 100 100 100 100 100 100 100 100 100 90 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 97 100 100 100 96 100 98 100 100 100 100 100 96 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 97 100 100 100 100", "output": "2" }, { "input": "100 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "100 2\n2 1 1 2 1 1 1 1 2 2 2 2 1 1 1 2 1 1 1 2 2 2 2 1 1 1 1 2 2 2 1 2 2 2 2 1 2 2 1 1 1 1 1 1 2 2 1 2 1 1 1 2 1 2 2 2 2 1 1 1 2 2 1 2 1 1 1 2 1 2 2 1 1 1 2 2 1 1 2 1 1 2 1 1 1 2 1 1 1 1 2 1 1 1 1 2 1 2 1 1", "output": "16" }, { "input": "3 5\n5 5 5", "output": "0" }, { "input": "7 7\n1 1 1 1 1 1 1", "output": "77" }, { "input": "1 1\n1", "output": "0" }, { "input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "19700" }, { "input": "4 10\n10 10 10 10", "output": "0" }, { "input": "1 10\n10", "output": "0" }, { "input": "10 1\n1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "3 10\n10 10 10", "output": "0" }, { "input": "2 4\n3 4", "output": "0" }, { "input": "1 2\n2", "output": "0" }, { "input": "3 4\n4 4 4", "output": "0" }, { "input": "3 2\n2 2 1", "output": "0" }, { "input": "5 5\n5 5 5 5 5", "output": "0" }, { "input": "3 3\n3 3 3", "output": "0" }, { "input": "2 9\n8 9", "output": "0" }, { "input": "3 10\n9 10 10", "output": "0" }, { "input": "1 3\n3", "output": "0" }, { "input": "2 2\n1 2", "output": "0" }, { "input": "2 10\n10 10", "output": "0" }, { "input": "23 14\n7 11 13 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14", "output": "0" }, { "input": "2 10\n9 10", "output": "0" }, { "input": "2 2\n2 2", "output": "0" }, { "input": "10 5\n5 5 5 5 5 5 5 5 5 4", "output": "0" }, { "input": "3 5\n4 5 5", "output": "0" }, { "input": "5 4\n4 4 4 4 4", "output": "0" }, { "input": "2 10\n10 9", "output": "0" }, { "input": "4 5\n3 5 5 5", "output": "0" }, { "input": "10 5\n5 5 5 5 5 5 5 5 5 5", "output": "0" }, { "input": "3 10\n10 10 9", "output": "0" }, { "input": "5 1\n1 1 1 1 1", "output": "0" }, { "input": "2 1\n1 1", "output": "0" }, { "input": "4 10\n9 10 10 10", "output": "0" }, { "input": "5 2\n2 2 2 2 2", "output": "0" }, { "input": "2 5\n4 5", "output": "0" }, { "input": "5 10\n10 10 10 10 10", "output": "0" }, { "input": "2 6\n6 6", "output": "0" }, { "input": "2 9\n9 9", "output": "0" }, { "input": "3 10\n10 9 10", "output": "0" }, { "input": "4 40\n39 40 40 40", "output": "0" }, { "input": "3 4\n3 4 4", "output": "0" }, { "input": "9 9\n9 9 9 9 9 9 9 9 9", "output": "0" }, { "input": "1 4\n4", "output": "0" }, { "input": "4 7\n1 1 1 1", "output": "44" }, { "input": "1 5\n5", "output": "0" }, { "input": "3 1\n1 1 1", "output": "0" }, { "input": "1 100\n100", "output": "0" }, { "input": "2 7\n3 5", "output": "10" }, { "input": "3 6\n6 6 6", "output": "0" }, { "input": "4 2\n1 2 2 2", "output": "0" }, { "input": "4 5\n4 5 5 5", "output": "0" }, { "input": "5 5\n1 1 1 1 1", "output": "35" }, { "input": "66 2\n1 2 2 2 2 1 1 2 1 2 2 2 2 2 2 1 2 1 2 1 2 1 2 1 2 1 1 1 1 2 2 1 2 2 1 1 2 1 2 2 1 1 1 2 1 2 1 2 1 2 1 2 2 2 2 1 2 2 1 2 1 1 1 2 2 1", "output": "0" }, { "input": "2 2\n2 1", "output": "0" }, { "input": "5 5\n5 5 5 4 5", "output": "0" }, { "input": "3 7\n1 1 1", "output": "33" }, { "input": "2 5\n5 5", "output": "0" }, { "input": "1 7\n1", "output": "11" }, { "input": "6 7\n1 1 1 1 1 1", "output": "66" }, { "input": "99 97\n15 80 78 69 12 84 36 51 89 77 88 10 1 19 67 85 6 36 8 70 14 45 88 97 22 13 75 57 83 27 13 97 9 90 68 51 76 37 5 2 16 92 11 48 13 77 35 19 15 74 22 29 21 12 28 42 56 5 32 41 62 75 71 71 68 72 24 77 11 28 78 27 53 88 74 66 1 42 18 16 18 39 75 38 81 5 13 39 40 75 13 36 53 83 9 54 57 63 64", "output": "10077" }, { "input": "8 7\n1 1 1 1 1 1 1 1", "output": "88" }, { "input": "3 2\n2 2 2", "output": "0" }, { "input": "6 5\n5 5 5 5 5 5", "output": "0" }, { "input": "10 5\n5 5 5 5 5 5 5 4 1 1", "output": "8" }, { "input": "1 5\n1", "output": "7" }, { "input": "10 10\n10 10 10 10 10 10 10 10 10 10", "output": "0" }, { "input": "2 3\n2 3", "output": "0" }, { "input": "1 9\n9", "output": "0" }, { "input": "74 2\n2 2 2 2 1 2 2 1 1 1 2 2 1 2 2 2 2 1 2 1 1 1 2 1 1 2 2 1 2 1 1 2 1 1 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 1 1 2 1 1 1 1 1 1 2 2 2 1 1 1 1 1 2 2 2 2 2 2 1 2", "output": "0" }, { "input": "5 5\n5 5 5 5 4", "output": "0" } ]
1,496,503,793
2,147,483,647
Python 3
OK
TESTS
106
62
0
def func(x, y): if ( (x/y - x//y) >= 0.5 ): return x//y + 1 else: return x//y n, k = [int (i) for i in input().split()] s = sum([int(i) for i in input().split()]) sr = s/n; j = 0 sr=func(s,n) while (sr != k): s += k n += 1 j+=1 sr = func(s, n) print(j)
Title: Straight <<A>> Time Limit: None seconds Memory Limit: None megabytes Problem Description: Noora is a student of one famous high school. It's her final year in school — she is going to study in university next year. However, she has to get an «A» graduation certificate in order to apply to a prestigious one. In school, where Noora is studying, teachers are putting down marks to the online class register, which are integers from 1 to *k*. The worst mark is 1, the best is *k*. Mark that is going to the certificate, is calculated as an average of all the marks, rounded to the closest integer. If several answers are possible, rounding up is produced. For example, 7.3 is rounded to 7, but 7.5 and 7.8784 — to 8. For instance, if Noora has marks [8,<=9], then the mark to the certificate is 9, because the average is equal to 8.5 and rounded to 9, but if the marks are [8,<=8,<=9], Noora will have graduation certificate with 8. To graduate with «A» certificate, Noora has to have mark *k*. Noora got *n* marks in register this year. However, she is afraid that her marks are not enough to get final mark *k*. Noora decided to ask for help in the internet, where hacker Leha immediately responded to her request. He is ready to hack class register for Noora and to add Noora any number of additional marks from 1 to *k*. At the same time, Leha want his hack be unseen to everyone, so he decided to add as less as possible additional marks. Please help Leha to calculate the minimal number of marks he has to add, so that final Noora's mark will become equal to *k*. Input Specification: The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*k*<=≤<=100) denoting the number of marks, received by Noora and the value of highest possible mark. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*k*) denoting marks received by Noora before Leha's hack. Output Specification: Print a single integer — minimal number of additional marks, that Leha has to add in order to change Noora's final mark to *k*. Demo Input: ['2 10\n8 9\n', '3 5\n4 4 4\n'] Demo Output: ['4', '3'] Note: Consider the first example testcase. Maximal mark is 10, Noora received two marks — 8 and 9, so current final mark is 9. To fix it, Leha can add marks [10, 10, 10, 10] (4 marks in total) to the registry, achieving Noora having average mark equal to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1b961585522f76271546da990a6228e7c666277f.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Consequently, new final mark is 10. Less number of marks won't fix the situation. In the second example Leha can add [5, 5, 5] to the registry, so that making average mark equal to 4.5, which is enough to have 5 in the certificate.
```python def func(x, y): if ( (x/y - x//y) >= 0.5 ): return x//y + 1 else: return x//y n, k = [int (i) for i in input().split()] s = sum([int(i) for i in input().split()]) sr = s/n; j = 0 sr=func(s,n) while (sr != k): s += k n += 1 j+=1 sr = func(s, n) print(j) ```
3
586
A
Alena's Schedule
PROGRAMMING
900
[ "implementation" ]
null
null
Alena has successfully passed the entrance exams to the university and is now looking forward to start studying. One two-hour lesson at the Russian university is traditionally called a pair, it lasts for two academic hours (an academic hour is equal to 45 minutes). The University works in such a way that every day it holds exactly *n* lessons. Depending on the schedule of a particular group of students, on a given day, some pairs may actually contain classes, but some may be empty (such pairs are called breaks). The official website of the university has already published the schedule for tomorrow for Alena's group. Thus, for each of the *n* pairs she knows if there will be a class at that time or not. Alena's House is far from the university, so if there are breaks, she doesn't always go home. Alena has time to go home only if the break consists of at least two free pairs in a row, otherwise she waits for the next pair at the university. Of course, Alena does not want to be sleepy during pairs, so she will sleep as long as possible, and will only come to the first pair that is presented in her schedule. Similarly, if there are no more pairs, then Alena immediately goes home. Alena appreciates the time spent at home, so she always goes home when it is possible, and returns to the university only at the beginning of the next pair. Help Alena determine for how many pairs she will stay at the university. Note that during some pairs Alena may be at the university waiting for the upcoming pair.
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of lessons at the university. The second line contains *n* numbers *a**i* (0<=≤<=*a**i*<=≤<=1). Number *a**i* equals 0, if Alena doesn't have the *i*-th pairs, otherwise it is equal to 1. Numbers *a*1,<=*a*2,<=...,<=*a**n* are separated by spaces.
Print a single number — the number of pairs during which Alena stays at the university.
[ "5\n0 1 0 1 1\n", "7\n1 0 1 0 0 1 0\n", "1\n0\n" ]
[ "4\n", "4\n", "0\n" ]
In the first sample Alena stays at the university from the second to the fifth pair, inclusive, during the third pair she will be it the university waiting for the next pair. In the last sample Alena doesn't have a single pair, so she spends all the time at home.
500
[ { "input": "5\n0 1 0 1 1", "output": "4" }, { "input": "7\n1 0 1 0 0 1 0", "output": "4" }, { "input": "1\n0", "output": "0" }, { "input": "1\n1", "output": "1" }, { "input": "2\n0 0", "output": "0" }, { "input": "2\n0 1", "output": "1" }, { "input": "2\n1 0", "output": "1" }, { "input": "2\n1 1", "output": "2" }, { "input": "10\n0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "9\n1 1 1 1 1 1 1 1 1", "output": "9" }, { "input": "11\n0 0 0 0 0 0 0 0 0 0 1", "output": "1" }, { "input": "12\n1 0 0 0 0 0 0 0 0 0 0 0", "output": "1" }, { "input": "20\n1 1 0 1 1 1 1 1 1 1 1 0 1 1 1 0 0 1 0 0", "output": "16" }, { "input": "41\n1 1 0 1 0 1 0 0 1 0 1 1 1 0 0 0 1 1 1 0 1 0 1 1 0 1 0 1 0 0 0 0 0 0 1 0 0 1 0 1 1", "output": "28" }, { "input": "63\n1 1 0 1 1 0 0 0 1 1 0 0 1 1 1 1 0 1 1 0 1 0 1 1 1 1 1 0 0 0 0 0 0 1 0 0 1 0 0 1 0 1 1 0 0 1 1 0 0 1 1 1 1 0 0 1 1 0 0 1 0 1 0", "output": "39" }, { "input": "80\n0 1 1 1 0 1 1 1 1 1 0 0 1 0 1 1 0 1 1 1 0 1 1 1 1 0 1 0 1 0 0 0 1 1 0 1 1 0 0 0 0 1 1 1 0 0 0 1 0 0 1 1 1 0 0 0 0 0 0 1 0 1 0 0 1 0 1 1 1 1 1 0 0 0 1 1 0 0 1 1", "output": "52" }, { "input": "99\n1 1 0 0 0 1 0 0 1 1 1 1 0 0 0 1 0 1 1 0 1 1 1 1 0 0 0 0 1 1 1 1 0 1 0 1 0 1 1 1 0 0 1 1 1 0 0 0 1 1 1 0 1 1 1 0 1 0 0 1 1 0 1 0 0 1 1 1 1 0 0 1 1 0 0 1 0 1 1 1 0 1 1 0 1 0 0 1 0 1 0 1 0 1 1 0 1 0 1", "output": "72" }, { "input": "100\n0 1 1 0 1 1 0 0 1 1 0 1 1 1 1 1 0 0 1 1 1 0 0 0 0 1 1 0 0 1 0 0 1 0 0 0 0 1 1 1 1 1 1 0 0 1 1 0 0 0 0 1 0 1 1 1 0 1 1 0 1 0 0 0 0 0 1 0 1 1 0 0 1 1 0 1 1 0 0 1 1 1 0 1 1 1 1 1 1 0 0 1 1 1 1 0 1 1 1 0", "output": "65" }, { "input": "11\n0 1 1 0 0 0 0 0 0 0 0", "output": "2" }, { "input": "11\n0 1 0 1 0 0 1 1 0 1 1", "output": "8" }, { "input": "11\n1 0 1 0 1 1 0 1 1 1 0", "output": "10" }, { "input": "11\n1 0 0 0 0 0 1 0 1 1 1", "output": "6" }, { "input": "22\n0 1 1 0 0 0 0 0 1 0 0 0 0 1 1 0 0 1 0 0 1 0", "output": "7" }, { "input": "22\n0 1 0 1 0 1 1 1 1 0 0 1 1 1 0 1 1 1 0 0 0 1", "output": "16" }, { "input": "22\n1 0 1 0 1 0 0 0 0 0 0 1 0 0 0 0 1 1 0 1 1 0", "output": "11" }, { "input": "22\n1 0 1 0 0 0 1 0 0 1 1 0 1 0 1 1 0 0 0 1 0 1", "output": "14" }, { "input": "33\n0 1 1 0 1 1 0 1 0 1 1 0 1 1 1 1 0 1 1 1 0 0 1 1 0 0 1 1 0 1 1 0 0", "output": "26" }, { "input": "33\n0 1 0 1 0 1 1 0 0 0 1 1 1 0 1 0 1 1 0 1 0 1 0 0 1 1 1 0 1 1 1 0 1", "output": "27" }, { "input": "33\n1 0 1 0 1 0 0 0 1 0 1 1 1 0 0 0 0 1 1 0 1 0 1 1 0 1 0 1 1 1 1 1 0", "output": "25" }, { "input": "33\n1 0 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 0 1 0 0 0 1 0 1 0 1 0 0 0 0 1 1", "output": "24" }, { "input": "44\n0 1 1 0 1 0 0 0 0 1 1 0 0 0 0 0 1 1 1 0 0 0 0 0 1 0 0 1 1 0 0 0 0 1 1 1 0 0 1 0 1 1 0 0", "output": "19" }, { "input": "44\n0 1 1 1 1 0 1 0 0 1 0 1 0 0 1 1 0 1 1 0 0 1 0 1 0 1 1 0 1 0 1 0 1 0 1 0 0 0 0 0 1 0 1 1", "output": "32" }, { "input": "44\n1 0 1 0 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 1 0 0 1 0 0 1 0", "output": "23" }, { "input": "44\n1 0 1 0 1 1 1 0 0 0 0 0 0 1 0 0 0 1 1 1 0 0 0 1 0 1 0 1 1 0 1 1 0 1 0 1 1 0 1 0 1 1 1 1", "output": "32" }, { "input": "55\n0 1 1 0 1 0 0 0 1 0 0 0 1 0 1 0 0 1 0 0 0 0 1 1 1 0 0 1 1 0 0 0 0 0 1 0 1 1 1 0 0 0 0 0 1 0 0 0 0 1 1 0 0 1 0", "output": "23" }, { "input": "55\n0 1 1 0 1 0 1 1 1 1 0 1 1 0 0 1 1 1 0 0 0 1 1 0 0 1 0 1 0 1 0 0 1 1 1 1 1 0 0 0 1 1 1 1 1 1 1 1 0 1 1 0 0 0 1", "output": "39" }, { "input": "55\n1 0 1 0 0 1 0 0 1 1 0 1 0 1 0 0 1 1 0 0 0 0 1 1 1 0 0 0 1 1 1 1 0 1 0 1 0 0 0 1 0 1 1 0 0 0 1 0 1 0 0 1 1 0 0", "output": "32" }, { "input": "55\n1 0 1 0 1 0 1 0 1 1 0 0 1 1 1 1 0 1 0 0 0 1 1 0 0 1 0 1 0 1 1 1 0 0 0 0 0 0 1 0 0 0 1 1 1 0 0 0 1 0 1 0 1 1 1", "output": "36" }, { "input": "66\n0 1 1 0 0 1 0 1 0 1 0 1 1 0 1 1 0 0 1 1 0 1 0 0 0 0 0 0 0 1 0 0 0 1 1 1 1 1 1 0 0 1 1 1 0 1 0 1 1 0 1 0 0 1 1 0 1 1 1 0 0 0 0 0 1 0", "output": "41" }, { "input": "66\n0 1 1 0 1 1 1 0 0 0 1 1 0 1 1 0 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 0 1 0 0 1 1 1 0 0 1 0 1 1 1 0 0 0 1 0 0 0 0 0 1 0 1 0 0 1 0 0 1 1 0 1", "output": "42" }, { "input": "66\n1 0 1 0 0 0 1 0 1 0 1 0 1 1 0 1 0 1 1 0 0 0 1 1 1 0 1 0 0 1 0 1 0 0 0 0 1 1 0 1 1 0 1 0 0 0 1 1 0 1 0 1 1 0 0 0 1 1 0 1 1 0 1 1 0 0", "output": "46" }, { "input": "66\n1 0 1 0 0 0 1 1 1 1 1 0 1 0 0 0 1 1 1 0 1 1 0 1 0 1 0 0 1 0 0 1 0 1 0 1 0 0 1 0 0 1 0 1 1 1 1 1 0 1 1 1 1 1 1 0 0 0 1 0 1 1 0 0 0 1", "output": "46" }, { "input": "77\n0 0 1 0 0 1 0 0 1 1 1 1 0 1 0 0 1 0 0 0 0 1 0 0 0 0 1 0 1 0 1 0 0 0 1 0 0 1 1 0 1 0 1 1 0 0 0 1 0 0 1 1 1 0 1 0 1 1 0 1 0 0 0 1 0 1 1 0 1 1 1 0 1 1 0 1 0", "output": "47" }, { "input": "77\n0 0 1 0 0 0 1 0 1 1 1 1 0 1 1 1 0 1 1 0 1 1 1 0 1 1 0 1 0 0 0 0 1 1 0 0 0 1 1 0 0 1 1 0 1 0 0 1 0 0 0 1 0 0 1 0 0 0 1 0 0 0 1 0 0 1 0 1 1 0 1 0 0 0 0 1 1", "output": "44" }, { "input": "77\n1 0 0 0 1 0 1 1 0 0 1 0 0 0 1 1 1 1 0 1 0 0 0 0 0 0 1 1 0 0 0 1 0 1 0 1 1 1 0 1 1 1 0 0 0 1 1 0 1 1 1 0 1 1 0 0 1 0 0 1 1 1 1 0 1 0 0 0 1 0 1 1 0 0 0 0 0", "output": "45" }, { "input": "77\n1 0 1 0 0 1 1 0 0 0 0 0 0 0 0 0 0 1 0 1 1 1 0 0 1 1 1 0 1 1 0 1 0 0 0 0 1 1 1 0 1 0 0 1 1 0 1 0 1 1 1 1 1 1 1 0 0 1 1 0 0 1 0 1 1 1 1 1 1 1 1 0 0 1 0 1 1", "output": "51" }, { "input": "88\n0 0 1 0 0 0 0 0 0 0 0 1 1 1 1 0 0 0 0 1 0 1 1 1 0 0 1 1 0 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 0 0 0 0 1 0 0 0 1 0 1 1 0 1 0 1 0 0 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 1 0 0 1 1 1 0", "output": "44" }, { "input": "88\n0 0 1 0 0 0 1 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 1 0 1 1 0 1 1 1 0 1 0 0 1 0 1 1 0 0 0 0 0 1 1 0 0 1 0 1 1 1 0 1 1 0 1 1 0 0 0 1 1 1 1 1 1 1 0 0 1 0 1 0 0 0 1 0 1 0 0 0 0 0 0 0 1", "output": "59" }, { "input": "88\n1 0 0 0 1 1 1 0 1 1 0 0 0 0 0 0 1 0 1 0 0 0 1 1 0 0 1 1 1 1 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 1 1 1 0 1 1 0 0 1 1 1 0 0 1 0 0 1 1 1 1 0 0 1 0 1 1 1 0 1 0 1 1 1 1 0 1 0 1 1 1 0 0 0", "output": "53" }, { "input": "88\n1 1 1 0 0 1 1 0 1 0 0 0 1 0 1 1 1 1 1 0 1 1 1 1 1 1 1 0 0 1 0 1 1 1 0 0 0 1 1 0 1 1 0 1 0 0 1 0 0 1 0 0 1 0 1 1 0 1 0 1 0 1 0 0 1 1 1 0 0 0 1 0 0 1 0 0 1 1 0 1 1 1 1 0 1 1 0 1", "output": "63" }, { "input": "99\n0 0 0 0 1 0 0 1 0 0 0 1 1 1 1 1 1 0 1 1 0 1 0 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 0 0 1 0 0 1 0 1 0 1 0 0 0 0 1 0 1 1 0 0 1 1 1 0 0 1 1 0 0 0 0 0 0 1 0 0 0 1 1 0 0 0 1 1 1 0 1 1 0 1 0 1 0 0 0 1 1 0 0 0 0", "output": "56" }, { "input": "99\n0 0 1 0 0 1 1 0 0 0 1 1 0 0 1 0 0 0 1 1 1 1 0 0 0 1 1 0 0 0 1 0 1 1 0 0 1 1 1 0 1 1 0 0 0 0 0 1 0 0 1 0 1 1 0 1 0 1 0 0 1 0 1 1 1 1 1 1 0 1 0 0 1 1 0 0 1 0 1 0 1 0 1 1 1 0 0 1 1 1 0 0 0 0 0 0 1 1 1", "output": "58" }, { "input": "99\n1 1 0 0 1 1 1 0 0 0 1 0 1 0 1 1 0 0 0 0 0 0 0 0 1 0 1 1 0 0 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 0 1 0 1 1 1 1 0 1 1 1 0 0 1 0 0 1 1 0 0 0 0 1 0 0 1 0 1 1 0 1 1 0 0 1 0 0 1 0 1 0 1 1 0 1 0 1 1 1 1 0 0 1 0", "output": "65" }, { "input": "99\n1 1 1 0 1 0 1 1 0 1 1 0 0 1 0 0 1 1 1 0 1 1 0 0 0 1 1 1 1 0 1 1 1 0 1 1 0 1 1 0 1 0 1 0 0 1 1 1 1 1 0 1 1 0 1 1 0 0 0 1 0 1 0 1 0 1 0 0 0 1 1 1 1 0 0 1 1 0 1 0 0 0 1 0 1 1 1 0 0 1 1 1 1 1 0 1 1 1 1", "output": "77" }, { "input": "90\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "90\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "90" }, { "input": "95\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "95\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "95" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "100" } ]
1,444,662,073
2,147,483,647
Python 3
OK
TESTS
60
62
0
__author__ = 'yarsanich' n = int(input('')) a = list(map(int, input('').split())) ans = 0 for i in range(n): if (a[i] == 1): ans+=1 a.append(1) start = a.index(1) if (start!=n): for i in range(start,n-1): if (a[i] == 0) and (a[i+1] != 0) and (a[i-1]!=0): ans+=1 print(ans) else: print(0)
Title: Alena's Schedule Time Limit: None seconds Memory Limit: None megabytes Problem Description: Alena has successfully passed the entrance exams to the university and is now looking forward to start studying. One two-hour lesson at the Russian university is traditionally called a pair, it lasts for two academic hours (an academic hour is equal to 45 minutes). The University works in such a way that every day it holds exactly *n* lessons. Depending on the schedule of a particular group of students, on a given day, some pairs may actually contain classes, but some may be empty (such pairs are called breaks). The official website of the university has already published the schedule for tomorrow for Alena's group. Thus, for each of the *n* pairs she knows if there will be a class at that time or not. Alena's House is far from the university, so if there are breaks, she doesn't always go home. Alena has time to go home only if the break consists of at least two free pairs in a row, otherwise she waits for the next pair at the university. Of course, Alena does not want to be sleepy during pairs, so she will sleep as long as possible, and will only come to the first pair that is presented in her schedule. Similarly, if there are no more pairs, then Alena immediately goes home. Alena appreciates the time spent at home, so she always goes home when it is possible, and returns to the university only at the beginning of the next pair. Help Alena determine for how many pairs she will stay at the university. Note that during some pairs Alena may be at the university waiting for the upcoming pair. Input Specification: The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of lessons at the university. The second line contains *n* numbers *a**i* (0<=≤<=*a**i*<=≤<=1). Number *a**i* equals 0, if Alena doesn't have the *i*-th pairs, otherwise it is equal to 1. Numbers *a*1,<=*a*2,<=...,<=*a**n* are separated by spaces. Output Specification: Print a single number — the number of pairs during which Alena stays at the university. Demo Input: ['5\n0 1 0 1 1\n', '7\n1 0 1 0 0 1 0\n', '1\n0\n'] Demo Output: ['4\n', '4\n', '0\n'] Note: In the first sample Alena stays at the university from the second to the fifth pair, inclusive, during the third pair she will be it the university waiting for the next pair. In the last sample Alena doesn't have a single pair, so she spends all the time at home.
```python __author__ = 'yarsanich' n = int(input('')) a = list(map(int, input('').split())) ans = 0 for i in range(n): if (a[i] == 1): ans+=1 a.append(1) start = a.index(1) if (start!=n): for i in range(start,n-1): if (a[i] == 0) and (a[i+1] != 0) and (a[i-1]!=0): ans+=1 print(ans) else: print(0) ```
3
899
A
Splitting in Teams
PROGRAMMING
800
[ "constructive algorithms", "greedy", "math" ]
null
null
There were *n* groups of students which came to write a training contest. A group is either one person who can write the contest with anyone else, or two people who want to write the contest in the same team. The coach decided to form teams of exactly three people for this training. Determine the maximum number of teams of three people he can form. It is possible that he can't use all groups to form teams. For groups of two, either both students should write the contest, or both should not. If two students from a group of two will write the contest, they should be in the same team.
The first line contains single integer *n* (2<=≤<=*n*<=≤<=2·105) — the number of groups. The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2), where *a**i* is the number of people in group *i*.
Print the maximum number of teams of three people the coach can form.
[ "4\n1 1 2 1\n", "2\n2 2\n", "7\n2 2 2 1 1 1 1\n", "3\n1 1 1\n" ]
[ "1\n", "0\n", "3\n", "1\n" ]
In the first example the coach can form one team. For example, he can take students from the first, second and fourth groups. In the second example he can't make a single team. In the third example the coach can form three teams. For example, he can do this in the following way: - The first group (of two people) and the seventh group (of one person), - The second group (of two people) and the sixth group (of one person), - The third group (of two people) and the fourth group (of one person).
500
[ { "input": "4\n1 1 2 1", "output": "1" }, { "input": "2\n2 2", "output": "0" }, { "input": "7\n2 2 2 1 1 1 1", "output": "3" }, { "input": "3\n1 1 1", "output": "1" }, { "input": "3\n2 2 2", "output": "0" }, { "input": "3\n1 2 1", "output": "1" }, { "input": "5\n2 2 1 1 1", "output": "2" }, { "input": "7\n1 1 2 2 1 2 1", "output": "3" }, { "input": "10\n1 2 2 1 2 2 1 2 1 1", "output": "5" }, { "input": "5\n2 2 2 1 2", "output": "1" }, { "input": "43\n1 2 2 2 1 1 2 2 1 1 2 2 2 2 1 2 2 2 2 2 1 2 1 2 1 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2", "output": "10" }, { "input": "72\n1 2 1 2 2 1 2 1 1 1 1 2 2 1 2 1 2 1 2 2 2 2 1 2 2 2 2 1 2 1 1 2 2 1 1 2 2 2 2 2 1 1 1 1 2 2 1 1 2 1 1 1 1 2 2 1 2 2 1 2 1 1 2 1 2 2 1 1 1 2 2 2", "output": "34" }, { "input": "64\n2 2 1 1 1 2 1 1 1 2 2 1 2 2 2 1 2 2 2 1 1 1 1 2 1 2 1 2 1 1 2 2 1 1 2 2 1 1 1 1 2 2 1 1 1 2 1 2 2 2 2 2 2 2 1 1 2 1 1 1 2 2 1 2", "output": "32" }, { "input": "20\n1 1 1 1 2 1 2 2 2 1 2 1 2 1 2 1 1 2 1 2", "output": "9" }, { "input": "23\n1 1 1 1 2 1 2 1 1 1 2 2 2 2 2 2 1 2 1 2 2 1 1", "output": "11" }, { "input": "201\n1 1 2 2 2 2 1 1 1 2 2 1 2 1 2 1 2 2 2 1 1 2 1 1 1 2 1 2 1 1 1 2 1 1 2 1 2 2 1 1 1 1 2 1 1 2 1 1 1 2 2 2 2 1 2 1 2 2 2 2 2 2 1 1 1 2 2 1 1 1 1 2 2 1 2 1 1 2 2 1 1 2 2 2 1 1 1 2 1 1 2 1 2 2 1 2 2 2 2 1 1 1 2 1 2 2 2 2 2 1 2 1 1 1 2 2 2 2 2 1 2 1 1 2 2 2 1 1 2 2 1 2 2 2 1 1 1 2 1 1 1 2 1 1 2 2 2 1 2 1 1 1 2 2 1 1 2 2 2 2 2 2 1 2 2 1 2 2 2 1 1 2 2 1 1 2 1 1 1 1 2 1 1 1 2 2 1 2 1 1 2 2 1 1 2 1 2 1 1 1 2", "output": "100" }, { "input": "247\n2 2 1 2 1 2 2 2 2 2 2 1 1 2 2 1 2 1 1 1 2 1 1 1 1 2 1 1 2 2 1 2 1 1 1 2 2 2 1 1 2 1 1 2 1 1 1 2 1 2 1 2 2 1 1 2 1 2 2 1 2 1 2 1 1 2 1 1 1 2 2 1 1 2 2 1 1 2 1 1 1 2 2 2 2 1 2 2 2 2 2 2 1 2 2 2 2 1 1 1 1 1 1 1 1 1 2 1 2 2 1 2 1 2 2 2 1 2 2 2 1 1 2 2 1 1 1 2 1 1 1 1 2 2 1 2 2 1 1 1 2 1 2 2 1 2 1 1 1 2 2 2 2 2 1 2 2 2 1 1 1 2 1 2 1 1 2 2 2 2 1 1 2 2 2 1 2 2 2 1 2 1 1 2 2 2 2 1 2 2 1 1 1 2 1 2 1 1 1 2 2 1 1 2 1 1 2 1 2 1 1 2 1 1 1 1 2 1 1 1 1 2 2 1 2 1 1 2 1 2 2 1 2 2 2 1 2 2 1 2 2 1 1 1 2 2 2", "output": "123" }, { "input": "4\n2 2 2 2", "output": "0" }, { "input": "4\n1 1 1 1", "output": "1" }, { "input": "2\n1 1", "output": "0" }, { "input": "2\n2 1", "output": "1" }, { "input": "2\n1 2", "output": "1" }, { "input": "3\n1 1 2", "output": "1" }, { "input": "3\n1 2 2", "output": "1" }, { "input": "3\n2 1 1", "output": "1" }, { "input": "3\n2 1 2", "output": "1" }, { "input": "3\n2 2 1", "output": "1" }, { "input": "4\n1 1 1 2", "output": "1" }, { "input": "4\n1 1 2 2", "output": "2" }, { "input": "4\n1 2 2 2", "output": "1" }, { "input": "4\n2 1 1 1", "output": "1" }, { "input": "5\n1 1 1 1 2", "output": "2" }, { "input": "14\n1 2 2 2 2 2 2 2 2 2 2 2 2 2", "output": "1" }, { "input": "38\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1", "output": "1" }, { "input": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1", "output": "1" }, { "input": "20\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1", "output": "1" }, { "input": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2", "output": "1" }, { "input": "6\n1 1 1 2 2 2", "output": "3" }, { "input": "5\n2 1 1 1 1", "output": "2" }, { "input": "9\n1 1 1 1 1 1 2 2 2", "output": "4" }, { "input": "10\n2 2 1 1 1 1 1 1 1 1", "output": "4" }, { "input": "6\n1 1 1 1 1 1", "output": "2" } ]
1,545,230,325
2,147,483,647
Python 3
OK
TESTS
67
155
3,993,600
n = int(input()) pupils = list(map(int, input().split())) twos = pupils.count(2) ones = pupils.count(1) if twos > ones: print(ones) exit() print(twos + (ones - twos)//3)
Title: Splitting in Teams Time Limit: None seconds Memory Limit: None megabytes Problem Description: There were *n* groups of students which came to write a training contest. A group is either one person who can write the contest with anyone else, or two people who want to write the contest in the same team. The coach decided to form teams of exactly three people for this training. Determine the maximum number of teams of three people he can form. It is possible that he can't use all groups to form teams. For groups of two, either both students should write the contest, or both should not. If two students from a group of two will write the contest, they should be in the same team. Input Specification: The first line contains single integer *n* (2<=≤<=*n*<=≤<=2·105) — the number of groups. The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2), where *a**i* is the number of people in group *i*. Output Specification: Print the maximum number of teams of three people the coach can form. Demo Input: ['4\n1 1 2 1\n', '2\n2 2\n', '7\n2 2 2 1 1 1 1\n', '3\n1 1 1\n'] Demo Output: ['1\n', '0\n', '3\n', '1\n'] Note: In the first example the coach can form one team. For example, he can take students from the first, second and fourth groups. In the second example he can't make a single team. In the third example the coach can form three teams. For example, he can do this in the following way: - The first group (of two people) and the seventh group (of one person), - The second group (of two people) and the sixth group (of one person), - The third group (of two people) and the fourth group (of one person).
```python n = int(input()) pupils = list(map(int, input().split())) twos = pupils.count(2) ones = pupils.count(1) if twos > ones: print(ones) exit() print(twos + (ones - twos)//3) ```
3
608
A
Saitama Destroys Hotel
PROGRAMMING
1,000
[ "implementation", "math" ]
null
null
Saitama accidentally destroyed a hotel again. To repay the hotel company, Genos has volunteered to operate an elevator in one of its other hotels. The elevator is special — it starts on the top floor, can only move down, and has infinite capacity. Floors are numbered from 0 to *s* and elevator initially starts on floor *s* at time 0. The elevator takes exactly 1 second to move down exactly 1 floor and negligible time to pick up passengers. Genos is given a list detailing when and on which floor passengers arrive. Please determine how long in seconds it will take Genos to bring all passengers to floor 0.
The first line of input contains two integers *n* and *s* (1<=≤<=*n*<=≤<=100, 1<=≤<=*s*<=≤<=1000) — the number of passengers and the number of the top floor respectively. The next *n* lines each contain two space-separated integers *f**i* and *t**i* (1<=≤<=*f**i*<=≤<=*s*, 1<=≤<=*t**i*<=≤<=1000) — the floor and the time of arrival in seconds for the passenger number *i*.
Print a single integer — the minimum amount of time in seconds needed to bring all the passengers to floor 0.
[ "3 7\n2 1\n3 8\n5 2\n", "5 10\n2 77\n3 33\n8 21\n9 12\n10 64\n" ]
[ "11\n", "79\n" ]
In the first sample, it takes at least 11 seconds to bring all passengers to floor 0. Here is how this could be done: 1. Move to floor 5: takes 2 seconds. 2. Pick up passenger 3. 3. Move to floor 3: takes 2 seconds. 4. Wait for passenger 2 to arrive: takes 4 seconds. 5. Pick up passenger 2. 6. Go to floor 2: takes 1 second. 7. Pick up passenger 1. 8. Go to floor 0: takes 2 seconds. This gives a total of 2 + 2 + 4 + 1 + 2 = 11 seconds.
500
[ { "input": "3 7\n2 1\n3 8\n5 2", "output": "11" }, { "input": "5 10\n2 77\n3 33\n8 21\n9 12\n10 64", "output": "79" }, { "input": "1 1000\n1000 1000", "output": "2000" }, { "input": "1 1\n1 1", "output": "2" }, { "input": "1 1000\n1 1", "output": "1000" }, { "input": "1 1000\n1 1000", "output": "1001" }, { "input": "100 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "2" }, { "input": "2 7\n6 3\n1 5", "output": "9" }, { "input": "2 100\n99 2\n1 10", "output": "101" }, { "input": "5 5\n1 1\n2 1\n3 1\n4 1\n5 1", "output": "6" }, { "input": "3 7\n1 6\n5 5\n6 1", "output": "10" }, { "input": "2 100\n4 100\n7 99", "output": "106" }, { "input": "2 10\n9 3\n1 4", "output": "12" }, { "input": "2 5\n4 4\n5 4", "output": "9" }, { "input": "2 10\n9 10\n6 11", "output": "19" }, { "input": "2 100\n99 9\n1 10", "output": "108" }, { "input": "2 7\n3 5\n7 4", "output": "11" }, { "input": "4 4\n4 6\n4 8\n1 7\n2 9", "output": "12" }, { "input": "2 1000\n1 2\n1000 1", "output": "1001" }, { "input": "2 20\n1 1\n2 2", "output": "20" }, { "input": "2 20\n10 10\n19 9", "output": "28" } ]
1,450,888,843
343
Python 3
OK
TESTS
39
62
0
n, s = map(int, input().split()) maxi = 0 for i in range(n): a, b = map(int, input().split()) maxi = max(maxi, max(b - (s - a), 0)) print(maxi + s)
Title: Saitama Destroys Hotel Time Limit: None seconds Memory Limit: None megabytes Problem Description: Saitama accidentally destroyed a hotel again. To repay the hotel company, Genos has volunteered to operate an elevator in one of its other hotels. The elevator is special — it starts on the top floor, can only move down, and has infinite capacity. Floors are numbered from 0 to *s* and elevator initially starts on floor *s* at time 0. The elevator takes exactly 1 second to move down exactly 1 floor and negligible time to pick up passengers. Genos is given a list detailing when and on which floor passengers arrive. Please determine how long in seconds it will take Genos to bring all passengers to floor 0. Input Specification: The first line of input contains two integers *n* and *s* (1<=≤<=*n*<=≤<=100, 1<=≤<=*s*<=≤<=1000) — the number of passengers and the number of the top floor respectively. The next *n* lines each contain two space-separated integers *f**i* and *t**i* (1<=≤<=*f**i*<=≤<=*s*, 1<=≤<=*t**i*<=≤<=1000) — the floor and the time of arrival in seconds for the passenger number *i*. Output Specification: Print a single integer — the minimum amount of time in seconds needed to bring all the passengers to floor 0. Demo Input: ['3 7\n2 1\n3 8\n5 2\n', '5 10\n2 77\n3 33\n8 21\n9 12\n10 64\n'] Demo Output: ['11\n', '79\n'] Note: In the first sample, it takes at least 11 seconds to bring all passengers to floor 0. Here is how this could be done: 1. Move to floor 5: takes 2 seconds. 2. Pick up passenger 3. 3. Move to floor 3: takes 2 seconds. 4. Wait for passenger 2 to arrive: takes 4 seconds. 5. Pick up passenger 2. 6. Go to floor 2: takes 1 second. 7. Pick up passenger 1. 8. Go to floor 0: takes 2 seconds. This gives a total of 2 + 2 + 4 + 1 + 2 = 11 seconds.
```python n, s = map(int, input().split()) maxi = 0 for i in range(n): a, b = map(int, input().split()) maxi = max(maxi, max(b - (s - a), 0)) print(maxi + s) ```
3
472
A
Design Tutorial: Learn from Math
PROGRAMMING
800
[ "math", "number theory" ]
null
null
One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that. For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem. You are given an integer *n* no less than 12, express it as a sum of two composite numbers.
The only line contains an integer *n* (12<=≤<=*n*<=≤<=106).
Output two composite integers *x* and *y* (1<=&lt;<=*x*,<=*y*<=&lt;<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them.
[ "12\n", "15\n", "23\n", "1000000\n" ]
[ "4 8\n", "6 9\n", "8 15\n", "500000 500000\n" ]
In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well. In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number.
500
[ { "input": "12", "output": "4 8" }, { "input": "15", "output": "6 9" }, { "input": "23", "output": "8 15" }, { "input": "1000000", "output": "500000 500000" }, { "input": "63874", "output": "4 63870" }, { "input": "14568", "output": "4 14564" }, { "input": "192", "output": "4 188" }, { "input": "86", "output": "4 82" }, { "input": "46220", "output": "4 46216" }, { "input": "57114", "output": "4 57110" }, { "input": "869", "output": "4 865" }, { "input": "738457", "output": "4 738453" }, { "input": "58113", "output": "6 58107" }, { "input": "4864", "output": "4 4860" }, { "input": "15", "output": "6 9" }, { "input": "74752", "output": "4 74748" }, { "input": "6073", "output": "4 6069" }, { "input": "1289", "output": "4 1285" }, { "input": "20", "output": "4 16" }, { "input": "58134", "output": "4 58130" }, { "input": "57756", "output": "4 57752" }, { "input": "765", "output": "6 759" }, { "input": "59", "output": "4 55" }, { "input": "991666", "output": "4 991662" }, { "input": "70761", "output": "4 70757" }, { "input": "13", "output": "4 9" }, { "input": "999999", "output": "4 999995" }, { "input": "17", "output": "8 9" }, { "input": "21", "output": "6 15" }, { "input": "19", "output": "4 15" }, { "input": "100007", "output": "6 100001" }, { "input": "999987", "output": "6 999981" }, { "input": "22", "output": "4 18" } ]
1,665,282,912
2,147,483,647
PyPy 3
OK
TESTS
33
186
20,684,800
def find_composite_sum(n): composite = [False] * (n + 1) composites = [] for i in range(2, n + 1): if composite[i]: composites.append(i) else: for j in range(2 * i, n + 1, i): composite[j] = True first_index = 0 last_index = len(composites) - 1 first = composites[first_index] last = composites[last_index] while first < last: if n - last == first: print("{} {}".format(first, last)) return elif n - last < first: last_index -= 1 else: first_index += 1 first = composites[first_index] last = composites[last_index] print("ERROR") if __name__ == '__main__': n = int(input()) find_composite_sum(n)
Title: Design Tutorial: Learn from Math Time Limit: None seconds Memory Limit: None megabytes Problem Description: One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that. For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem. You are given an integer *n* no less than 12, express it as a sum of two composite numbers. Input Specification: The only line contains an integer *n* (12<=≤<=*n*<=≤<=106). Output Specification: Output two composite integers *x* and *y* (1<=&lt;<=*x*,<=*y*<=&lt;<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them. Demo Input: ['12\n', '15\n', '23\n', '1000000\n'] Demo Output: ['4 8\n', '6 9\n', '8 15\n', '500000 500000\n'] Note: In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well. In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number.
```python def find_composite_sum(n): composite = [False] * (n + 1) composites = [] for i in range(2, n + 1): if composite[i]: composites.append(i) else: for j in range(2 * i, n + 1, i): composite[j] = True first_index = 0 last_index = len(composites) - 1 first = composites[first_index] last = composites[last_index] while first < last: if n - last == first: print("{} {}".format(first, last)) return elif n - last < first: last_index -= 1 else: first_index += 1 first = composites[first_index] last = composites[last_index] print("ERROR") if __name__ == '__main__': n = int(input()) find_composite_sum(n) ```
3
990
A
Commentary Boxes
PROGRAMMING
1,000
[ "implementation", "math" ]
null
null
Berland Football Cup starts really soon! Commentators from all over the world come to the event. Organizers have already built $n$ commentary boxes. $m$ regional delegations will come to the Cup. Every delegation should get the same number of the commentary boxes. If any box is left unoccupied then the delegations will be upset. So each box should be occupied by exactly one delegation. If $n$ is not divisible by $m$, it is impossible to distribute the boxes to the delegations at the moment. Organizers can build a new commentary box paying $a$ burles and demolish a commentary box paying $b$ burles. They can both build and demolish boxes arbitrary number of times (each time paying a corresponding fee). It is allowed to demolish all the existing boxes. What is the minimal amount of burles organizers should pay to satisfy all the delegations (i.e. to make the number of the boxes be divisible by $m$)?
The only line contains four integer numbers $n$, $m$, $a$ and $b$ ($1 \le n, m \le 10^{12}$, $1 \le a, b \le 100$), where $n$ is the initial number of the commentary boxes, $m$ is the number of delegations to come, $a$ is the fee to build a box and $b$ is the fee to demolish a box.
Output the minimal amount of burles organizers should pay to satisfy all the delegations (i.e. to make the number of the boxes be divisible by $m$). It is allowed that the final number of the boxes is equal to $0$.
[ "9 7 3 8\n", "2 7 3 7\n", "30 6 17 19\n" ]
[ "15\n", "14\n", "0\n" ]
In the first example organizers can build $5$ boxes to make the total of $14$ paying $3$ burles for the each of them. In the second example organizers can demolish $2$ boxes to make the total of $0$ paying $7$ burles for the each of them. In the third example organizers are already able to distribute all the boxes equally among the delegations, each one get $5$ boxes.
0
[ { "input": "9 7 3 8", "output": "15" }, { "input": "2 7 3 7", "output": "14" }, { "input": "30 6 17 19", "output": "0" }, { "input": "500000000001 1000000000000 100 100", "output": "49999999999900" }, { "input": "1000000000000 750000000001 10 100", "output": "5000000000020" }, { "input": "1000000000000 750000000001 100 10", "output": "2499999999990" }, { "input": "42 1 1 1", "output": "0" }, { "input": "1 1000000000000 1 100", "output": "100" }, { "input": "7 2 3 7", "output": "3" }, { "input": "999999999 2 1 1", "output": "1" }, { "input": "999999999999 10000000007 100 100", "output": "70100" }, { "input": "10000000001 2 1 1", "output": "1" }, { "input": "29 6 1 2", "output": "1" }, { "input": "99999999999 6 100 100", "output": "300" }, { "input": "1000000000000 7 3 8", "output": "8" }, { "input": "99999999999 2 1 1", "output": "1" }, { "input": "1 2 1 1", "output": "1" }, { "input": "999999999999 2 1 1", "output": "1" }, { "input": "9 2 1 1", "output": "1" }, { "input": "17 4 5 5", "output": "5" }, { "input": "100000000000 3 1 1", "output": "1" }, { "input": "100 7 1 1", "output": "2" }, { "input": "1000000000000 3 100 100", "output": "100" }, { "input": "70 3 10 10", "output": "10" }, { "input": "1 2 5 1", "output": "1" }, { "input": "1000000000000 3 1 1", "output": "1" }, { "input": "804289377 846930887 78 16", "output": "3326037780" }, { "input": "1000000000000 9 55 55", "output": "55" }, { "input": "957747787 424238336 87 93", "output": "10162213695" }, { "input": "25 6 1 2", "output": "2" }, { "input": "22 7 3 8", "output": "8" }, { "input": "10000000000 1 1 1", "output": "0" }, { "input": "999999999999 2 10 10", "output": "10" }, { "input": "999999999999 2 100 100", "output": "100" }, { "input": "100 3 3 8", "output": "6" }, { "input": "99999 2 1 1", "output": "1" }, { "input": "100 3 2 5", "output": "4" }, { "input": "1000000000000 13 10 17", "output": "17" }, { "input": "7 2 1 2", "output": "1" }, { "input": "10 3 1 2", "output": "2" }, { "input": "5 2 2 2", "output": "2" }, { "input": "100 3 5 2", "output": "2" }, { "input": "7 2 1 1", "output": "1" }, { "input": "70 4 1 1", "output": "2" }, { "input": "10 4 1 1", "output": "2" }, { "input": "6 7 41 42", "output": "41" }, { "input": "10 3 10 1", "output": "1" }, { "input": "5 5 2 3", "output": "0" }, { "input": "1000000000000 3 99 99", "output": "99" }, { "input": "7 3 100 1", "output": "1" }, { "input": "7 2 100 5", "output": "5" }, { "input": "1000000000000 1 23 33", "output": "0" }, { "input": "30 7 1 1", "output": "2" }, { "input": "100 3 1 1", "output": "1" }, { "input": "90001 300 100 1", "output": "1" }, { "input": "13 4 1 2", "output": "2" }, { "input": "1000000000000 6 1 3", "output": "2" }, { "input": "50 4 5 100", "output": "10" }, { "input": "999 2 1 1", "output": "1" }, { "input": "5 2 5 5", "output": "5" }, { "input": "20 3 3 3", "output": "3" }, { "input": "3982258181 1589052704 87 20", "output": "16083055460" }, { "input": "100 3 1 3", "output": "2" }, { "input": "7 3 1 1", "output": "1" }, { "input": "19 10 100 100", "output": "100" }, { "input": "23 3 100 1", "output": "2" }, { "input": "25 7 100 1", "output": "4" }, { "input": "100 9 1 2", "output": "2" }, { "input": "9999999999 2 1 100", "output": "1" }, { "input": "1000000000000 2 1 1", "output": "0" }, { "input": "10000 3 1 1", "output": "1" }, { "input": "22 7 1 6", "output": "6" }, { "input": "100000000000 1 1 1", "output": "0" }, { "input": "18 7 100 1", "output": "4" }, { "input": "10003 4 1 100", "output": "1" }, { "input": "3205261341 718648876 58 11", "output": "3637324207" }, { "input": "8 3 100 1", "output": "2" }, { "input": "15 7 1 1", "output": "1" }, { "input": "1000000000000 1 20 20", "output": "0" }, { "input": "16 7 3 2", "output": "4" }, { "input": "1000000000000 1 1 1", "output": "0" }, { "input": "7 3 1 100", "output": "2" }, { "input": "16 3 1 100", "output": "2" }, { "input": "13 4 1 10", "output": "3" }, { "input": "10 4 5 5", "output": "10" }, { "input": "14 3 1 100", "output": "1" }, { "input": "100 33 100 1", "output": "1" }, { "input": "22 7 1 8", "output": "6" }, { "input": "10 4 2 1", "output": "2" }, { "input": "6 4 2 2", "output": "4" }, { "input": "17 4 2 1", "output": "1" }, { "input": "7 3 100 10", "output": "10" }, { "input": "702 7 3 2", "output": "4" }, { "input": "8 3 1 5", "output": "1" }, { "input": "3 2 5 2", "output": "2" }, { "input": "99 19 1 7", "output": "15" }, { "input": "16 3 100 1", "output": "1" }, { "input": "100 34 1 100", "output": "2" }, { "input": "100 33 1 1", "output": "1" }, { "input": "2 3 4 3", "output": "4" }, { "input": "15 4 4 10", "output": "4" }, { "input": "1144108931 470211273 45 79", "output": "11993619960" }, { "input": "2 3 3 4", "output": "3" }, { "input": "29 5 4 9", "output": "4" }, { "input": "15 7 1 5", "output": "5" }, { "input": "1 1 1 1", "output": "0" }, { "input": "1 1 3 4", "output": "0" }, { "input": "10 12 2 1", "output": "4" }, { "input": "1 2 3 4", "output": "3" } ]
1,591,692,666
2,147,483,647
PyPy 3
OK
TESTS
109
155
0
n,m,a,b = map(int,input().split()) f = 0 if n%m==0: print(0) f = 1 if not f: bl = n+(m-(n%m)) bl = bl-n d = n-(n%m) d=n-d print(min(bl*a,d*b))
Title: Commentary Boxes Time Limit: None seconds Memory Limit: None megabytes Problem Description: Berland Football Cup starts really soon! Commentators from all over the world come to the event. Organizers have already built $n$ commentary boxes. $m$ regional delegations will come to the Cup. Every delegation should get the same number of the commentary boxes. If any box is left unoccupied then the delegations will be upset. So each box should be occupied by exactly one delegation. If $n$ is not divisible by $m$, it is impossible to distribute the boxes to the delegations at the moment. Organizers can build a new commentary box paying $a$ burles and demolish a commentary box paying $b$ burles. They can both build and demolish boxes arbitrary number of times (each time paying a corresponding fee). It is allowed to demolish all the existing boxes. What is the minimal amount of burles organizers should pay to satisfy all the delegations (i.e. to make the number of the boxes be divisible by $m$)? Input Specification: The only line contains four integer numbers $n$, $m$, $a$ and $b$ ($1 \le n, m \le 10^{12}$, $1 \le a, b \le 100$), where $n$ is the initial number of the commentary boxes, $m$ is the number of delegations to come, $a$ is the fee to build a box and $b$ is the fee to demolish a box. Output Specification: Output the minimal amount of burles organizers should pay to satisfy all the delegations (i.e. to make the number of the boxes be divisible by $m$). It is allowed that the final number of the boxes is equal to $0$. Demo Input: ['9 7 3 8\n', '2 7 3 7\n', '30 6 17 19\n'] Demo Output: ['15\n', '14\n', '0\n'] Note: In the first example organizers can build $5$ boxes to make the total of $14$ paying $3$ burles for the each of them. In the second example organizers can demolish $2$ boxes to make the total of $0$ paying $7$ burles for the each of them. In the third example organizers are already able to distribute all the boxes equally among the delegations, each one get $5$ boxes.
```python n,m,a,b = map(int,input().split()) f = 0 if n%m==0: print(0) f = 1 if not f: bl = n+(m-(n%m)) bl = bl-n d = n-(n%m) d=n-d print(min(bl*a,d*b)) ```
3
785
A
Anton and Polyhedrons
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons: - Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces. All five kinds of polyhedrons are shown on the picture below: Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number!
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of polyhedrons in Anton's collection. Each of the following *n* lines of the input contains a string *s**i* — the name of the *i*-th polyhedron in Anton's collection. The string can look like this: - "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron.
Output one number — the total number of faces in all the polyhedrons in Anton's collection.
[ "4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n", "3\nDodecahedron\nOctahedron\nOctahedron\n" ]
[ "42\n", "28\n" ]
In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces.
500
[ { "input": "4\nIcosahedron\nCube\nTetrahedron\nDodecahedron", "output": "42" }, { "input": "3\nDodecahedron\nOctahedron\nOctahedron", "output": "28" }, { "input": "25\nIcosahedron\nOctahedron\nTetrahedron\nDodecahedron\nCube\nIcosahedron\nOctahedron\nCube\nTetrahedron\nIcosahedron\nIcosahedron\nTetrahedron\nOctahedron\nDodecahedron\nIcosahedron\nOctahedron\nIcosahedron\nTetrahedron\nDodecahedron\nTetrahedron\nOctahedron\nCube\nCube\nDodecahedron\nTetrahedron", "output": "256" }, { "input": "1\nTetrahedron", "output": "4" }, { "input": "1\nCube", "output": "6" }, { "input": "1\nOctahedron", "output": "8" }, { "input": "1\nDodecahedron", "output": "12" }, { "input": "1\nIcosahedron", "output": "20" }, { "input": "28\nOctahedron\nDodecahedron\nOctahedron\nOctahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nDodecahedron\nDodecahedron\nCube\nDodecahedron\nCube\nTetrahedron\nCube\nCube\nTetrahedron\nDodecahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nIcosahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron", "output": "340" } ]
1,676,519,630
2,147,483,647
PyPy 3-64
OK
TESTS
30
1,060
9,113,600
a=int(input()) s=0 for i in range(a): x=input() if x=="Tetrahedron": s=s+4 if x=="Cube": s=s+6 if x=="Octahedron": s=s+8 if x=="Dodecahedron": s=s+12 if x=="Icosahedron": s=s+20 print(s)
Title: Anton and Polyhedrons Time Limit: None seconds Memory Limit: None megabytes Problem Description: Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons: - Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces. All five kinds of polyhedrons are shown on the picture below: Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number! Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of polyhedrons in Anton's collection. Each of the following *n* lines of the input contains a string *s**i* — the name of the *i*-th polyhedron in Anton's collection. The string can look like this: - "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron. Output Specification: Output one number — the total number of faces in all the polyhedrons in Anton's collection. Demo Input: ['4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n', '3\nDodecahedron\nOctahedron\nOctahedron\n'] Demo Output: ['42\n', '28\n'] Note: In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces.
```python a=int(input()) s=0 for i in range(a): x=input() if x=="Tetrahedron": s=s+4 if x=="Cube": s=s+6 if x=="Octahedron": s=s+8 if x=="Dodecahedron": s=s+12 if x=="Icosahedron": s=s+20 print(s) ```
3
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,664,709,382
2,147,483,647
Python 3
OK
TESTS
30
92
0
n = input() c = 0 for i in n: if i.isupper(): c+=1 if c > (len(n) - c): print(n.upper()) else: print(n.lower())
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python n = input() c = 0 for i in n: if i.isupper(): c+=1 if c > (len(n) - c): print(n.upper()) else: print(n.lower()) ```
3.977
369
A
Valera and Plates
PROGRAMMING
900
[ "greedy", "implementation" ]
null
null
Valera is a lazy student. He has *m* clean bowls and *k* clean plates. Valera has made an eating plan for the next *n* days. As Valera is lazy, he will eat exactly one dish per day. At that, in order to eat a dish, he needs exactly one clean plate or bowl. We know that Valera can cook only two types of dishes. He can eat dishes of the first type from bowls and dishes of the second type from either bowls or plates. When Valera finishes eating, he leaves a dirty plate/bowl behind. His life philosophy doesn't let him eat from dirty kitchenware. So sometimes he needs to wash his plate/bowl before eating. Find the minimum number of times Valera will need to wash a plate/bowl, if he acts optimally.
The first line of the input contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=1000) — the number of the planned days, the number of clean bowls and the number of clean plates. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2). If *a**i* equals one, then on day *i* Valera will eat a first type dish. If *a**i* equals two, then on day *i* Valera will eat a second type dish.
Print a single integer — the minimum number of times Valera will need to wash a plate/bowl.
[ "3 1 1\n1 2 1\n", "4 3 1\n1 1 1 1\n", "3 1 2\n2 2 2\n", "8 2 2\n1 2 1 2 1 2 1 2\n" ]
[ "1\n", "1\n", "0\n", "4\n" ]
In the first sample Valera will wash a bowl only on the third day, so the answer is one. In the second sample, Valera will have the first type of the dish during all four days, and since there are only three bowls, he will wash a bowl exactly once. In the third sample, Valera will have the second type of dish for all three days, and as they can be eaten from either a plate or a bowl, he will never need to wash a plate/bowl.
500
[ { "input": "3 1 1\n1 2 1", "output": "1" }, { "input": "4 3 1\n1 1 1 1", "output": "1" }, { "input": "3 1 2\n2 2 2", "output": "0" }, { "input": "8 2 2\n1 2 1 2 1 2 1 2", "output": "4" }, { "input": "2 100 100\n2 2", "output": "0" }, { "input": "1 1 1\n2", "output": "0" }, { "input": "233 100 1\n2 2 1 1 1 2 2 2 2 1 1 2 2 2 1 2 2 1 1 1 2 2 1 1 1 1 2 1 2 2 1 1 2 2 1 2 2 1 2 1 2 1 2 2 2 1 1 1 1 2 1 2 1 1 2 1 1 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 2 2 2 1 1 2 2 1 1 1 1 2 1 1 2 1 2 2 2 1 1 1 2 2 2 1 1 1 1 2 1 2 1 1 1 1 2 2 2 1 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 2 1 1 1 2 2 1 1 2 1 2 1 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 1 2 2 1 1 1 2 2 1 1 2 2 1 1 2 1 1 2 2 1 2 2 2 2 2 2 1 2 2 2 2 2 1 1 2 2 2 2 2 2 1 1 1 2 1 2 2 2 2 2 2 2 2 1 1 2 1 2 1 2 2", "output": "132" }, { "input": "123 100 1\n2 2 2 1 1 2 2 2 2 1 1 2 2 2 1 2 2 2 2 1 2 2 2 1 1 1 2 2 2 2 1 2 2 2 2 2 2 1 2 1 2 1 2 2 2 1 2 1 2 2 1 2 2 1 2 2 1 2 2 1 2 2 2 1 1 1 1 1 1 1 1 1 2 2 2 2 2 1 1 2 2 1 1 1 1 2 1 2 2 1 2 2 2 1 1 1 2 2 2 1 2 2 2 2 1 2 2 2 2 1 2 2 2 1 1 2 1 2 1 2 1 1 1", "output": "22" }, { "input": "188 100 1\n2 2 1 1 1 2 2 2 2 1 1 2 2 2 1 2 2 1 1 1 2 2 1 1 1 1 2 1 2 2 1 1 2 2 1 2 2 1 2 1 2 1 2 2 2 1 1 1 1 2 1 2 1 1 2 1 1 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 2 2 2 1 1 2 2 1 1 1 1 2 1 1 2 1 2 2 2 1 1 1 2 2 2 1 1 1 1 2 1 2 1 1 1 1 2 2 2 1 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 2 1 1 1 2 2 1 1 2 1 2 1 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 1 2 2 1 1 1 2 2 1 1 2 2 1 1 2 1", "output": "87" }, { "input": "3 1 2\n1 1 1", "output": "2" }, { "input": "3 2 2\n1 1 1", "output": "1" }, { "input": "3 2 1\n1 1 1", "output": "1" }, { "input": "3 1 1\n1 1 1", "output": "2" }, { "input": "5 1 2\n2 2 2 2 2", "output": "2" }, { "input": "5 2 2\n2 2 2 2 2", "output": "1" }, { "input": "5 2 1\n2 2 2 2 2", "output": "2" }, { "input": "5 1 1\n2 2 2 2 2", "output": "3" }, { "input": "1 1 2\n2", "output": "0" }, { "input": "1 2 2\n2", "output": "0" }, { "input": "1 2 1\n2", "output": "0" }, { "input": "1 1 1\n2", "output": "0" }, { "input": "6 3 1\n1 1 2 2 2 2", "output": "2" }, { "input": "100 40 20\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "40" }, { "input": "7 5 2\n2 2 1 1 1 1 1", "output": "0" }, { "input": "10 4 4\n2 2 2 2 2 2 1 1 1 1", "output": "2" }, { "input": "3 2 1\n2 1 1", "output": "0" }, { "input": "7 6 1\n2 1 1 1 1 1 1", "output": "0" }, { "input": "7 5 1\n1 1 1 2 2 2 2", "output": "1" }, { "input": "5 3 1\n1 1 2 2 2", "output": "1" }, { "input": "3 1 1\n2 2 2", "output": "1" }, { "input": "5 2 2\n2 2 2 2 2", "output": "1" }, { "input": "3 1 3\n1 1 1", "output": "2" }, { "input": "5 2 1\n1 1 2 2 2", "output": "2" }, { "input": "4 3 2\n2 1 1 1", "output": "0" }, { "input": "4 2 1\n1 2 2 2", "output": "1" }, { "input": "14 4 7\n1 1 1 2 2 2 2 2 2 2 2 2 2 2", "output": "3" }, { "input": "12 10 4\n2 2 2 2 2 2 1 1 1 1 1 1", "output": "0" }, { "input": "5 3 2\n2 2 1 1 1", "output": "0" } ]
1,439,182,784
2,147,483,647
Python 3
OK
TESTS
63
62
0
firstLine = [int(n) for n in input().split()]; secondLine = [int(n) for n in input().split()]; bowls = firstLine[1]; plates = firstLine[2]; liquid = 0; solid = 0; for i in secondLine: if(i==1): liquid += 1; else: solid += 1; total = 0; total += max(liquid-bowls, 0); bowls = max(bowls-liquid, 0); total += max((solid-bowls)-plates, 0); print(total);
Title: Valera and Plates Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera is a lazy student. He has *m* clean bowls and *k* clean plates. Valera has made an eating plan for the next *n* days. As Valera is lazy, he will eat exactly one dish per day. At that, in order to eat a dish, he needs exactly one clean plate or bowl. We know that Valera can cook only two types of dishes. He can eat dishes of the first type from bowls and dishes of the second type from either bowls or plates. When Valera finishes eating, he leaves a dirty plate/bowl behind. His life philosophy doesn't let him eat from dirty kitchenware. So sometimes he needs to wash his plate/bowl before eating. Find the minimum number of times Valera will need to wash a plate/bowl, if he acts optimally. Input Specification: The first line of the input contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=1000) — the number of the planned days, the number of clean bowls and the number of clean plates. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2). If *a**i* equals one, then on day *i* Valera will eat a first type dish. If *a**i* equals two, then on day *i* Valera will eat a second type dish. Output Specification: Print a single integer — the minimum number of times Valera will need to wash a plate/bowl. Demo Input: ['3 1 1\n1 2 1\n', '4 3 1\n1 1 1 1\n', '3 1 2\n2 2 2\n', '8 2 2\n1 2 1 2 1 2 1 2\n'] Demo Output: ['1\n', '1\n', '0\n', '4\n'] Note: In the first sample Valera will wash a bowl only on the third day, so the answer is one. In the second sample, Valera will have the first type of the dish during all four days, and since there are only three bowls, he will wash a bowl exactly once. In the third sample, Valera will have the second type of dish for all three days, and as they can be eaten from either a plate or a bowl, he will never need to wash a plate/bowl.
```python firstLine = [int(n) for n in input().split()]; secondLine = [int(n) for n in input().split()]; bowls = firstLine[1]; plates = firstLine[2]; liquid = 0; solid = 0; for i in secondLine: if(i==1): liquid += 1; else: solid += 1; total = 0; total += max(liquid-bowls, 0); bowls = max(bowls-liquid, 0); total += max((solid-bowls)-plates, 0); print(total); ```
3
784
B
Kids' Riddle
PROGRAMMING
2,000
[ "*special" ]
null
null
Programmers' kids solve this riddle in 5-10 minutes. How fast can you do it?
The input contains a single integer *n* (0<=≤<=*n*<=≤<=2000000000).
Output a single integer.
[ "11\n", "14\n", "61441\n", "571576\n", "2128506\n" ]
[ "2\n", "0\n", "2\n", "10\n", "3\n" ]
none
0
[ { "input": "11", "output": "2" }, { "input": "14", "output": "0" }, { "input": "61441", "output": "2" }, { "input": "571576", "output": "10" }, { "input": "2128506", "output": "3" }, { "input": "0", "output": "1" }, { "input": "2000000000", "output": "4" }, { "input": "143165576", "output": "14" }, { "input": "1741", "output": "2" }, { "input": "1919020031", "output": "3" }, { "input": "1795248373", "output": "5" }, { "input": "1818960378", "output": "5" }, { "input": "1285316221", "output": "3" }, { "input": "1309028227", "output": "5" }, { "input": "1304312649", "output": "8" }, { "input": "1180540990", "output": "5" }, { "input": "1204252996", "output": "3" }, { "input": "1199537418", "output": "4" }, { "input": "1075765759", "output": "2" }, { "input": "724264821", "output": "5" }, { "input": "747976826", "output": "4" }, { "input": "624205168", "output": "4" }, { "input": "619489590", "output": "4" }, { "input": "643201595", "output": "5" }, { "input": "638486017", "output": "6" }, { "input": "514714359", "output": "3" }, { "input": "833393692", "output": "3" }, { "input": "186925426", "output": "4" }, { "input": "210637432", "output": "4" }, { "input": "58438190", "output": "4" } ]
1,493,675,272
2,147,483,647
PyPy 3
OK
TESTS
30
109
23,142,400
print(sum(["046889ABBDabbd".count(x) for x in hex(int(input()))])-1)
Title: Kids' Riddle Time Limit: None seconds Memory Limit: None megabytes Problem Description: Programmers' kids solve this riddle in 5-10 minutes. How fast can you do it? Input Specification: The input contains a single integer *n* (0<=≤<=*n*<=≤<=2000000000). Output Specification: Output a single integer. Demo Input: ['11\n', '14\n', '61441\n', '571576\n', '2128506\n'] Demo Output: ['2\n', '0\n', '2\n', '10\n', '3\n'] Note: none
```python print(sum(["046889ABBDabbd".count(x) for x in hex(int(input()))])-1) ```
3
908
A
New Year and Counting Cards
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
Your friend has *n* cards. You know that each card has a lowercase English letter on one side and a digit on the other. Currently, your friend has laid out the cards on a table so only one side of each card is visible. You would like to know if the following statement is true for cards that your friend owns: "If a card has a vowel on one side, then it has an even digit on the other side." More specifically, a vowel is one of 'a', 'e', 'i', 'o' or 'u', and even digit is one of '0', '2', '4', '6' or '8'. For example, if a card has 'a' on one side, and '6' on the other side, then this statement is true for it. Also, the statement is true, for example, for a card with 'b' and '4', and for a card with 'b' and '3' (since the letter is not a vowel). The statement is false, for example, for card with 'e' and '5'. You are interested if the statement is true for all cards. In particular, if no card has a vowel, the statement is true. To determine this, you can flip over some cards to reveal the other side. You would like to know what is the minimum number of cards you need to flip in the worst case in order to verify that the statement is true.
The first and only line of input will contain a string *s* (1<=≤<=|*s*|<=≤<=50), denoting the sides of the cards that you can see on the table currently. Each character of *s* is either a lowercase English letter or a digit.
Print a single integer, the minimum number of cards you must turn over to verify your claim.
[ "ee\n", "z\n", "0ay1\n" ]
[ "2\n", "0\n", "2\n" ]
In the first sample, we must turn over both cards. Note that even though both cards have the same letter, they could possibly have different numbers on the other side. In the second sample, we don't need to turn over any cards. The statement is vacuously true, since you know your friend has no cards with a vowel on them. In the third sample, we need to flip the second and fourth cards.
500
[ { "input": "ee", "output": "2" }, { "input": "z", "output": "0" }, { "input": "0ay1", "output": "2" }, { "input": "0abcdefghijklmnopqrstuvwxyz1234567896", "output": "10" }, { "input": "0a0a9e9e2i2i9o9o6u6u9z9z4x4x9b9b", "output": "18" }, { "input": "01234567890123456789012345678901234567890123456789", "output": "25" }, { "input": "qwertyuioplkjhgfdsazxcvbnmqwertyuioplkjhgfdsazxcvb", "output": "10" }, { "input": "cjw2dwmr10pku4yxohe0wglktd", "output": "4" }, { "input": "6z2tx805jie8cfybwtfqvmlveec3iak5z5u3lu62vbxyqht6", "output": "13" }, { "input": "kaq7jyialrfp4ilkni90eq8v3amcbygon7py0hb8z26fbl8ss1", "output": "13" }, { "input": "hpwn50zgbmct80k9rizjqg40nycgs0acwikjqt11nr6m61krfs", "output": "8" }, { "input": "l3rw91a4m25l8iytxyeuixsegzcbm4h41ornf3pixkrmwznrzc", "output": "14" }, { "input": "2222", "output": "0" }, { "input": "13579", "output": "5" }, { "input": "1", "output": "1" }, { "input": "0", "output": "0" }, { "input": "a", "output": "1" }, { "input": "y", "output": "0" }, { "input": "w", "output": "0" }, { "input": "oo", "output": "2" }, { "input": "oy", "output": "1" }, { "input": "yo", "output": "1" }, { "input": "yy", "output": "0" }, { "input": "a0", "output": "1" }, { "input": "a9", "output": "2" }, { "input": "y0", "output": "0" }, { "input": "y7", "output": "1" }, { "input": "0a", "output": "1" }, { "input": "3a", "output": "2" }, { "input": "06", "output": "0" }, { "input": "07", "output": "1" }, { "input": "70", "output": "1" }, { "input": "77", "output": "2" }, { "input": "13570", "output": "4" }, { "input": "0000000000011111", "output": "5" }, { "input": "1357", "output": "4" }, { "input": "uuuuuuuuuuuuuuuuuu", "output": "18" }, { "input": "gabieurat", "output": "5" } ]
1,620,389,987
2,147,483,647
Python 3
OK
TESTS
38
62
6,758,400
flipped_cards = {'a', 'e', 'i', 'o', 'u'} x = 0 for c in input(): if c in flipped_cards: x += 1 if c.isdigit() and int(c) % 2 == 1: x += 1 print(x)
Title: New Year and Counting Cards Time Limit: None seconds Memory Limit: None megabytes Problem Description: Your friend has *n* cards. You know that each card has a lowercase English letter on one side and a digit on the other. Currently, your friend has laid out the cards on a table so only one side of each card is visible. You would like to know if the following statement is true for cards that your friend owns: "If a card has a vowel on one side, then it has an even digit on the other side." More specifically, a vowel is one of 'a', 'e', 'i', 'o' or 'u', and even digit is one of '0', '2', '4', '6' or '8'. For example, if a card has 'a' on one side, and '6' on the other side, then this statement is true for it. Also, the statement is true, for example, for a card with 'b' and '4', and for a card with 'b' and '3' (since the letter is not a vowel). The statement is false, for example, for card with 'e' and '5'. You are interested if the statement is true for all cards. In particular, if no card has a vowel, the statement is true. To determine this, you can flip over some cards to reveal the other side. You would like to know what is the minimum number of cards you need to flip in the worst case in order to verify that the statement is true. Input Specification: The first and only line of input will contain a string *s* (1<=≤<=|*s*|<=≤<=50), denoting the sides of the cards that you can see on the table currently. Each character of *s* is either a lowercase English letter or a digit. Output Specification: Print a single integer, the minimum number of cards you must turn over to verify your claim. Demo Input: ['ee\n', 'z\n', '0ay1\n'] Demo Output: ['2\n', '0\n', '2\n'] Note: In the first sample, we must turn over both cards. Note that even though both cards have the same letter, they could possibly have different numbers on the other side. In the second sample, we don't need to turn over any cards. The statement is vacuously true, since you know your friend has no cards with a vowel on them. In the third sample, we need to flip the second and fourth cards.
```python flipped_cards = {'a', 'e', 'i', 'o', 'u'} x = 0 for c in input(): if c in flipped_cards: x += 1 if c.isdigit() and int(c) % 2 == 1: x += 1 print(x) ```
3
265
A
Colorful Stones (Simplified Edition)
PROGRAMMING
800
[ "implementation" ]
null
null
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively. Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times. Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move. You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction. Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
Print the final 1-based position of Liss in a single line.
[ "RGB\nRRR\n", "RRRBGBRBBB\nBBBRR\n", "BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n" ]
[ "2\n", "3\n", "15\n" ]
none
500
[ { "input": "RGB\nRRR", "output": "2" }, { "input": "RRRBGBRBBB\nBBBRR", "output": "3" }, { "input": "BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB", "output": "15" }, { "input": "G\nRRBBRBRRBR", "output": "1" }, { "input": "RRRRRBRRBRRGRBGGRRRGRBBRBBBBBRGRBGBRRGBBBRBBGBRGBB\nB", "output": "1" }, { "input": "RRGGBRGRBG\nBRRGGBBGGR", "output": "7" }, { "input": "BBRRGBGGRGBRGBRBRBGR\nGGGRBGGGBRRRRGRBGBGRGRRBGRBGBG", "output": "15" }, { "input": "GBRRBGBGBBBBRRRGBGRRRGBGBBBRGR\nRRGBRRGRBBBBBBGRRBBR", "output": "8" }, { "input": "BRGRRGRGRRGBBGBBBRRBBRRBGBBGRGBBGGRGBRBGGGRRRBGGBB\nRGBBGRRBBBRRGRRBRBBRGBBGGGRGBGRRRRBRBGGBRBGGGRGBRR", "output": "16" }, { "input": "GGRGGBRRGRGBRRGGRBBGGRRGBBBGBBBGGRBGGBRBBRGBRRRBRG\nGGRGRRRRRRRRRGBBBBRGBRGRGRRGBBRGGBRBBRBGBRGRRRRGGR", "output": "18" }, { "input": "RBBRBGBBGGGBRRBGBRGRRGGRBBBBGRBGGBRRBGBBRBRGBBGGGG\nBRRGRBGRBGBRGBRBGGBBBGBBRGRBGRGRBGRBGGRRBGBRGRRBBG", "output": "23" }, { "input": "RRGGRRBRGRGBRGBRGBBRGGGBRBGBRGBRGGBRBRGBGRRBBGGRBR\nBRGRBBBGRBGRRGGRRRRRRRRGGGGGGGGBGGGGGGGRGRBBRGRGBR", "output": "14" }, { "input": "RBRBRRRRRGGR\nBBBBRRGGBGRBRGBBRGGGRGGBRRBRBRBGGG", "output": "12" }, { "input": "GGRGGGBRGRGRBBRGGGRBGRRR\nGBBBBGBGBGBBBRGGRGGBGRRGRRRGBGB", "output": "12" }, { "input": "RGRBGBRBBGBRRGGGBBGBRRBGRGBBBBBGRRRGGRBB\nBGR", "output": "2" }, { "input": "R\nB", "output": "1" }, { "input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR", "output": "50" }, { "input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG", "output": "1" }, { "input": "R\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG", "output": "1" } ]
1,601,093,281
2,147,483,647
Python 3
OK
TESTS
19
218
0
inp = list(input()) ins = list(input()) res = 0 for i in range(len(ins)): if (inp[res] == ins[i]): res += 1 print(res+1)
Title: Colorful Stones (Simplified Edition) Time Limit: None seconds Memory Limit: None megabytes Problem Description: There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively. Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times. Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move. You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction. Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence. Input Specification: The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence. Output Specification: Print the final 1-based position of Liss in a single line. Demo Input: ['RGB\nRRR\n', 'RRRBGBRBBB\nBBBRR\n', 'BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n'] Demo Output: ['2\n', '3\n', '15\n'] Note: none
```python inp = list(input()) ins = list(input()) res = 0 for i in range(len(ins)): if (inp[res] == ins[i]): res += 1 print(res+1) ```
3
66
A
Petya and Java
PROGRAMMING
1,300
[ "implementation", "strings" ]
A. Petya and Java
2
256
Little Petya has recently started attending a programming club. Naturally he is facing the problem of choosing a programming language. After long considerations he realized that Java is the best choice. The main argument in favor of choosing Java was that it has a very large integer data type, called BigInteger. But having attended several classes of the club, Petya realized that not all tasks require using the BigInteger type. It turned out that in some tasks it is much easier to use small data types. That's why a question arises: "Which integer type to use if one wants to store a positive integer *n*?" Petya knows only 5 integer types: 1) byte occupies 1 byte and allows you to store numbers from <=-<=128 to 127 2) short occupies 2 bytes and allows you to store numbers from <=-<=32768 to 32767 3) int occupies 4 bytes and allows you to store numbers from <=-<=2147483648 to 2147483647 4) long occupies 8 bytes and allows you to store numbers from <=-<=9223372036854775808 to 9223372036854775807 5) BigInteger can store any integer number, but at that it is not a primitive type, and operations with it are much slower. For all the types given above the boundary values are included in the value range. From this list, Petya wants to choose the smallest type that can store a positive integer *n*. Since BigInteger works much slower, Peter regards it last. Help him.
The first line contains a positive number *n*. It consists of no more than 100 digits and doesn't contain any leading zeros. The number *n* can't be represented as an empty string. Please, do not use %lld specificator to read or write 64-bit integers in C++. It is preffered to use cout (also you may use %I64d).
Print the first type from the list "byte, short, int, long, BigInteger", that can store the natural number *n*, in accordance with the data given above.
[ "127\n", "130\n", "123456789101112131415161718192021222324\n" ]
[ "byte\n", "short\n", "BigInteger\n" ]
none
500
[ { "input": "127", "output": "byte" }, { "input": "130", "output": "short" }, { "input": "123456789101112131415161718192021222324", "output": "BigInteger" }, { "input": "6", "output": "byte" }, { "input": "16", "output": "byte" }, { "input": "126", "output": "byte" }, { "input": "128", "output": "short" }, { "input": "32766", "output": "short" }, { "input": "111111", "output": "int" }, { "input": "22222", "output": "short" }, { "input": "32767", "output": "short" }, { "input": "32768", "output": "int" }, { "input": "32769", "output": "int" }, { "input": "2147483645", "output": "int" }, { "input": "2147483646", "output": "int" }, { "input": "2147483647", "output": "int" }, { "input": "2147483648", "output": "long" }, { "input": "2147483649", "output": "long" }, { "input": "9223372036854775805", "output": "long" }, { "input": "9223372036854775806", "output": "long" }, { "input": "9223372036854775807", "output": "long" }, { "input": "9223372036854775808", "output": "BigInteger" }, { "input": "9223372036854775809", "output": "BigInteger" }, { "input": "1111111111111111111111111111111111111111111111", "output": "BigInteger" }, { "input": "232", "output": "short" }, { "input": "241796563564014133460267652699", "output": "BigInteger" }, { "input": "29360359146807441660707083821018832188095237636414144034857851003419752010124705615779249", "output": "BigInteger" }, { "input": "337300529263821789926982715723773719445001702036602052198530564", "output": "BigInteger" }, { "input": "381127467969689863953686682245136076127159921", "output": "BigInteger" }, { "input": "2158324958633591462", "output": "long" }, { "input": "268659422768117401499491767189496733446324586965055954729177892248858259490346", "output": "BigInteger" }, { "input": "3023764505449745844381036446038799100004717936344985", "output": "BigInteger" }, { "input": "13408349824892484976400774", "output": "BigInteger" }, { "input": "18880842614378213198381172973704766723997934818440985546083314104481253291692101136681", "output": "BigInteger" }, { "input": "1180990956946757129733650596194933741", "output": "BigInteger" }, { "input": "73795216631038776655609800540262114612084443385902708034055020082090470662930545328551", "output": "BigInteger" }, { "input": "1658370691480968202384509492140362150472696196949", "output": "BigInteger" }, { "input": "59662093286671707493190399502717308574459619342109544431740791973099298641871347858082458491958703", "output": "BigInteger" }, { "input": "205505005582428018613354752739589866670902346355933720701937", "output": "BigInteger" }, { "input": "53348890623013817139699", "output": "BigInteger" }, { "input": "262373979958859125198440634134122707574734706745701184688685117904709744", "output": "BigInteger" }, { "input": "69113784278456828987289369893745977", "output": "BigInteger" }, { "input": "2210209454022702335652564247406666491086662454147967686455330365147159266087", "output": "BigInteger" }, { "input": "630105816139991597267787581532092408135", "output": "BigInteger" }, { "input": "800461429306907809762708270", "output": "BigInteger" }, { "input": "7685166910821197056344900917707673568669808490600751439157", "output": "BigInteger" }, { "input": "713549841568602590705962611607726022334779480510421458817648621376683672722573289661127894", "output": "BigInteger" }, { "input": "680504312323996476676434432", "output": "BigInteger" }, { "input": "3376595620091080825479292544658464163405755746884100218035", "output": "BigInteger" }, { "input": "303681723783491968617491075591006152690484825330764215796396316561122383310011589365655481", "output": "BigInteger" }, { "input": "4868659422768117401499491767189496733446324586965055954729177892248858259490346614099717639491763430", "output": "BigInteger" }, { "input": "3502376450544974584438103644603879910000471793634498544789130945841846713263971487355748226237288709", "output": "BigInteger" }, { "input": "2334083498248924849764007740114454487565621932425948046430072197452845278935316358800789014185793377", "output": "BigInteger" }, { "input": "1988808426143782131983811729737047667239979348184409855460833141044812532916921011366813880911319644", "output": "BigInteger" }, { "input": "1018099095694675712973365059619493374113337270925179793757322992466016001294122941535439492265169131", "output": "BigInteger" }, { "input": "8437952166310387766556098005402621146120844433859027080340550200820904706629305453285512716464931911", "output": "BigInteger" }, { "input": "6965837069148096820238450949214036215047269619694967357734070611376013382163559966747678150791825071", "output": "BigInteger" }, { "input": "4596620932866717074931903995027173085744596193421095444317407919730992986418713478580824584919587030", "output": "BigInteger" }, { "input": "1905505005582428018613354752739589866670902346355933720701937408006000562951996789032987808118459990", "output": "BigInteger" }, { "input": "8433488906230138171396997888322916936677429522910871017295155818340819168386140293774243244435122950", "output": "BigInteger" }, { "input": "6862373979958859125198440634134122707574734706745701184688685117904709744830303784215298687654884810", "output": "BigInteger" }, { "input": "4491137842784568289872893698937459777201151060689848471272003426250808340375567208957554901863756992", "output": "BigInteger" }, { "input": "9721020945402270233565256424740666649108666245414796768645533036514715926608741510409618545180420952", "output": "BigInteger" }, { "input": "7330105816139991597267787581532092408135003429259616955239761315950805521264994021242873979309182812", "output": "BigInteger" }, { "input": "2000461429306907809762708270752707617318091579531521957022940951538737203583768926365382290530636885", "output": "BigInteger" }, { "input": "9868516691082119705634490091770767356866980849060075143915700796802700437762260163478754592094654326", "output": "BigInteger" }, { "input": "8713549841568602590705962611607726022334779480510421458817648621376683672722573289661127894678771177", "output": "BigInteger" }, { "input": "4580504312323996476676434432646986768872786931159974634901608445720467716981185426771899006352697916", "output": "BigInteger" }, { "input": "2537659562009108082547929254465846416340575574688410021803548570097340949141688442074263189944614467", "output": "BigInteger" }, { "input": "1403681723783491968617491075591006152690484825330764215796396316561122383310011589365655481428540208", "output": "BigInteger" }, { "input": "26", "output": "byte" }, { "input": "302376450544", "output": "long" }, { "input": "13", "output": "byte" }, { "input": "188808426143", "output": "long" }, { "input": "118099095694675", "output": "long" }, { "input": "73795216631038", "output": "long" }, { "input": "1658370691480", "output": "long" }, { "input": "596620932866", "output": "long" }, { "input": "2055050055", "output": "int" }, { "input": "533488906", "output": "int" }, { "input": "26237397", "output": "int" }, { "input": "6911378", "output": "int" }, { "input": "221020945402270233", "output": "long" }, { "input": "63010581613999159", "output": "long" }, { "input": "80046142930", "output": "long" }, { "input": "7685166910821197", "output": "long" }, { "input": "71", "output": "byte" }, { "input": "6805043123239964766", "output": "long" }, { "input": "3376", "output": "short" }, { "input": "3036817237", "output": "long" } ]
1,653,424,879
2,147,483,647
PyPy 3-64
OK
TESTS
90
124
0
def solve(): # n,m = (int(i) for i in input().split(" ")) n = int(input()) if n>=-128 and n<=127: print("byte") elif n>=-32768 and n<=32767: print("short") elif n>=-2147483648 and n<= 2147483647: print("int") elif n>=-9223372036854775808 and n<= 9223372036854775807 : print("long") else: print("BigInteger") t = 1#int(input()) for _ in range(t): solve()
Title: Petya and Java Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Little Petya has recently started attending a programming club. Naturally he is facing the problem of choosing a programming language. After long considerations he realized that Java is the best choice. The main argument in favor of choosing Java was that it has a very large integer data type, called BigInteger. But having attended several classes of the club, Petya realized that not all tasks require using the BigInteger type. It turned out that in some tasks it is much easier to use small data types. That's why a question arises: "Which integer type to use if one wants to store a positive integer *n*?" Petya knows only 5 integer types: 1) byte occupies 1 byte and allows you to store numbers from <=-<=128 to 127 2) short occupies 2 bytes and allows you to store numbers from <=-<=32768 to 32767 3) int occupies 4 bytes and allows you to store numbers from <=-<=2147483648 to 2147483647 4) long occupies 8 bytes and allows you to store numbers from <=-<=9223372036854775808 to 9223372036854775807 5) BigInteger can store any integer number, but at that it is not a primitive type, and operations with it are much slower. For all the types given above the boundary values are included in the value range. From this list, Petya wants to choose the smallest type that can store a positive integer *n*. Since BigInteger works much slower, Peter regards it last. Help him. Input Specification: The first line contains a positive number *n*. It consists of no more than 100 digits and doesn't contain any leading zeros. The number *n* can't be represented as an empty string. Please, do not use %lld specificator to read or write 64-bit integers in C++. It is preffered to use cout (also you may use %I64d). Output Specification: Print the first type from the list "byte, short, int, long, BigInteger", that can store the natural number *n*, in accordance with the data given above. Demo Input: ['127\n', '130\n', '123456789101112131415161718192021222324\n'] Demo Output: ['byte\n', 'short\n', 'BigInteger\n'] Note: none
```python def solve(): # n,m = (int(i) for i in input().split(" ")) n = int(input()) if n>=-128 and n<=127: print("byte") elif n>=-32768 and n<=32767: print("short") elif n>=-2147483648 and n<= 2147483647: print("int") elif n>=-9223372036854775808 and n<= 9223372036854775807 : print("long") else: print("BigInteger") t = 1#int(input()) for _ in range(t): solve() ```
3.969
994
A
Fingerprints
PROGRAMMING
800
[ "implementation" ]
null
null
You are locked in a room with a door that has a keypad with 10 keys corresponding to digits from 0 to 9. To escape from the room, you need to enter a correct code. You also have a sequence of digits. Some keys on the keypad have fingerprints. You believe the correct code is the longest not necessarily contiguous subsequence of the sequence you have that only contains digits with fingerprints on the corresponding keys. Find such code.
The first line contains two integers $n$ and $m$ ($1 \le n, m \le 10$) representing the number of digits in the sequence you have and the number of keys on the keypad that have fingerprints. The next line contains $n$ distinct space-separated integers $x_1, x_2, \ldots, x_n$ ($0 \le x_i \le 9$) representing the sequence. The next line contains $m$ distinct space-separated integers $y_1, y_2, \ldots, y_m$ ($0 \le y_i \le 9$) — the keys with fingerprints.
In a single line print a space-separated sequence of integers representing the code. If the resulting sequence is empty, both printing nothing and printing a single line break is acceptable.
[ "7 3\n3 5 7 1 6 2 8\n1 2 7\n", "4 4\n3 4 1 0\n0 1 7 9\n" ]
[ "7 1 2\n", "1 0\n" ]
In the first example, the only digits with fingerprints are $1$, $2$ and $7$. All three of them appear in the sequence you know, $7$ first, then $1$ and then $2$. Therefore the output is 7 1 2. Note that the order is important, and shall be the same as the order in the original sequence. In the second example digits $0$, $1$, $7$ and $9$ have fingerprints, however only $0$ and $1$ appear in the original sequence. $1$ appears earlier, so the output is 1 0. Again, the order is important.
500
[ { "input": "7 3\n3 5 7 1 6 2 8\n1 2 7", "output": "7 1 2" }, { "input": "4 4\n3 4 1 0\n0 1 7 9", "output": "1 0" }, { "input": "9 4\n9 8 7 6 5 4 3 2 1\n2 4 6 8", "output": "8 6 4 2" }, { "input": "10 5\n3 7 1 2 4 6 9 0 5 8\n4 3 0 7 9", "output": "3 7 4 9 0" }, { "input": "10 10\n1 2 3 4 5 6 7 8 9 0\n4 5 6 7 1 2 3 0 9 8", "output": "1 2 3 4 5 6 7 8 9 0" }, { "input": "1 1\n4\n4", "output": "4" }, { "input": "3 7\n6 3 4\n4 9 0 1 7 8 6", "output": "6 4" }, { "input": "10 1\n9 0 8 1 7 4 6 5 2 3\n0", "output": "0" }, { "input": "5 10\n6 0 3 8 1\n3 1 0 5 4 7 2 8 9 6", "output": "6 0 3 8 1" }, { "input": "8 2\n7 2 9 6 1 0 3 4\n6 3", "output": "6 3" }, { "input": "5 4\n7 0 1 4 9\n0 9 5 3", "output": "0 9" }, { "input": "10 1\n9 6 2 0 1 8 3 4 7 5\n6", "output": "6" }, { "input": "10 2\n7 1 0 2 4 6 5 9 3 8\n3 2", "output": "2 3" }, { "input": "5 9\n3 7 9 2 4\n3 8 4 5 9 6 1 0 2", "output": "3 9 2 4" }, { "input": "10 6\n7 1 2 3 8 0 6 4 5 9\n1 5 8 2 3 6", "output": "1 2 3 8 6 5" }, { "input": "8 2\n7 4 8 9 2 5 6 1\n6 4", "output": "4 6" }, { "input": "10 2\n1 0 3 5 8 9 4 7 6 2\n0 3", "output": "0 3" }, { "input": "7 6\n9 2 8 6 1 3 7\n4 2 0 3 1 8", "output": "2 8 1 3" }, { "input": "1 6\n3\n6 8 2 4 5 3", "output": "3" }, { "input": "1 8\n0\n9 2 4 8 1 5 0 7", "output": "0" }, { "input": "6 9\n7 3 9 4 1 0\n9 1 5 8 0 6 2 7 4", "output": "7 9 4 1 0" }, { "input": "10 2\n4 9 6 8 3 0 1 5 7 2\n0 1", "output": "0 1" }, { "input": "10 5\n5 2 8 0 9 7 6 1 4 3\n9 6 4 1 2", "output": "2 9 6 1 4" }, { "input": "6 3\n8 3 9 2 7 6\n5 4 3", "output": "3" }, { "input": "4 10\n8 3 9 6\n4 9 6 2 7 0 8 1 3 5", "output": "8 3 9 6" }, { "input": "1 2\n1\n1 0", "output": "1" }, { "input": "3 6\n1 2 3\n4 5 6 1 2 3", "output": "1 2 3" }, { "input": "1 2\n2\n1 2", "output": "2" }, { "input": "1 10\n9\n0 1 2 3 4 5 6 7 8 9", "output": "9" } ]
1,586,607,499
2,147,483,647
PyPy 3
OK
TESTS
31
156
0
n,m=[int(x) for x in input().split()] x=[int(x) for x in input().split()][:n] y=[int(x) for x in input().split()][:m] for i in x: if i in y: print(i,end=" ")
Title: Fingerprints Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are locked in a room with a door that has a keypad with 10 keys corresponding to digits from 0 to 9. To escape from the room, you need to enter a correct code. You also have a sequence of digits. Some keys on the keypad have fingerprints. You believe the correct code is the longest not necessarily contiguous subsequence of the sequence you have that only contains digits with fingerprints on the corresponding keys. Find such code. Input Specification: The first line contains two integers $n$ and $m$ ($1 \le n, m \le 10$) representing the number of digits in the sequence you have and the number of keys on the keypad that have fingerprints. The next line contains $n$ distinct space-separated integers $x_1, x_2, \ldots, x_n$ ($0 \le x_i \le 9$) representing the sequence. The next line contains $m$ distinct space-separated integers $y_1, y_2, \ldots, y_m$ ($0 \le y_i \le 9$) — the keys with fingerprints. Output Specification: In a single line print a space-separated sequence of integers representing the code. If the resulting sequence is empty, both printing nothing and printing a single line break is acceptable. Demo Input: ['7 3\n3 5 7 1 6 2 8\n1 2 7\n', '4 4\n3 4 1 0\n0 1 7 9\n'] Demo Output: ['7 1 2\n', '1 0\n'] Note: In the first example, the only digits with fingerprints are $1$, $2$ and $7$. All three of them appear in the sequence you know, $7$ first, then $1$ and then $2$. Therefore the output is 7 1 2. Note that the order is important, and shall be the same as the order in the original sequence. In the second example digits $0$, $1$, $7$ and $9$ have fingerprints, however only $0$ and $1$ appear in the original sequence. $1$ appears earlier, so the output is 1 0. Again, the order is important.
```python n,m=[int(x) for x in input().split()] x=[int(x) for x in input().split()][:n] y=[int(x) for x in input().split()][:m] for i in x: if i in y: print(i,end=" ") ```
3
777
C
Alyona and Spreadsheet
PROGRAMMING
1,600
[ "binary search", "data structures", "dp", "greedy", "implementation", "two pointers" ]
null
null
During the lesson small girl Alyona works with one famous spreadsheet computer program and learns how to edit tables. Now she has a table filled with integers. The table consists of *n* rows and *m* columns. By *a**i*,<=*j* we will denote the integer located at the *i*-th row and the *j*-th column. We say that the table is sorted in non-decreasing order in the column *j* if *a**i*,<=*j*<=≤<=*a**i*<=+<=1,<=*j* for all *i* from 1 to *n*<=-<=1. Teacher gave Alyona *k* tasks. For each of the tasks two integers *l* and *r* are given and Alyona has to answer the following question: if one keeps the rows from *l* to *r* inclusive and deletes all others, will the table be sorted in non-decreasing order in at least one column? Formally, does there exist such *j* that *a**i*,<=*j*<=≤<=*a**i*<=+<=1,<=*j* for all *i* from *l* to *r*<=-<=1 inclusive. Alyona is too small to deal with this task and asks you to help!
The first line of the input contains two positive integers *n* and *m* (1<=≤<=*n*·*m*<=≤<=100<=000) — the number of rows and the number of columns in the table respectively. Note that your are given a constraint that bound the product of these two integers, i.e. the number of elements in the table. Each of the following *n* lines contains *m* integers. The *j*-th integers in the *i* of these lines stands for *a**i*,<=*j* (1<=≤<=*a**i*,<=*j*<=≤<=109). The next line of the input contains an integer *k* (1<=≤<=*k*<=≤<=100<=000) — the number of task that teacher gave to Alyona. The *i*-th of the next *k* lines contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*).
Print "Yes" to the *i*-th line of the output if the table consisting of rows from *l**i* to *r**i* inclusive is sorted in non-decreasing order in at least one column. Otherwise, print "No".
[ "5 4\n1 2 3 5\n3 1 3 2\n4 5 2 3\n5 5 3 2\n4 4 3 4\n6\n1 1\n2 5\n4 5\n3 5\n1 3\n1 5\n" ]
[ "Yes\nNo\nYes\nYes\nYes\nNo\n" ]
In the sample, the whole table is not sorted in any column. However, rows 1–3 are sorted in column 1, while rows 4–5 are sorted in column 3.
1,500
[ { "input": "5 4\n1 2 3 5\n3 1 3 2\n4 5 2 3\n5 5 3 2\n4 4 3 4\n6\n1 1\n2 5\n4 5\n3 5\n1 3\n1 5", "output": "Yes\nNo\nYes\nYes\nYes\nNo" }, { "input": "1 1\n1\n1\n1 1", "output": "Yes" }, { "input": "10 1\n523130301\n127101624\n15573616\n703140639\n628818570\n957494759\n161270109\n386865653\n67832626\n53360557\n17\n4 5\n4 7\n8 8\n9 9\n3 9\n8 10\n8 9\n7 9\n4 5\n2 9\n4 6\n2 4\n2 6\n4 6\n7 9\n2 4\n8 10", "output": "No\nNo\nYes\nYes\nNo\nNo\nNo\nNo\nNo\nNo\nNo\nNo\nNo\nNo\nNo\nNo\nNo" }, { "input": "15 1\n556231456\n573340933\n626155933\n397229387\n10255952\n376567394\n906742013\n269437009\n31298788\n712285290\n620239975\n379221898\n229140718\n95080095\n997123854\n18\n5 15\n1 12\n4 10\n2 15\n12 15\n15 15\n2 2\n15 15\n15 15\n13 13\n10 14\n3 6\n14 15\n3 6\n4 4\n14 15\n12 14\n1 9", "output": "No\nNo\nNo\nNo\nNo\nYes\nYes\nYes\nYes\nYes\nNo\nNo\nYes\nNo\nYes\nYes\nNo\nNo" }, { "input": "11 1\n501465490\n366941771\n415080944\n385243536\n445132523\n697044413\n894369800\n812743722\n23684788\n466526046\n953916313\n45\n2 4\n8 9\n7 7\n4 9\n2 9\n2 11\n4 4\n5 7\n1 2\n5 10\n4 6\n1 7\n4 4\n1 6\n4 7\n10 11\n1 8\n6 11\n8 8\n8 10\n1 1\n5 10\n9 10\n6 9\n6 11\n1 1\n9 9\n5 11\n1 2\n9 11\n2 6\n3 7\n11 11\n6 7\n11 11\n7 8\n5 8\n11 11\n5 6\n4 5\n2 6\n5 10\n9 9\n1 1\n1 1", "output": "No\nNo\nYes\nNo\nNo\nNo\nYes\nYes\nNo\nNo\nYes\nNo\nYes\nNo\nYes\nYes\nNo\nNo\nYes\nNo\nYes\nNo\nYes\nNo\nNo\nYes\nYes\nNo\nNo\nYes\nNo\nNo\nYes\nYes\nYes\nNo\nNo\nYes\nYes\nYes\nNo\nNo\nYes\nYes\nYes" } ]
1,698,933,257
2,147,483,647
Python 3
OK
TESTS
114
982
16,896,000
""" https://codeforces.com/problemset/problem/777/C 输入 n m(1≤n*m≤1e5) 和 n 行 m 列的矩阵 a,元素范围 [1,1e9]。 然后输入 k(1≤k≤1e5) 和 k 个询问,每个询问输入两个数 L R(1≤L≤R≤n)。 对于每个询问,请判断在第 L 行到第 R 行中,是否存在一列,元素值从上到下是递增的(允许相等),输出 Yes 或 No。 进阶:把询问范围缩小至子矩形,即第 L 行到第 R 行并且只考虑第 p 列到第 q 列。 """ from math import inf def MII(): return map(int, input().split()) def II(): return int(input()) def I(): return input() n, m = MII() res = [[] for _ in range(n)] for i in range(n): res[i] = list(MII()) ans = [0] * n # 表示每行对应非递减的最小起点 row = [0] * m for i in range(1, n): for j in range(m): if res[i-1][j] <= res[i][j]: continue else: row[j] = i ans[i] = min(row) k = II() for _ in range(k): l, r = MII() l -= 1 r -= 1 flag = "Yes" if ans[r] <= l else "No" print(flag)
Title: Alyona and Spreadsheet Time Limit: None seconds Memory Limit: None megabytes Problem Description: During the lesson small girl Alyona works with one famous spreadsheet computer program and learns how to edit tables. Now she has a table filled with integers. The table consists of *n* rows and *m* columns. By *a**i*,<=*j* we will denote the integer located at the *i*-th row and the *j*-th column. We say that the table is sorted in non-decreasing order in the column *j* if *a**i*,<=*j*<=≤<=*a**i*<=+<=1,<=*j* for all *i* from 1 to *n*<=-<=1. Teacher gave Alyona *k* tasks. For each of the tasks two integers *l* and *r* are given and Alyona has to answer the following question: if one keeps the rows from *l* to *r* inclusive and deletes all others, will the table be sorted in non-decreasing order in at least one column? Formally, does there exist such *j* that *a**i*,<=*j*<=≤<=*a**i*<=+<=1,<=*j* for all *i* from *l* to *r*<=-<=1 inclusive. Alyona is too small to deal with this task and asks you to help! Input Specification: The first line of the input contains two positive integers *n* and *m* (1<=≤<=*n*·*m*<=≤<=100<=000) — the number of rows and the number of columns in the table respectively. Note that your are given a constraint that bound the product of these two integers, i.e. the number of elements in the table. Each of the following *n* lines contains *m* integers. The *j*-th integers in the *i* of these lines stands for *a**i*,<=*j* (1<=≤<=*a**i*,<=*j*<=≤<=109). The next line of the input contains an integer *k* (1<=≤<=*k*<=≤<=100<=000) — the number of task that teacher gave to Alyona. The *i*-th of the next *k* lines contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). Output Specification: Print "Yes" to the *i*-th line of the output if the table consisting of rows from *l**i* to *r**i* inclusive is sorted in non-decreasing order in at least one column. Otherwise, print "No". Demo Input: ['5 4\n1 2 3 5\n3 1 3 2\n4 5 2 3\n5 5 3 2\n4 4 3 4\n6\n1 1\n2 5\n4 5\n3 5\n1 3\n1 5\n'] Demo Output: ['Yes\nNo\nYes\nYes\nYes\nNo\n'] Note: In the sample, the whole table is not sorted in any column. However, rows 1–3 are sorted in column 1, while rows 4–5 are sorted in column 3.
```python """ https://codeforces.com/problemset/problem/777/C 输入 n m(1≤n*m≤1e5) 和 n 行 m 列的矩阵 a,元素范围 [1,1e9]。 然后输入 k(1≤k≤1e5) 和 k 个询问,每个询问输入两个数 L R(1≤L≤R≤n)。 对于每个询问,请判断在第 L 行到第 R 行中,是否存在一列,元素值从上到下是递增的(允许相等),输出 Yes 或 No。 进阶:把询问范围缩小至子矩形,即第 L 行到第 R 行并且只考虑第 p 列到第 q 列。 """ from math import inf def MII(): return map(int, input().split()) def II(): return int(input()) def I(): return input() n, m = MII() res = [[] for _ in range(n)] for i in range(n): res[i] = list(MII()) ans = [0] * n # 表示每行对应非递减的最小起点 row = [0] * m for i in range(1, n): for j in range(m): if res[i-1][j] <= res[i][j]: continue else: row[j] = i ans[i] = min(row) k = II() for _ in range(k): l, r = MII() l -= 1 r -= 1 flag = "Yes" if ans[r] <= l else "No" print(flag) ```
3
208
A
Dubstep
PROGRAMMING
900
[ "strings" ]
null
null
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them. Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club. For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX". Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
[ "WUBWUBABCWUB\n", "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n" ]
[ "ABC ", "WE ARE THE CHAMPIONS MY FRIEND " ]
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya. In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
500
[ { "input": "WUBWUBABCWUB", "output": "ABC " }, { "input": "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB", "output": "WE ARE THE CHAMPIONS MY FRIEND " }, { "input": "WUBWUBWUBSR", "output": "SR " }, { "input": "RWUBWUBWUBLWUB", "output": "R L " }, { "input": "ZJWUBWUBWUBJWUBWUBWUBL", "output": "ZJ J L " }, { "input": "CWUBBWUBWUBWUBEWUBWUBWUBQWUBWUBWUB", "output": "C B E Q " }, { "input": "WUBJKDWUBWUBWBIRAQKFWUBWUBYEWUBWUBWUBWVWUBWUB", "output": "JKD WBIRAQKF YE WV " }, { "input": "WUBKSDHEMIXUJWUBWUBRWUBWUBWUBSWUBWUBWUBHWUBWUBWUB", "output": "KSDHEMIXUJ R S H " }, { "input": "OGWUBWUBWUBXWUBWUBWUBIWUBWUBWUBKOWUBWUB", "output": "OG X I KO " }, { "input": "QWUBQQWUBWUBWUBIWUBWUBWWWUBWUBWUBJOPJPBRH", "output": "Q QQ I WW JOPJPBRH " }, { "input": "VSRNVEATZTLGQRFEGBFPWUBWUBWUBAJWUBWUBWUBPQCHNWUBCWUB", "output": "VSRNVEATZTLGQRFEGBFP AJ PQCHN C " }, { "input": "WUBWUBEWUBWUBWUBIQMJNIQWUBWUBWUBGZZBQZAUHYPWUBWUBWUBPMRWUBWUBWUBDCV", "output": "E IQMJNIQ GZZBQZAUHYP PMR DCV " }, { "input": "WUBWUBWUBFVWUBWUBWUBBPSWUBWUBWUBRXNETCJWUBWUBWUBJDMBHWUBWUBWUBBWUBWUBVWUBWUBB", "output": "FV BPS RXNETCJ JDMBH B V B " }, { "input": "WUBWUBWUBFBQWUBWUBWUBIDFSYWUBWUBWUBCTWDMWUBWUBWUBSXOWUBWUBWUBQIWUBWUBWUBL", "output": "FBQ IDFSY CTWDM SXO QI L " }, { "input": "IWUBWUBQLHDWUBYIIKZDFQWUBWUBWUBCXWUBWUBUWUBWUBWUBKWUBWUBWUBNL", "output": "I QLHD YIIKZDFQ CX U K NL " }, { "input": "KWUBUPDYXGOKUWUBWUBWUBAGOAHWUBIZDWUBWUBWUBIYWUBWUBWUBVWUBWUBWUBPWUBWUBWUBE", "output": "K UPDYXGOKU AGOAH IZD IY V P E " }, { "input": "WUBWUBOWUBWUBWUBIPVCQAFWYWUBWUBWUBQWUBWUBWUBXHDKCPYKCTWWYWUBWUBWUBVWUBWUBWUBFZWUBWUB", "output": "O IPVCQAFWY Q XHDKCPYKCTWWY V FZ " }, { "input": "PAMJGYWUBWUBWUBXGPQMWUBWUBWUBTKGSXUYWUBWUBWUBEWUBWUBWUBNWUBWUBWUBHWUBWUBWUBEWUBWUB", "output": "PAMJGY XGPQM TKGSXUY E N H E " }, { "input": "WUBYYRTSMNWUWUBWUBWUBCWUBWUBWUBCWUBWUBWUBFSYUINDWOBVWUBWUBWUBFWUBWUBWUBAUWUBWUBWUBVWUBWUBWUBJB", "output": "YYRTSMNWU C C FSYUINDWOBV F AU V JB " }, { "input": "WUBWUBYGPYEYBNRTFKOQCWUBWUBWUBUYGRTQEGWLFYWUBWUBWUBFVWUBHPWUBWUBWUBXZQWUBWUBWUBZDWUBWUBWUBM", "output": "YGPYEYBNRTFKOQC UYGRTQEGWLFY FV HP XZQ ZD M " }, { "input": "WUBZVMJWUBWUBWUBFOIMJQWKNZUBOFOFYCCWUBWUBWUBAUWWUBRDRADWUBWUBWUBCHQVWUBWUBWUBKFTWUBWUBWUBW", "output": "ZVMJ FOIMJQWKNZUBOFOFYCC AUW RDRAD CHQV KFT W " }, { "input": "WUBWUBZBKOKHQLGKRVIMZQMQNRWUBWUBWUBDACWUBWUBNZHFJMPEYKRVSWUBWUBWUBPPHGAVVPRZWUBWUBWUBQWUBWUBAWUBG", "output": "ZBKOKHQLGKRVIMZQMQNR DAC NZHFJMPEYKRVS PPHGAVVPRZ Q A G " }, { "input": "WUBWUBJWUBWUBWUBNFLWUBWUBWUBGECAWUBYFKBYJWTGBYHVSSNTINKWSINWSMAWUBWUBWUBFWUBWUBWUBOVWUBWUBLPWUBWUBWUBN", "output": "J NFL GECA YFKBYJWTGBYHVSSNTINKWSINWSMA F OV LP N " }, { "input": "WUBWUBLCWUBWUBWUBZGEQUEATJVIXETVTWUBWUBWUBEXMGWUBWUBWUBRSWUBWUBWUBVWUBWUBWUBTAWUBWUBWUBCWUBWUBWUBQG", "output": "LC ZGEQUEATJVIXETVT EXMG RS V TA C QG " }, { "input": "WUBMPWUBWUBWUBORWUBWUBDLGKWUBWUBWUBVVZQCAAKVJTIKWUBWUBWUBTJLUBZJCILQDIFVZWUBWUBYXWUBWUBWUBQWUBWUBWUBLWUB", "output": "MP OR DLGK VVZQCAAKVJTIK TJLUBZJCILQDIFVZ YX Q L " }, { "input": "WUBNXOLIBKEGXNWUBWUBWUBUWUBGITCNMDQFUAOVLWUBWUBWUBAIJDJZJHFMPVTPOXHPWUBWUBWUBISCIOWUBWUBWUBGWUBWUBWUBUWUB", "output": "NXOLIBKEGXN U GITCNMDQFUAOVL AIJDJZJHFMPVTPOXHP ISCIO G U " }, { "input": "WUBWUBNMMWCZOLYPNBELIYVDNHJUNINWUBWUBWUBDXLHYOWUBWUBWUBOJXUWUBWUBWUBRFHTGJCEFHCGWARGWUBWUBWUBJKWUBWUBSJWUBWUB", "output": "NMMWCZOLYPNBELIYVDNHJUNIN DXLHYO OJXU RFHTGJCEFHCGWARG JK SJ " }, { "input": "SGWLYSAUJOJBNOXNWUBWUBWUBBOSSFWKXPDPDCQEWUBWUBWUBDIRZINODWUBWUBWUBWWUBWUBWUBPPHWUBWUBWUBRWUBWUBWUBQWUBWUBWUBJWUB", "output": "SGWLYSAUJOJBNOXN BOSSFWKXPDPDCQE DIRZINOD W PPH R Q J " }, { "input": "TOWUBWUBWUBGBTBNWUBWUBWUBJVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSAWUBWUBWUBSWUBWUBWUBTOLVXWUBWUBWUBNHWUBWUBWUBO", "output": "TO GBTBN JVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSA S TOLVX NH O " }, { "input": "WUBWUBWSPLAYSZSAUDSWUBWUBWUBUWUBWUBWUBKRWUBWUBWUBRSOKQMZFIYZQUWUBWUBWUBELSHUWUBWUBWUBUKHWUBWUBWUBQXEUHQWUBWUBWUBBWUBWUBWUBR", "output": "WSPLAYSZSAUDS U KR RSOKQMZFIYZQU ELSHU UKH QXEUHQ B R " }, { "input": "WUBXEMWWVUHLSUUGRWUBWUBWUBAWUBXEGILZUNKWUBWUBWUBJDHHKSWUBWUBWUBDTSUYSJHWUBWUBWUBPXFWUBMOHNJWUBWUBWUBZFXVMDWUBWUBWUBZMWUBWUB", "output": "XEMWWVUHLSUUGR A XEGILZUNK JDHHKS DTSUYSJH PXF MOHNJ ZFXVMD ZM " }, { "input": "BMBWUBWUBWUBOQKWUBWUBWUBPITCIHXHCKLRQRUGXJWUBWUBWUBVWUBWUBWUBJCWUBWUBWUBQJPWUBWUBWUBBWUBWUBWUBBMYGIZOOXWUBWUBWUBTAGWUBWUBHWUB", "output": "BMB OQK PITCIHXHCKLRQRUGXJ V JC QJP B BMYGIZOOX TAG H " }, { "input": "CBZNWUBWUBWUBNHWUBWUBWUBYQSYWUBWUBWUBMWUBWUBWUBXRHBTMWUBWUBWUBPCRCWUBWUBWUBTZUYLYOWUBWUBWUBCYGCWUBWUBWUBCLJWUBWUBWUBSWUBWUBWUB", "output": "CBZN NH YQSY M XRHBTM PCRC TZUYLYO CYGC CLJ S " }, { "input": "DPDWUBWUBWUBEUQKWPUHLTLNXHAEKGWUBRRFYCAYZFJDCJLXBAWUBWUBWUBHJWUBOJWUBWUBWUBNHBJEYFWUBWUBWUBRWUBWUBWUBSWUBWWUBWUBWUBXDWUBWUBWUBJWUB", "output": "DPD EUQKWPUHLTLNXHAEKG RRFYCAYZFJDCJLXBA HJ OJ NHBJEYF R S W XD J " }, { "input": "WUBWUBWUBISERPQITVIYERSCNWUBWUBWUBQWUBWUBWUBDGSDIPWUBWUBWUBCAHKDZWEXBIBJVVSKKVQJWUBWUBWUBKIWUBWUBWUBCWUBWUBWUBAWUBWUBWUBPWUBWUBWUBHWUBWUBWUBF", "output": "ISERPQITVIYERSCN Q DGSDIP CAHKDZWEXBIBJVVSKKVQJ KI C A P H F " }, { "input": "WUBWUBWUBIWUBWUBLIKNQVWUBWUBWUBPWUBWUBWUBHWUBWUBWUBMWUBWUBWUBDPRSWUBWUBWUBBSAGYLQEENWXXVWUBWUBWUBXMHOWUBWUBWUBUWUBWUBWUBYRYWUBWUBWUBCWUBWUBWUBY", "output": "I LIKNQV P H M DPRS BSAGYLQEENWXXV XMHO U YRY C Y " }, { "input": "WUBWUBWUBMWUBWUBWUBQWUBWUBWUBITCFEYEWUBWUBWUBHEUWGNDFNZGWKLJWUBWUBWUBMZPWUBWUBWUBUWUBWUBWUBBWUBWUBWUBDTJWUBHZVIWUBWUBWUBPWUBFNHHWUBWUBWUBVTOWUB", "output": "M Q ITCFEYE HEUWGNDFNZGWKLJ MZP U B DTJ HZVI P FNHH VTO " }, { "input": "WUBWUBNDNRFHYJAAUULLHRRDEDHYFSRXJWUBWUBWUBMUJVDTIRSGYZAVWKRGIFWUBWUBWUBHMZWUBWUBWUBVAIWUBWUBWUBDDKJXPZRGWUBWUBWUBSGXWUBWUBWUBIFKWUBWUBWUBUWUBWUBWUBW", "output": "NDNRFHYJAAUULLHRRDEDHYFSRXJ MUJVDTIRSGYZAVWKRGIF HMZ VAI DDKJXPZRG SGX IFK U W " }, { "input": "WUBOJMWRSLAXXHQRTPMJNCMPGWUBWUBWUBNYGMZIXNLAKSQYWDWUBWUBWUBXNIWUBWUBWUBFWUBWUBWUBXMBWUBWUBWUBIWUBWUBWUBINWUBWUBWUBWDWUBWUBWUBDDWUBWUBWUBD", "output": "OJMWRSLAXXHQRTPMJNCMPG NYGMZIXNLAKSQYWD XNI F XMB I IN WD DD D " }, { "input": "WUBWUBWUBREHMWUBWUBWUBXWUBWUBWUBQASNWUBWUBWUBNLSMHLCMTICWUBWUBWUBVAWUBWUBWUBHNWUBWUBWUBNWUBWUBWUBUEXLSFOEULBWUBWUBWUBXWUBWUBWUBJWUBWUBWUBQWUBWUBWUBAWUBWUB", "output": "REHM X QASN NLSMHLCMTIC VA HN N UEXLSFOEULB X J Q A " }, { "input": "WUBWUBWUBSTEZTZEFFIWUBWUBWUBSWUBWUBWUBCWUBFWUBHRJPVWUBWUBWUBDYJUWUBWUBWUBPWYDKCWUBWUBWUBCWUBWUBWUBUUEOGCVHHBWUBWUBWUBEXLWUBWUBWUBVCYWUBWUBWUBMWUBWUBWUBYWUB", "output": "STEZTZEFFI S C F HRJPV DYJU PWYDKC C UUEOGCVHHB EXL VCY M Y " }, { "input": "WPPNMSQOQIWUBWUBWUBPNQXWUBWUBWUBHWUBWUBWUBNFLWUBWUBWUBGWSGAHVJFNUWUBWUBWUBFWUBWUBWUBWCMLRICFSCQQQTNBWUBWUBWUBSWUBWUBWUBKGWUBWUBWUBCWUBWUBWUBBMWUBWUBWUBRWUBWUB", "output": "WPPNMSQOQI PNQX H NFL GWSGAHVJFNU F WCMLRICFSCQQQTNB S KG C BM R " }, { "input": "YZJOOYITZRARKVFYWUBWUBRZQGWUBWUBWUBUOQWUBWUBWUBIWUBWUBWUBNKVDTBOLETKZISTWUBWUBWUBWLWUBQQFMMGSONZMAWUBZWUBWUBWUBQZUXGCWUBWUBWUBIRZWUBWUBWUBLTTVTLCWUBWUBWUBY", "output": "YZJOOYITZRARKVFY RZQG UOQ I NKVDTBOLETKZIST WL QQFMMGSONZMA Z QZUXGC IRZ LTTVTLC Y " }, { "input": "WUBCAXNCKFBVZLGCBWCOAWVWOFKZVQYLVTWUBWUBWUBNLGWUBWUBWUBAMGDZBDHZMRMQMDLIRMIWUBWUBWUBGAJSHTBSWUBWUBWUBCXWUBWUBWUBYWUBZLXAWWUBWUBWUBOHWUBWUBWUBZWUBWUBWUBGBWUBWUBWUBE", "output": "CAXNCKFBVZLGCBWCOAWVWOFKZVQYLVT NLG AMGDZBDHZMRMQMDLIRMI GAJSHTBS CX Y ZLXAW OH Z GB E " }, { "input": "WUBWUBCHXSOWTSQWUBWUBWUBCYUZBPBWUBWUBWUBSGWUBWUBWKWORLRRLQYUUFDNWUBWUBWUBYYGOJNEVEMWUBWUBWUBRWUBWUBWUBQWUBWUBWUBIHCKWUBWUBWUBKTWUBWUBWUBRGSNTGGWUBWUBWUBXCXWUBWUBWUBS", "output": "CHXSOWTSQ CYUZBPB SG WKWORLRRLQYUUFDN YYGOJNEVEM R Q IHCK KT RGSNTGG XCX S " }, { "input": "WUBWUBWUBHJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQWUBWUBWUBXTZKGIITWUBWUBWUBAWUBWUBWUBVNCXPUBCQWUBWUBWUBIDPNAWUBWUBWUBOWUBWUBWUBYGFWUBWUBWUBMQOWUBWUBWUBKWUBWUBWUBAZVWUBWUBWUBEP", "output": "HJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQ XTZKGIIT A VNCXPUBCQ IDPNA O YGF MQO K AZV EP " }, { "input": "WUBKYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTVWUBWUBWUBLRMIIWUBWUBWUBGWUBWUBWUBADPSWUBWUBWUBANBWUBWUBPCWUBWUBWUBPWUBWUBWUBGPVNLSWIRFORYGAABUXMWUBWUBWUBOWUBWUBWUBNWUBWUBWUBYWUBWUB", "output": "KYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTV LRMII G ADPS ANB PC P GPVNLSWIRFORYGAABUXM O N Y " }, { "input": "REWUBWUBWUBJDWUBWUBWUBNWUBWUBWUBTWWUBWUBWUBWZDOCKKWUBWUBWUBLDPOVBFRCFWUBWUBAKZIBQKEUAZEEWUBWUBWUBLQYPNPFWUBYEWUBWUBWUBFWUBWUBWUBBPWUBWUBWUBAWWUBWUBWUBQWUBWUBWUBBRWUBWUBWUBXJL", "output": "RE JD N TW WZDOCKK LDPOVBFRCF AKZIBQKEUAZEE LQYPNPF YE F BP AW Q BR XJL " }, { "input": "CUFGJDXGMWUBWUBWUBOMWUBWUBWUBSIEWUBWUBWUBJJWKNOWUBWUBWUBYBHVNRNORGYWUBWUBWUBOAGCAWUBWUBWUBSBLBKTPFKPBIWUBWUBWUBJBWUBWUBWUBRMFCJPGWUBWUBWUBDWUBWUBWUBOJOWUBWUBWUBZPWUBWUBWUBMWUBRWUBWUBWUBFXWWUBWUBWUBO", "output": "CUFGJDXGM OM SIE JJWKNO YBHVNRNORGY OAGCA SBLBKTPFKPBI JB RMFCJPG D OJO ZP M R FXW O " }, { "input": "WUBJZGAEXFMFEWMAKGQLUWUBWUBWUBICYTPQWGENELVYWANKUOJYWUBWUBWUBGWUBWUBWUBHYCJVLPHTUPNEGKCDGQWUBWUBWUBOFWUBWUBWUBCPGSOGZBRPRPVJJEWUBWUBWUBDQBCWUBWUBWUBHWUBWUBWUBMHOHYBMATWUBWUBWUBVWUBWUBWUBSWUBWUBWUBKOWU", "output": "JZGAEXFMFEWMAKGQLU ICYTPQWGENELVYWANKUOJY G HYCJVLPHTUPNEGKCDGQ OF CPGSOGZBRPRPVJJE DQBC H MHOHYBMAT V S KOWU " }, { "input": "A", "output": "A " }, { "input": "WUBA", "output": "A " }, { "input": "WUBWUBA", "output": "A " }, { "input": "AWUBWUBWUB", "output": "A " }, { "input": "AWUBBWUBCWUBD", "output": "A B C D " }, { "input": "WUBWWUBWUBWUBUWUBWUBBWUB", "output": "W U B " }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA " }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAWUBAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA " }, { "input": "WUWUBBWWUBUB", "output": "WU BW UB " }, { "input": "WUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUABWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUB", "output": "WUAB " }, { "input": "ZWUB", "output": "Z " }, { "input": "WU", "output": "WU " }, { "input": "UB", "output": "UB " }, { "input": "U", "output": "U " }, { "input": "WUBW", "output": "W " }, { "input": "WUBWU", "output": "WU " }, { "input": "WUWUB", "output": "WU " }, { "input": "UBWUB", "output": "UB " }, { "input": "WUWUBUBWUBUWUB", "output": "WU UB U " }, { "input": "WUBWWUBAWUB", "output": "W A " }, { "input": "WUUUUU", "output": "WUUUUU " } ]
1,686,161,266
2,147,483,647
Python 3
OK
TESTS
71
92
0
s=input() flag=True i=0 while i<len(s): if s[i:i+3]=='WUB': i=i+3 if not flag: print(' ',end='') else: print(s[i],end='') i=i+1 flag=False
Title: Dubstep Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them. Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club. For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX". Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song. Input Specification: The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word. Output Specification: Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space. Demo Input: ['WUBWUBABCWUB\n', 'WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n'] Demo Output: ['ABC ', 'WE ARE THE CHAMPIONS MY FRIEND '] Note: In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya. In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
```python s=input() flag=True i=0 while i<len(s): if s[i:i+3]=='WUB': i=i+3 if not flag: print(' ',end='') else: print(s[i],end='') i=i+1 flag=False ```
3
535
B
Tavas and SaDDas
PROGRAMMING
1,100
[ "bitmasks", "brute force", "combinatorics", "implementation" ]
null
null
Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you." The problem is: You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. If we sort all lucky numbers in increasing order, what's the 1-based index of *n*? Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back.
The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109).
Print the index of *n* among all lucky numbers.
[ "4\n", "7\n", "77\n" ]
[ "1\n", "2\n", "6\n" ]
none
1,000
[ { "input": "4", "output": "1" }, { "input": "7", "output": "2" }, { "input": "77", "output": "6" }, { "input": "4", "output": "1" }, { "input": "474744", "output": "83" }, { "input": "777774", "output": "125" }, { "input": "447", "output": "8" }, { "input": "774", "output": "13" }, { "input": "4", "output": "1" }, { "input": "4447747", "output": "140" }, { "input": "7747474", "output": "233" }, { "input": "4444", "output": "15" }, { "input": "4447", "output": "16" }, { "input": "7", "output": "2" }, { "input": "4", "output": "1" }, { "input": "4447744", "output": "139" }, { "input": "77474", "output": "57" }, { "input": "7747", "output": "28" }, { "input": "444", "output": "7" }, { "input": "7", "output": "2" }, { "input": "7774477", "output": "242" }, { "input": "4477774", "output": "157" }, { "input": "7444", "output": "23" }, { "input": "7474747", "output": "212" }, { "input": "77", "output": "6" }, { "input": "774477", "output": "114" }, { "input": "7", "output": "2" }, { "input": "47", "output": "4" }, { "input": "747777", "output": "110" }, { "input": "444444444", "output": "511" }, { "input": "777777777", "output": "1022" }, { "input": "477477447", "output": "728" }, { "input": "777744747", "output": "996" } ]
1,668,196,776
2,147,483,647
Python 3
OK
TESTS
33
46
0
def main(): str_input = input() ret = 1 for character in str_input: ret = 2 * ret if character == '7': ret += 1 print(ret - 1) if __name__ == '__main__': main()
Title: Tavas and SaDDas Time Limit: None seconds Memory Limit: None megabytes Problem Description: Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you." The problem is: You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. If we sort all lucky numbers in increasing order, what's the 1-based index of *n*? Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back. Input Specification: The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109). Output Specification: Print the index of *n* among all lucky numbers. Demo Input: ['4\n', '7\n', '77\n'] Demo Output: ['1\n', '2\n', '6\n'] Note: none
```python def main(): str_input = input() ret = 1 for character in str_input: ret = 2 * ret if character == '7': ret += 1 print(ret - 1) if __name__ == '__main__': main() ```
3
938
A
Word Correction
PROGRAMMING
800
[ "implementation" ]
null
null
Victor tries to write his own text editor, with word correction included. However, the rules of word correction are really strange. Victor thinks that if a word contains two consecutive vowels, then it's kinda weird and it needs to be replaced. So the word corrector works in such a way: as long as there are two consecutive vowels in the word, it deletes the first vowel in a word such that there is another vowel right before it. If there are no two consecutive vowels in the word, it is considered to be correct. You are given a word *s*. Can you predict what will it become after correction? In this problem letters a, e, i, o, u and y are considered to be vowels.
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of letters in word *s* before the correction. The second line contains a string *s* consisting of exactly *n* lowercase Latin letters — the word before the correction.
Output the word *s* after the correction.
[ "5\nweird\n", "4\nword\n", "5\naaeaa\n" ]
[ "werd\n", "word\n", "a\n" ]
Explanations of the examples: 1. There is only one replace: weird <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> werd;1. No replace needed since there are no two consecutive vowels;1. aaeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> a.
0
[ { "input": "5\nweird", "output": "werd" }, { "input": "4\nword", "output": "word" }, { "input": "5\naaeaa", "output": "a" }, { "input": "100\naaaaabbbbboyoyoyoyoyacadabbbbbiuiufgiuiuaahjabbbklboyoyoyoyoyaaaaabbbbbiuiuiuiuiuaaaaabbbbbeyiyuyzyw", "output": "abbbbbocadabbbbbifgihjabbbklbobbbbbibbbbbezyw" }, { "input": "69\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb", "output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb" }, { "input": "12\nmmmmmmmmmmmm", "output": "mmmmmmmmmmmm" }, { "input": "18\nyaywptqwuyiqypwoyw", "output": "ywptqwuqypwow" }, { "input": "85\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb", "output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb" }, { "input": "13\nmmmmmmmmmmmmm", "output": "mmmmmmmmmmmmm" }, { "input": "10\nmmmmmmmmmm", "output": "mmmmmmmmmm" }, { "input": "11\nmmmmmmmmmmm", "output": "mmmmmmmmmmm" }, { "input": "15\nmmmmmmmmmmmmmmm", "output": "mmmmmmmmmmmmmmm" }, { "input": "1\na", "output": "a" }, { "input": "14\nmmmmmmmmmmmmmm", "output": "mmmmmmmmmmmmmm" }, { "input": "33\nmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm", "output": "mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm" }, { "input": "79\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb", "output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb" }, { "input": "90\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb", "output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb" }, { "input": "2\naa", "output": "a" }, { "input": "18\niuiuqpyyaoaetiwliu", "output": "iqpytiwli" }, { "input": "5\nxxxxx", "output": "xxxxx" }, { "input": "6\nxxxahg", "output": "xxxahg" }, { "input": "3\nzcv", "output": "zcv" }, { "input": "4\naepo", "output": "apo" }, { "input": "5\nqqqqq", "output": "qqqqq" }, { "input": "6\naaaaaa", "output": "a" }, { "input": "4\naeta", "output": "ata" }, { "input": "20\nttyttlwaoieulyiluuri", "output": "ttyttlwalyluri" }, { "input": "1\nb", "output": "b" }, { "input": "3\nanc", "output": "anc" }, { "input": "1\ne", "output": "e" }, { "input": "3\naie", "output": "a" }, { "input": "3\nvio", "output": "vi" }, { "input": "2\nea", "output": "e" }, { "input": "3\nuas", "output": "us" }, { "input": "2\nba", "output": "ba" }, { "input": "2\naq", "output": "aq" }, { "input": "2\nya", "output": "y" }, { "input": "2\nou", "output": "o" }, { "input": "2\nbb", "output": "bb" }, { "input": "7\nayylmao", "output": "alma" }, { "input": "2\nab", "output": "ab" }, { "input": "19\nyuouiyaoiiweqrryqqp", "output": "yweqrryqqp" }, { "input": "25\niqypwqpriiioetiuqqqttouei", "output": "iqypwqpritiqqqtto" }, { "input": "100\naaaaabbbbboyoyoyoyoyacadabbbbbiuiufgiuiuaahjabbbklboyoyoyoyoyaaaaabbbbbiuiuiuiuiuaaaaabbbbbeyiyuyzyz", "output": "abbbbbocadabbbbbifgihjabbbklbobbbbbibbbbbezyz" }, { "input": "17\naccccccccccccccca", "output": "accccccccccccccca" }, { "input": "5\nababa", "output": "ababa" }, { "input": "10\naaaaaaaaaa", "output": "a" }, { "input": "22\naaaaabbbbboyoyoyoyoyac", "output": "abbbbboc" }, { "input": "7\nmahmoud", "output": "mahmod" } ]
1,579,159,683
2,147,483,647
Python 3
OK
TESTS
49
109
0
n=int(input()) s=input() sm='' vl=list('aeiouy') cl=list('bcdfghjklmnpqrstvwxz') check=0 for i in s: if i in vl: if check==1: continue else: sm+=i check=1 else: sm+=i check=0 print(sm)
Title: Word Correction Time Limit: None seconds Memory Limit: None megabytes Problem Description: Victor tries to write his own text editor, with word correction included. However, the rules of word correction are really strange. Victor thinks that if a word contains two consecutive vowels, then it's kinda weird and it needs to be replaced. So the word corrector works in such a way: as long as there are two consecutive vowels in the word, it deletes the first vowel in a word such that there is another vowel right before it. If there are no two consecutive vowels in the word, it is considered to be correct. You are given a word *s*. Can you predict what will it become after correction? In this problem letters a, e, i, o, u and y are considered to be vowels. Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of letters in word *s* before the correction. The second line contains a string *s* consisting of exactly *n* lowercase Latin letters — the word before the correction. Output Specification: Output the word *s* after the correction. Demo Input: ['5\nweird\n', '4\nword\n', '5\naaeaa\n'] Demo Output: ['werd\n', 'word\n', 'a\n'] Note: Explanations of the examples: 1. There is only one replace: weird <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> werd;1. No replace needed since there are no two consecutive vowels;1. aaeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> a.
```python n=int(input()) s=input() sm='' vl=list('aeiouy') cl=list('bcdfghjklmnpqrstvwxz') check=0 for i in s: if i in vl: if check==1: continue else: sm+=i check=1 else: sm+=i check=0 print(sm) ```
3
148
A
Insomnia cure
PROGRAMMING
800
[ "constructive algorithms", "implementation", "math" ]
null
null
«One dragon. Two dragon. Three dragon», — the princess was counting. She had trouble falling asleep, and she got bored of counting lambs when she was nine. However, just counting dragons was boring as well, so she entertained herself at best she could. Tonight she imagined that all dragons were here to steal her, and she was fighting them off. Every *k*-th dragon got punched in the face with a frying pan. Every *l*-th dragon got his tail shut into the balcony door. Every *m*-th dragon got his paws trampled with sharp heels. Finally, she threatened every *n*-th dragon to call her mom, and he withdrew in panic. How many imaginary dragons suffered moral or physical damage tonight, if the princess counted a total of *d* dragons?
Input data contains integer numbers *k*,<=*l*,<=*m*,<=*n* and *d*, each number in a separate line (1<=≤<=*k*,<=*l*,<=*m*,<=*n*<=≤<=10, 1<=≤<=*d*<=≤<=105).
Output the number of damaged dragons.
[ "1\n2\n3\n4\n12\n", "2\n3\n4\n5\n24\n" ]
[ "12\n", "17\n" ]
In the first case every first dragon got punched with a frying pan. Some of the dragons suffered from other reasons as well, but the pan alone would be enough. In the second case dragons 1, 7, 11, 13, 17, 19 and 23 escaped unharmed.
1,000
[ { "input": "1\n2\n3\n4\n12", "output": "12" }, { "input": "2\n3\n4\n5\n24", "output": "17" }, { "input": "1\n1\n1\n1\n100000", "output": "100000" }, { "input": "10\n9\n8\n7\n6", "output": "0" }, { "input": "8\n4\n4\n3\n65437", "output": "32718" }, { "input": "8\n4\n1\n10\n59392", "output": "59392" }, { "input": "4\n1\n8\n7\n44835", "output": "44835" }, { "input": "6\n1\n7\n2\n62982", "output": "62982" }, { "input": "2\n7\n4\n9\n56937", "output": "35246" }, { "input": "2\n9\n8\n1\n75083", "output": "75083" }, { "input": "8\n7\n7\n6\n69038", "output": "24656" }, { "input": "4\n4\n2\n3\n54481", "output": "36320" }, { "input": "6\n4\n9\n8\n72628", "output": "28244" }, { "input": "9\n7\n8\n10\n42357", "output": "16540" }, { "input": "5\n6\n4\n3\n60504", "output": "36302" }, { "input": "7\n2\n3\n8\n21754", "output": "15539" }, { "input": "1\n2\n10\n4\n39901", "output": "39901" }, { "input": "3\n4\n7\n1\n58048", "output": "58048" }, { "input": "9\n10\n4\n6\n52003", "output": "21956" }, { "input": "5\n10\n9\n3\n70149", "output": "32736" }, { "input": "5\n5\n5\n10\n55592", "output": "11118" }, { "input": "1\n5\n2\n6\n49547", "output": "49547" }, { "input": "3\n7\n7\n7\n84046", "output": "36019" }, { "input": "10\n2\n1\n8\n63537", "output": "63537" }, { "input": "7\n2\n10\n5\n81684", "output": "53678" }, { "input": "7\n1\n6\n8\n99831", "output": "99831" }, { "input": "3\n9\n3\n3\n61082", "output": "20360" }, { "input": "5\n5\n8\n9\n79228", "output": "29931" }, { "input": "1\n5\n5\n6\n89535", "output": "89535" }, { "input": "5\n5\n2\n1\n7682", "output": "7682" }, { "input": "7\n4\n8\n8\n25829", "output": "9224" }, { "input": "3\n4\n3\n3\n87079", "output": "43539" }, { "input": "5\n8\n4\n9\n5226", "output": "2438" }, { "input": "4\n9\n6\n6\n1070", "output": "415" }, { "input": "10\n10\n10\n10\n100000", "output": "10000" }, { "input": "1\n1\n1\n1\n1", "output": "1" }, { "input": "10\n10\n10\n10\n1", "output": "0" }, { "input": "10\n10\n1\n10\n10", "output": "10" }, { "input": "10\n10\n1\n10\n100", "output": "100" }, { "input": "2\n2\n2\n2\n1", "output": "0" } ]
1,683,809,448
2,147,483,647
PyPy 3-64
OK
TESTS
40
124
0
from math import lcm k, l, m, n, d = map(int, [input() for _ in range(5)]) print(d // k + d // l + d // m + d // n - (d // lcm(k, l) + d // lcm(k, m) + d // lcm(k, n) + d // lcm(l, m) + d // lcm(l, n) + d // lcm(m, n)) + d // lcm(k, l, m) + d // lcm(k, l, n) + d // lcm(k, m, n) + d // lcm(l, m, n) - d // lcm(k, l, m, n))
Title: Insomnia cure Time Limit: None seconds Memory Limit: None megabytes Problem Description: «One dragon. Two dragon. Three dragon», — the princess was counting. She had trouble falling asleep, and she got bored of counting lambs when she was nine. However, just counting dragons was boring as well, so she entertained herself at best she could. Tonight she imagined that all dragons were here to steal her, and she was fighting them off. Every *k*-th dragon got punched in the face with a frying pan. Every *l*-th dragon got his tail shut into the balcony door. Every *m*-th dragon got his paws trampled with sharp heels. Finally, she threatened every *n*-th dragon to call her mom, and he withdrew in panic. How many imaginary dragons suffered moral or physical damage tonight, if the princess counted a total of *d* dragons? Input Specification: Input data contains integer numbers *k*,<=*l*,<=*m*,<=*n* and *d*, each number in a separate line (1<=≤<=*k*,<=*l*,<=*m*,<=*n*<=≤<=10, 1<=≤<=*d*<=≤<=105). Output Specification: Output the number of damaged dragons. Demo Input: ['1\n2\n3\n4\n12\n', '2\n3\n4\n5\n24\n'] Demo Output: ['12\n', '17\n'] Note: In the first case every first dragon got punched with a frying pan. Some of the dragons suffered from other reasons as well, but the pan alone would be enough. In the second case dragons 1, 7, 11, 13, 17, 19 and 23 escaped unharmed.
```python from math import lcm k, l, m, n, d = map(int, [input() for _ in range(5)]) print(d // k + d // l + d // m + d // n - (d // lcm(k, l) + d // lcm(k, m) + d // lcm(k, n) + d // lcm(l, m) + d // lcm(l, n) + d // lcm(m, n)) + d // lcm(k, l, m) + d // lcm(k, l, n) + d // lcm(k, m, n) + d // lcm(l, m, n) - d // lcm(k, l, m, n)) ```
3
994
A
Fingerprints
PROGRAMMING
800
[ "implementation" ]
null
null
You are locked in a room with a door that has a keypad with 10 keys corresponding to digits from 0 to 9. To escape from the room, you need to enter a correct code. You also have a sequence of digits. Some keys on the keypad have fingerprints. You believe the correct code is the longest not necessarily contiguous subsequence of the sequence you have that only contains digits with fingerprints on the corresponding keys. Find such code.
The first line contains two integers $n$ and $m$ ($1 \le n, m \le 10$) representing the number of digits in the sequence you have and the number of keys on the keypad that have fingerprints. The next line contains $n$ distinct space-separated integers $x_1, x_2, \ldots, x_n$ ($0 \le x_i \le 9$) representing the sequence. The next line contains $m$ distinct space-separated integers $y_1, y_2, \ldots, y_m$ ($0 \le y_i \le 9$) — the keys with fingerprints.
In a single line print a space-separated sequence of integers representing the code. If the resulting sequence is empty, both printing nothing and printing a single line break is acceptable.
[ "7 3\n3 5 7 1 6 2 8\n1 2 7\n", "4 4\n3 4 1 0\n0 1 7 9\n" ]
[ "7 1 2\n", "1 0\n" ]
In the first example, the only digits with fingerprints are $1$, $2$ and $7$. All three of them appear in the sequence you know, $7$ first, then $1$ and then $2$. Therefore the output is 7 1 2. Note that the order is important, and shall be the same as the order in the original sequence. In the second example digits $0$, $1$, $7$ and $9$ have fingerprints, however only $0$ and $1$ appear in the original sequence. $1$ appears earlier, so the output is 1 0. Again, the order is important.
500
[ { "input": "7 3\n3 5 7 1 6 2 8\n1 2 7", "output": "7 1 2" }, { "input": "4 4\n3 4 1 0\n0 1 7 9", "output": "1 0" }, { "input": "9 4\n9 8 7 6 5 4 3 2 1\n2 4 6 8", "output": "8 6 4 2" }, { "input": "10 5\n3 7 1 2 4 6 9 0 5 8\n4 3 0 7 9", "output": "3 7 4 9 0" }, { "input": "10 10\n1 2 3 4 5 6 7 8 9 0\n4 5 6 7 1 2 3 0 9 8", "output": "1 2 3 4 5 6 7 8 9 0" }, { "input": "1 1\n4\n4", "output": "4" }, { "input": "3 7\n6 3 4\n4 9 0 1 7 8 6", "output": "6 4" }, { "input": "10 1\n9 0 8 1 7 4 6 5 2 3\n0", "output": "0" }, { "input": "5 10\n6 0 3 8 1\n3 1 0 5 4 7 2 8 9 6", "output": "6 0 3 8 1" }, { "input": "8 2\n7 2 9 6 1 0 3 4\n6 3", "output": "6 3" }, { "input": "5 4\n7 0 1 4 9\n0 9 5 3", "output": "0 9" }, { "input": "10 1\n9 6 2 0 1 8 3 4 7 5\n6", "output": "6" }, { "input": "10 2\n7 1 0 2 4 6 5 9 3 8\n3 2", "output": "2 3" }, { "input": "5 9\n3 7 9 2 4\n3 8 4 5 9 6 1 0 2", "output": "3 9 2 4" }, { "input": "10 6\n7 1 2 3 8 0 6 4 5 9\n1 5 8 2 3 6", "output": "1 2 3 8 6 5" }, { "input": "8 2\n7 4 8 9 2 5 6 1\n6 4", "output": "4 6" }, { "input": "10 2\n1 0 3 5 8 9 4 7 6 2\n0 3", "output": "0 3" }, { "input": "7 6\n9 2 8 6 1 3 7\n4 2 0 3 1 8", "output": "2 8 1 3" }, { "input": "1 6\n3\n6 8 2 4 5 3", "output": "3" }, { "input": "1 8\n0\n9 2 4 8 1 5 0 7", "output": "0" }, { "input": "6 9\n7 3 9 4 1 0\n9 1 5 8 0 6 2 7 4", "output": "7 9 4 1 0" }, { "input": "10 2\n4 9 6 8 3 0 1 5 7 2\n0 1", "output": "0 1" }, { "input": "10 5\n5 2 8 0 9 7 6 1 4 3\n9 6 4 1 2", "output": "2 9 6 1 4" }, { "input": "6 3\n8 3 9 2 7 6\n5 4 3", "output": "3" }, { "input": "4 10\n8 3 9 6\n4 9 6 2 7 0 8 1 3 5", "output": "8 3 9 6" }, { "input": "1 2\n1\n1 0", "output": "1" }, { "input": "3 6\n1 2 3\n4 5 6 1 2 3", "output": "1 2 3" }, { "input": "1 2\n2\n1 2", "output": "2" }, { "input": "1 10\n9\n0 1 2 3 4 5 6 7 8 9", "output": "9" } ]
1,683,987,841
2,147,483,647
Python 3
OK
TESTS
31
46
0
n,m=input().split() l=input().split() m=input().split() r=[] for i in l: if i in m: r.append(i) print(*r)
Title: Fingerprints Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are locked in a room with a door that has a keypad with 10 keys corresponding to digits from 0 to 9. To escape from the room, you need to enter a correct code. You also have a sequence of digits. Some keys on the keypad have fingerprints. You believe the correct code is the longest not necessarily contiguous subsequence of the sequence you have that only contains digits with fingerprints on the corresponding keys. Find such code. Input Specification: The first line contains two integers $n$ and $m$ ($1 \le n, m \le 10$) representing the number of digits in the sequence you have and the number of keys on the keypad that have fingerprints. The next line contains $n$ distinct space-separated integers $x_1, x_2, \ldots, x_n$ ($0 \le x_i \le 9$) representing the sequence. The next line contains $m$ distinct space-separated integers $y_1, y_2, \ldots, y_m$ ($0 \le y_i \le 9$) — the keys with fingerprints. Output Specification: In a single line print a space-separated sequence of integers representing the code. If the resulting sequence is empty, both printing nothing and printing a single line break is acceptable. Demo Input: ['7 3\n3 5 7 1 6 2 8\n1 2 7\n', '4 4\n3 4 1 0\n0 1 7 9\n'] Demo Output: ['7 1 2\n', '1 0\n'] Note: In the first example, the only digits with fingerprints are $1$, $2$ and $7$. All three of them appear in the sequence you know, $7$ first, then $1$ and then $2$. Therefore the output is 7 1 2. Note that the order is important, and shall be the same as the order in the original sequence. In the second example digits $0$, $1$, $7$ and $9$ have fingerprints, however only $0$ and $1$ appear in the original sequence. $1$ appears earlier, so the output is 1 0. Again, the order is important.
```python n,m=input().split() l=input().split() m=input().split() r=[] for i in l: if i in m: r.append(i) print(*r) ```
3
214
A
System of Equations
PROGRAMMING
800
[ "brute force" ]
null
null
Furik loves math lessons very much, so he doesn't attend them, unlike Rubik. But now Furik wants to get a good mark for math. For that Ms. Ivanova, his math teacher, gave him a new task. Furik solved the task immediately. Can you? You are given a system of equations: You should count, how many there are pairs of integers (*a*,<=*b*) (0<=≤<=*a*,<=*b*) which satisfy the system.
A single line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the parameters of the system. The numbers on the line are separated by a space.
On a single line print the answer to the problem.
[ "9 3\n", "14 28\n", "4 20\n" ]
[ "1\n", "1\n", "0\n" ]
In the first sample the suitable pair is integers (3, 0). In the second sample the suitable pair is integers (3, 5). In the third sample there is no suitable pair.
500
[ { "input": "9 3", "output": "1" }, { "input": "14 28", "output": "1" }, { "input": "4 20", "output": "0" }, { "input": "18 198", "output": "1" }, { "input": "22 326", "output": "1" }, { "input": "26 104", "output": "1" }, { "input": "14 10", "output": "0" }, { "input": "8 20", "output": "0" }, { "input": "2 8", "output": "0" }, { "input": "20 11", "output": "0" }, { "input": "57 447", "output": "1" }, { "input": "1 1", "output": "2" }, { "input": "66 296", "output": "1" }, { "input": "75 683", "output": "1" }, { "input": "227 975", "output": "1" }, { "input": "247 499", "output": "1" }, { "input": "266 116", "output": "1" }, { "input": "286 916", "output": "1" }, { "input": "307 341", "output": "1" }, { "input": "451 121", "output": "1" }, { "input": "471 921", "output": "1" }, { "input": "502 346", "output": "1" }, { "input": "535 59", "output": "1" }, { "input": "555 699", "output": "1" }, { "input": "747 351", "output": "1" }, { "input": "790 64", "output": "1" }, { "input": "810 704", "output": "1" }, { "input": "855 225", "output": "1" }, { "input": "902 34", "output": "1" }, { "input": "922 514", "output": "1" }, { "input": "971 131", "output": "1" }, { "input": "991 931", "output": "1" }, { "input": "840 780", "output": "0" }, { "input": "102 595", "output": "0" }, { "input": "139 433", "output": "0" }, { "input": "968 288", "output": "0" }, { "input": "563 354", "output": "0" }, { "input": "994 975", "output": "0" }, { "input": "456 221", "output": "0" }, { "input": "205 210", "output": "0" }, { "input": "1 11", "output": "0" }, { "input": "1000 1000", "output": "0" }, { "input": "3 3", "output": "0" }, { "input": "11 99", "output": "0" }, { "input": "2 2", "output": "1" }, { "input": "11 1", "output": "0" }, { "input": "6 6", "output": "1" }, { "input": "100 452", "output": "0" }, { "input": "420 380", "output": "0" }, { "input": "31 31", "output": "0" }, { "input": "2 6", "output": "0" }, { "input": "112 134", "output": "0" }, { "input": "13 13", "output": "0" }, { "input": "1 571", "output": "0" } ]
1,643,887,463
2,147,483,647
Python 3
OK
TESTS
54
92
0
n, m = map(int, input().split()) answer = 0 a = 0 while a*a <= n and a <= m: b = n - a*a if (a + b*b) == m: answer += 1 a += 1 print(answer)
Title: System of Equations Time Limit: None seconds Memory Limit: None megabytes Problem Description: Furik loves math lessons very much, so he doesn't attend them, unlike Rubik. But now Furik wants to get a good mark for math. For that Ms. Ivanova, his math teacher, gave him a new task. Furik solved the task immediately. Can you? You are given a system of equations: You should count, how many there are pairs of integers (*a*,<=*b*) (0<=≤<=*a*,<=*b*) which satisfy the system. Input Specification: A single line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the parameters of the system. The numbers on the line are separated by a space. Output Specification: On a single line print the answer to the problem. Demo Input: ['9 3\n', '14 28\n', '4 20\n'] Demo Output: ['1\n', '1\n', '0\n'] Note: In the first sample the suitable pair is integers (3, 0). In the second sample the suitable pair is integers (3, 5). In the third sample there is no suitable pair.
```python n, m = map(int, input().split()) answer = 0 a = 0 while a*a <= n and a <= m: b = n - a*a if (a + b*b) == m: answer += 1 a += 1 print(answer) ```
3
43
A
Football
PROGRAMMING
1,000
[ "strings" ]
A. Football
2
256
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
[ "1\nABC\n", "5\nA\nABA\nABA\nA\nA\n" ]
[ "ABC\n", "A\n" ]
none
500
[ { "input": "1\nABC", "output": "ABC" }, { "input": "5\nA\nABA\nABA\nA\nA", "output": "A" }, { "input": "2\nXTSJEP\nXTSJEP", "output": "XTSJEP" }, { "input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ", "output": "XZYDJAEDZ" }, { "input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD", "output": "QCCYXL" }, { "input": "3\nAZID\nEERWBC\nEERWBC", "output": "EERWBC" }, { "input": "3\nHNCGYL\nHNCGYL\nHNCGYL", "output": "HNCGYL" }, { "input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG", "output": "ZZWZTG" }, { "input": "4\nA\nA\nKUDLJMXCSE\nA", "output": "A" }, { "input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW", "output": "PHBTW" }, { "input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN", "output": "PKUZYTFYWN" }, { "input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH", "output": "HH" }, { "input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW", "output": "W" }, { "input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP", "output": "XBCP" }, { "input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS", "output": "PYPAS" }, { "input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC", "output": "NC" }, { "input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI", "output": "VOCI" }, { "input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA", "output": "HA" }, { "input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS", "output": "G" }, { "input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL", "output": "WL" } ]
1,686,146,568
2,147,483,647
Python 3
OK
TESTS
34
92
0
d = {} c = 0 res = '' for i in [*open(0)][1:]: if i[-1] =='\n': i = i[:-1] if i in d.keys(): d[i]+=1 else: d[i]=1 if d[i] > c: c = d[i] res = i print(res)
Title: Football Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams. Output Specification: Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner. Demo Input: ['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n'] Demo Output: ['ABC\n', 'A\n'] Note: none
```python d = {} c = 0 res = '' for i in [*open(0)][1:]: if i[-1] =='\n': i = i[:-1] if i in d.keys(): d[i]+=1 else: d[i]=1 if d[i] > c: c = d[i] res = i print(res) ```
3.977
25
A
IQ test
PROGRAMMING
1,300
[ "brute force" ]
A. IQ test
2
256
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
[ "5\n2 4 7 8 10\n", "4\n1 2 1 1\n" ]
[ "3\n", "2\n" ]
none
0
[ { "input": "5\n2 4 7 8 10", "output": "3" }, { "input": "4\n1 2 1 1", "output": "2" }, { "input": "3\n1 2 2", "output": "1" }, { "input": "3\n100 99 100", "output": "2" }, { "input": "3\n5 3 2", "output": "3" }, { "input": "4\n43 28 1 91", "output": "2" }, { "input": "4\n75 13 94 77", "output": "3" }, { "input": "4\n97 8 27 3", "output": "2" }, { "input": "10\n95 51 12 91 85 3 1 31 25 7", "output": "3" }, { "input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46", "output": "4" }, { "input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36", "output": "26" }, { "input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83", "output": "48" }, { "input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25", "output": "1" }, { "input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46", "output": "25" }, { "input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73", "output": "13" }, { "input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76", "output": "99" }, { "input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14", "output": "1" }, { "input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22", "output": "93" }, { "input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23", "output": "1" }, { "input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98", "output": "1" }, { "input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94", "output": "93" }, { "input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29", "output": "32" }, { "input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47", "output": "26" }, { "input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72", "output": "56" }, { "input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86", "output": "97" }, { "input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42", "output": "79" }, { "input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52", "output": "25" }, { "input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86", "output": "78" }, { "input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68", "output": "70" }, { "input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81", "output": "39" }, { "input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83", "output": "88" }, { "input": "3\n100 100 1", "output": "3" } ]
1,658,890,989
2,147,483,647
Python 3
OK
TESTS
32
92
0
x = int(input()) nums = list(map(int, input().split())) odds = [] evens = [] for i in range(x): if nums[i] % 2 == 0: evens.append(nums[i]) else: odds.append(nums[i]) if len(evens) == 1: print(nums.index(evens[0]) + 1) else: print(nums.index(odds[0]) + 1)
Title: IQ test Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness. Input Specification: The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness. Output Specification: Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order. Demo Input: ['5\n2 4 7 8 10\n', '4\n1 2 1 1\n'] Demo Output: ['3\n', '2\n'] Note: none
```python x = int(input()) nums = list(map(int, input().split())) odds = [] evens = [] for i in range(x): if nums[i] % 2 == 0: evens.append(nums[i]) else: odds.append(nums[i]) if len(evens) == 1: print(nums.index(evens[0]) + 1) else: print(nums.index(odds[0]) + 1) ```
3.977
405
A
Gravity Flip
PROGRAMMING
900
[ "greedy", "implementation", "sortings" ]
null
null
Little Chris is bored during his physics lessons (too easy), so he has built a toy box to keep himself occupied. The box is special, since it has the ability to change gravity. There are *n* columns of toy cubes in the box arranged in a line. The *i*-th column contains *a**i* cubes. At first, the gravity in the box is pulling the cubes downwards. When Chris switches the gravity, it begins to pull all the cubes to the right side of the box. The figure shows the initial and final configurations of the cubes in the box: the cubes that have changed their position are highlighted with orange. Given the initial configuration of the toy cubes in the box, find the amounts of cubes in each of the *n* columns after the gravity switch!
The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=100), the number of the columns in the box. The next line contains *n* space-separated integer numbers. The *i*-th number *a**i* (1<=≤<=*a**i*<=≤<=100) denotes the number of cubes in the *i*-th column.
Output *n* integer numbers separated by spaces, where the *i*-th number is the amount of cubes in the *i*-th column after the gravity switch.
[ "4\n3 2 1 2\n", "3\n2 3 8\n" ]
[ "1 2 2 3 \n", "2 3 8 \n" ]
The first example case is shown on the figure. The top cube of the first column falls to the top of the last column; the top cube of the second column falls to the top of the third column; the middle cube of the first column falls to the top of the second column. In the second example case the gravity switch does not change the heights of the columns.
500
[ { "input": "4\n3 2 1 2", "output": "1 2 2 3 " }, { "input": "3\n2 3 8", "output": "2 3 8 " }, { "input": "5\n2 1 2 1 2", "output": "1 1 2 2 2 " }, { "input": "1\n1", "output": "1 " }, { "input": "2\n4 3", "output": "3 4 " }, { "input": "6\n100 40 60 20 1 80", "output": "1 20 40 60 80 100 " }, { "input": "10\n10 8 6 7 5 3 4 2 9 1", "output": "1 2 3 4 5 6 7 8 9 10 " }, { "input": "10\n1 2 3 4 5 6 7 8 9 10", "output": "1 2 3 4 5 6 7 8 9 10 " }, { "input": "100\n82 51 81 14 37 17 78 92 64 15 8 86 89 8 87 77 66 10 15 12 100 25 92 47 21 78 20 63 13 49 41 36 41 79 16 87 87 69 3 76 80 60 100 49 70 59 72 8 38 71 45 97 71 14 76 54 81 4 59 46 39 29 92 3 49 22 53 99 59 52 74 31 92 43 42 23 44 9 82 47 7 40 12 9 3 55 37 85 46 22 84 52 98 41 21 77 63 17 62 91", "output": "3 3 3 4 7 8 8 8 9 9 10 12 12 13 14 14 15 15 16 17 17 20 21 21 22 22 23 25 29 31 36 37 37 38 39 40 41 41 41 42 43 44 45 46 46 47 47 49 49 49 51 52 52 53 54 55 59 59 59 60 62 63 63 64 66 69 70 71 71 72 74 76 76 77 77 78 78 79 80 81 81 82 82 84 85 86 87 87 87 89 91 92 92 92 92 97 98 99 100 100 " }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 " }, { "input": "10\n1 9 7 6 2 4 7 8 1 3", "output": "1 1 2 3 4 6 7 7 8 9 " }, { "input": "20\n53 32 64 20 41 97 50 20 66 68 22 60 74 61 97 54 80 30 72 59", "output": "20 20 22 30 32 41 50 53 54 59 60 61 64 66 68 72 74 80 97 97 " }, { "input": "30\n7 17 4 18 16 12 14 10 1 13 2 16 13 17 8 16 13 14 9 17 17 5 13 5 1 7 6 20 18 12", "output": "1 1 2 4 5 5 6 7 7 8 9 10 12 12 13 13 13 13 14 14 16 16 16 17 17 17 17 18 18 20 " }, { "input": "40\n22 58 68 58 48 53 52 1 16 78 75 17 63 15 36 32 78 75 49 14 42 46 66 54 49 82 40 43 46 55 12 73 5 45 61 60 1 11 31 84", "output": "1 1 5 11 12 14 15 16 17 22 31 32 36 40 42 43 45 46 46 48 49 49 52 53 54 55 58 58 60 61 63 66 68 73 75 75 78 78 82 84 " }, { "input": "70\n1 3 3 1 3 3 1 1 1 3 3 2 3 3 1 1 1 2 3 1 3 2 3 3 3 2 2 3 1 3 3 2 1 1 2 1 2 1 2 2 1 1 1 3 3 2 3 2 3 2 3 3 2 2 2 3 2 3 3 3 1 1 3 3 1 1 1 1 3 1", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 " }, { "input": "90\n17 75 51 30 100 5 50 95 51 73 66 5 7 76 43 49 23 55 3 24 95 79 10 11 44 93 17 99 53 66 82 66 63 76 19 4 51 71 75 43 27 5 24 19 48 7 91 15 55 21 7 6 27 10 2 91 64 58 18 21 16 71 90 88 21 20 6 6 95 85 11 7 40 65 52 49 92 98 46 88 17 48 85 96 77 46 100 34 67 52", "output": "2 3 4 5 5 5 6 6 6 7 7 7 7 10 10 11 11 15 16 17 17 17 18 19 19 20 21 21 21 23 24 24 27 27 30 34 40 43 43 44 46 46 48 48 49 49 50 51 51 51 52 52 53 55 55 58 63 64 65 66 66 66 67 71 71 73 75 75 76 76 77 79 82 85 85 88 88 90 91 91 92 93 95 95 95 96 98 99 100 100 " }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 " }, { "input": "100\n1 1 1 1 2 1 1 1 1 1 2 2 1 1 2 1 2 1 1 1 2 1 1 2 1 2 1 1 2 2 2 1 1 2 1 1 1 2 2 2 1 1 1 2 1 2 2 1 2 1 1 2 2 1 2 1 2 1 2 2 1 1 1 2 1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 1 1 1 1 2 2 2 2 2 2 2 1 1 1 2 1 2 1", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 " }, { "input": "100\n2 1 1 1 3 2 3 3 2 3 3 1 3 3 1 3 3 1 1 1 2 3 1 2 3 1 2 3 3 1 3 1 1 2 3 2 3 3 2 3 3 1 2 2 1 2 3 2 3 2 2 1 1 3 1 3 2 1 3 1 3 1 3 1 1 3 3 3 2 3 2 2 2 2 1 3 3 3 1 2 1 2 3 2 1 3 1 3 2 1 3 1 2 1 2 3 1 3 2 3", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 " }, { "input": "100\n7 4 5 5 10 10 5 8 5 7 4 5 4 6 8 8 2 6 3 3 10 7 10 8 6 2 7 3 9 7 7 2 4 5 2 4 9 5 10 1 10 5 10 4 1 3 4 2 6 9 9 9 10 6 2 5 6 1 8 10 4 10 3 4 10 5 5 4 10 4 5 3 7 10 2 7 3 6 9 6 1 6 5 5 4 6 6 4 4 1 5 1 6 6 6 8 8 6 2 6", "output": "1 1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7 7 7 7 7 7 8 8 8 8 8 8 8 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 10 10 10 10 " }, { "input": "100\n12 10 5 11 13 12 14 13 7 15 15 12 13 19 12 18 14 10 10 3 1 10 16 11 19 8 10 15 5 10 12 16 11 13 11 15 14 12 16 8 11 8 15 2 18 2 14 13 15 20 8 8 4 12 14 7 10 3 9 1 7 19 6 7 2 14 8 20 7 17 18 20 3 18 18 9 6 10 4 1 4 19 9 13 3 3 12 11 11 20 8 2 13 6 7 12 1 4 17 3", "output": "1 1 1 1 2 2 2 2 3 3 3 3 3 3 4 4 4 4 5 5 6 6 6 7 7 7 7 7 7 8 8 8 8 8 8 8 9 9 9 10 10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 12 12 12 13 13 13 13 13 13 13 14 14 14 14 14 14 15 15 15 15 15 15 16 16 16 17 17 18 18 18 18 18 19 19 19 19 20 20 20 20 " }, { "input": "100\n5 13 1 40 30 10 23 32 33 12 6 4 15 29 31 17 23 5 36 31 32 38 24 11 34 39 19 21 6 19 31 35 1 15 6 29 22 15 17 15 1 17 2 34 20 8 27 2 29 26 13 9 22 27 27 3 20 40 4 40 33 29 36 30 35 16 19 28 26 11 36 24 29 5 40 10 38 34 33 23 34 39 31 7 10 31 22 6 36 24 14 31 34 23 2 4 26 16 2 32", "output": "1 1 1 2 2 2 2 3 4 4 4 5 5 5 6 6 6 6 7 8 9 10 10 10 11 11 12 13 13 14 15 15 15 15 16 16 17 17 17 19 19 19 20 20 21 22 22 22 23 23 23 23 24 24 24 26 26 26 27 27 27 28 29 29 29 29 29 30 30 31 31 31 31 31 31 32 32 32 33 33 33 34 34 34 34 34 35 35 36 36 36 36 38 38 39 39 40 40 40 40 " }, { "input": "100\n72 44 34 74 9 60 26 37 55 77 74 69 28 66 54 55 8 36 57 31 31 48 32 66 40 70 77 43 64 28 37 10 21 58 51 32 60 28 51 52 28 35 7 33 1 68 38 70 57 71 8 20 42 57 59 4 58 10 17 47 22 48 16 3 76 67 32 37 64 47 33 41 75 69 2 76 39 9 27 75 20 21 52 25 71 21 11 29 38 10 3 1 45 55 63 36 27 7 59 41", "output": "1 1 2 3 3 4 7 7 8 8 9 9 10 10 10 11 16 17 20 20 21 21 21 22 25 26 27 27 28 28 28 28 29 31 31 32 32 32 33 33 34 35 36 36 37 37 37 38 38 39 40 41 41 42 43 44 45 47 47 48 48 51 51 52 52 54 55 55 55 57 57 57 58 58 59 59 60 60 63 64 64 66 66 67 68 69 69 70 70 71 71 72 74 74 75 75 76 76 77 77 " }, { "input": "100\n75 18 61 10 56 53 42 57 79 80 31 2 50 45 54 99 84 52 71 21 86 3 19 98 14 37 40 62 63 68 5 10 87 8 81 85 52 52 57 94 2 7 56 96 19 76 1 13 81 6 80 47 22 59 99 32 9 5 36 88 98 91 70 70 12 93 12 22 85 1 97 48 94 16 84 84 51 34 62 7 68 51 30 2 37 82 4 7 27 1 80 9 61 16 59 55 12 96 94 82", "output": "1 1 1 2 2 2 3 4 5 5 6 7 7 7 8 9 9 10 10 12 12 12 13 14 16 16 18 19 19 21 22 22 27 30 31 32 34 36 37 37 40 42 45 47 48 50 51 51 52 52 52 53 54 55 56 56 57 57 59 59 61 61 62 62 63 68 68 70 70 71 75 76 79 80 80 80 81 81 82 82 84 84 84 85 85 86 87 88 91 93 94 94 94 96 96 97 98 98 99 99 " }, { "input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 " }, { "input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 " }, { "input": "100\n50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50", "output": "50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 " }, { "input": "49\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97", "output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 " }, { "input": "30\n1 4 7 10 13 16 19 22 25 28 31 34 37 40 43 46 49 52 55 58 61 64 67 70 73 76 79 82 85 88", "output": "1 4 7 10 13 16 19 22 25 28 31 34 37 40 43 46 49 52 55 58 61 64 67 70 73 76 79 82 85 88 " }, { "input": "100\n100 51 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 51 100 " }, { "input": "10\n100 90 80 70 60 50 40 30 20 10", "output": "10 20 30 40 50 60 70 80 90 100 " }, { "input": "1\n10", "output": "10 " } ]
1,687,179,501
2,147,483,647
Python 3
OK
TESTS
32
46
0
n = int(input()) cubes = [int(x) for x in input().split()] cubes.sort() for cube in cubes: print(cube,end=" ") print()
Title: Gravity Flip Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Chris is bored during his physics lessons (too easy), so he has built a toy box to keep himself occupied. The box is special, since it has the ability to change gravity. There are *n* columns of toy cubes in the box arranged in a line. The *i*-th column contains *a**i* cubes. At first, the gravity in the box is pulling the cubes downwards. When Chris switches the gravity, it begins to pull all the cubes to the right side of the box. The figure shows the initial and final configurations of the cubes in the box: the cubes that have changed their position are highlighted with orange. Given the initial configuration of the toy cubes in the box, find the amounts of cubes in each of the *n* columns after the gravity switch! Input Specification: The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=100), the number of the columns in the box. The next line contains *n* space-separated integer numbers. The *i*-th number *a**i* (1<=≤<=*a**i*<=≤<=100) denotes the number of cubes in the *i*-th column. Output Specification: Output *n* integer numbers separated by spaces, where the *i*-th number is the amount of cubes in the *i*-th column after the gravity switch. Demo Input: ['4\n3 2 1 2\n', '3\n2 3 8\n'] Demo Output: ['1 2 2 3 \n', '2 3 8 \n'] Note: The first example case is shown on the figure. The top cube of the first column falls to the top of the last column; the top cube of the second column falls to the top of the third column; the middle cube of the first column falls to the top of the second column. In the second example case the gravity switch does not change the heights of the columns.
```python n = int(input()) cubes = [int(x) for x in input().split()] cubes.sort() for cube in cubes: print(cube,end=" ") print() ```
3
378
A
Playing with Dice
PROGRAMMING
800
[ "brute force" ]
null
null
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw. The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
[ "2 5\n", "2 4\n" ]
[ "3 0 3\n", "2 1 3\n" ]
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct. You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| &lt; |*b* - *x*|.
500
[ { "input": "2 5", "output": "3 0 3" }, { "input": "2 4", "output": "2 1 3" }, { "input": "5 3", "output": "2 1 3" }, { "input": "1 6", "output": "3 0 3" }, { "input": "5 1", "output": "3 1 2" }, { "input": "6 3", "output": "2 0 4" }, { "input": "2 3", "output": "2 0 4" }, { "input": "5 6", "output": "5 0 1" }, { "input": "4 4", "output": "0 6 0" }, { "input": "1 1", "output": "0 6 0" }, { "input": "6 4", "output": "1 1 4" }, { "input": "1 4", "output": "2 0 4" }, { "input": "5 5", "output": "0 6 0" }, { "input": "4 5", "output": "4 0 2" }, { "input": "4 3", "output": "3 0 3" }, { "input": "1 5", "output": "2 1 3" }, { "input": "6 5", "output": "1 0 5" }, { "input": "2 2", "output": "0 6 0" }, { "input": "1 3", "output": "1 1 4" }, { "input": "3 6", "output": "4 0 2" }, { "input": "3 1", "output": "4 1 1" }, { "input": "3 2", "output": "4 0 2" }, { "input": "3 5", "output": "3 1 2" }, { "input": "3 3", "output": "0 6 0" }, { "input": "6 2", "output": "2 1 3" }, { "input": "4 1", "output": "4 0 2" }, { "input": "5 2", "output": "3 0 3" }, { "input": "4 2", "output": "3 1 2" }, { "input": "2 1", "output": "5 0 1" }, { "input": "6 1", "output": "3 0 3" }, { "input": "4 6", "output": "4 1 1" }, { "input": "2 6", "output": "3 1 2" }, { "input": "3 4", "output": "3 0 3" }, { "input": "1 2", "output": "1 0 5" }, { "input": "6 6", "output": "0 6 0" }, { "input": "5 4", "output": "2 0 4" }, { "input": "3 3", "output": "0 6 0" }, { "input": "1 1", "output": "0 6 0" } ]
1,683,347,582
2,147,483,647
Python 3
OK
TESTS
38
46
0
a,b=input().split(" ") a=int(a) b=int(b) wina=int(0) winb=int(0) draw=int(0) for i in range(1,7): if abs(a-i)>abs(b-i): winb+=1 elif abs(a-i)<abs(b-i): wina+=1 else: draw+=1 print(wina,draw,winb)
Title: Playing with Dice Time Limit: None seconds Memory Limit: None megabytes Problem Description: Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw. The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins? Input Specification: The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly. Output Specification: Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly. Demo Input: ['2 5\n', '2 4\n'] Demo Output: ['3 0 3\n', '2 1 3\n'] Note: The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct. You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| &lt; |*b* - *x*|.
```python a,b=input().split(" ") a=int(a) b=int(b) wina=int(0) winb=int(0) draw=int(0) for i in range(1,7): if abs(a-i)>abs(b-i): winb+=1 elif abs(a-i)<abs(b-i): wina+=1 else: draw+=1 print(wina,draw,winb) ```
3
1,009
A
Game Shopping
PROGRAMMING
800
[ "implementation" ]
null
null
Maxim wants to buy some games at the local game shop. There are $n$ games in the shop, the $i$-th game costs $c_i$. Maxim has a wallet which can be represented as an array of integers. His wallet contains $m$ bills, the $j$-th bill has value $a_j$. Games in the shop are ordered from left to right, Maxim tries to buy every game in that order. When Maxim stands at the position $i$ in the shop, he takes the first bill from his wallet (if his wallet is empty then he proceeds to the next position immediately) and tries to buy the $i$-th game using this bill. After Maxim tried to buy the $n$-th game, he leaves the shop. Maxim buys the $i$-th game if and only if the value of the first bill (which he takes) from his wallet is greater or equal to the cost of the $i$-th game. If he successfully buys the $i$-th game, the first bill from his wallet disappears and the next bill becomes first. Otherwise Maxim leaves the first bill in his wallet (this bill still remains the first one) and proceeds to the next game. For example, for array $c = [2, 4, 5, 2, 4]$ and array $a = [5, 3, 4, 6]$ the following process takes place: Maxim buys the first game using the first bill (its value is $5$), the bill disappears, after that the second bill (with value $3$) becomes the first one in Maxim's wallet, then Maxim doesn't buy the second game because $c_2 &gt; a_2$, the same with the third game, then he buys the fourth game using the bill of value $a_2$ (the third bill becomes the first one in Maxim's wallet) and buys the fifth game using the bill of value $a_3$. Your task is to get the number of games Maxim will buy.
The first line of the input contains two integers $n$ and $m$ ($1 \le n, m \le 1000$) — the number of games and the number of bills in Maxim's wallet. The second line of the input contains $n$ integers $c_1, c_2, \dots, c_n$ ($1 \le c_i \le 1000$), where $c_i$ is the cost of the $i$-th game. The third line of the input contains $m$ integers $a_1, a_2, \dots, a_m$ ($1 \le a_j \le 1000$), where $a_j$ is the value of the $j$-th bill from the Maxim's wallet.
Print a single integer — the number of games Maxim will buy.
[ "5 4\n2 4 5 2 4\n5 3 4 6\n", "5 2\n20 40 50 20 40\n19 20\n", "6 4\n4 8 15 16 23 42\n1000 1000 1000 1000\n" ]
[ "3\n", "0\n", "4\n" ]
The first example is described in the problem statement. In the second example Maxim cannot buy any game because the value of the first bill in his wallet is smaller than the cost of any game in the shop. In the third example the values of the bills in Maxim's wallet are large enough to buy any game he encounter until he runs out of bills in his wallet.
0
[ { "input": "5 4\n2 4 5 2 4\n5 3 4 6", "output": "3" }, { "input": "5 2\n20 40 50 20 40\n19 20", "output": "0" }, { "input": "6 4\n4 8 15 16 23 42\n1000 1000 1000 1000", "output": "4" }, { "input": "5 1\n1 1 1 1 1\n5", "output": "1" }, { "input": "5 1\n10 1 1 1 1\n1000", "output": "1" }, { "input": "5 1\n100 100 100 100 100\n100", "output": "1" }, { "input": "2 1\n2 1\n1", "output": "1" }, { "input": "2 3\n3 1\n2 4 2", "output": "1" }, { "input": "1 5\n4\n1 4 3 3 2", "output": "0" }, { "input": "5 3\n4 2 3 1 1\n2 1 3", "output": "3" }, { "input": "3 5\n5 2 5\n1 4 1 4 2", "output": "0" }, { "input": "7 3\n9 7 10 2 1 1 1\n8 9 6", "output": "3" }, { "input": "5 3\n2 5 3 3 2\n2 5 3", "output": "3" } ]
1,604,047,602
2,147,483,647
Python 3
OK
TESTS
19
109
307,200
a=list(map(int,input().split())) b=list(map(int,input().split())) c=list(map(int,input().split())) j=0 count=0 i=0 while i<a[0] and j<a[1]: if c[j]>=b[i]: j+=1 count+=1 i+=1 print(count)
Title: Game Shopping Time Limit: None seconds Memory Limit: None megabytes Problem Description: Maxim wants to buy some games at the local game shop. There are $n$ games in the shop, the $i$-th game costs $c_i$. Maxim has a wallet which can be represented as an array of integers. His wallet contains $m$ bills, the $j$-th bill has value $a_j$. Games in the shop are ordered from left to right, Maxim tries to buy every game in that order. When Maxim stands at the position $i$ in the shop, he takes the first bill from his wallet (if his wallet is empty then he proceeds to the next position immediately) and tries to buy the $i$-th game using this bill. After Maxim tried to buy the $n$-th game, he leaves the shop. Maxim buys the $i$-th game if and only if the value of the first bill (which he takes) from his wallet is greater or equal to the cost of the $i$-th game. If he successfully buys the $i$-th game, the first bill from his wallet disappears and the next bill becomes first. Otherwise Maxim leaves the first bill in his wallet (this bill still remains the first one) and proceeds to the next game. For example, for array $c = [2, 4, 5, 2, 4]$ and array $a = [5, 3, 4, 6]$ the following process takes place: Maxim buys the first game using the first bill (its value is $5$), the bill disappears, after that the second bill (with value $3$) becomes the first one in Maxim's wallet, then Maxim doesn't buy the second game because $c_2 &gt; a_2$, the same with the third game, then he buys the fourth game using the bill of value $a_2$ (the third bill becomes the first one in Maxim's wallet) and buys the fifth game using the bill of value $a_3$. Your task is to get the number of games Maxim will buy. Input Specification: The first line of the input contains two integers $n$ and $m$ ($1 \le n, m \le 1000$) — the number of games and the number of bills in Maxim's wallet. The second line of the input contains $n$ integers $c_1, c_2, \dots, c_n$ ($1 \le c_i \le 1000$), where $c_i$ is the cost of the $i$-th game. The third line of the input contains $m$ integers $a_1, a_2, \dots, a_m$ ($1 \le a_j \le 1000$), where $a_j$ is the value of the $j$-th bill from the Maxim's wallet. Output Specification: Print a single integer — the number of games Maxim will buy. Demo Input: ['5 4\n2 4 5 2 4\n5 3 4 6\n', '5 2\n20 40 50 20 40\n19 20\n', '6 4\n4 8 15 16 23 42\n1000 1000 1000 1000\n'] Demo Output: ['3\n', '0\n', '4\n'] Note: The first example is described in the problem statement. In the second example Maxim cannot buy any game because the value of the first bill in his wallet is smaller than the cost of any game in the shop. In the third example the values of the bills in Maxim's wallet are large enough to buy any game he encounter until he runs out of bills in his wallet.
```python a=list(map(int,input().split())) b=list(map(int,input().split())) c=list(map(int,input().split())) j=0 count=0 i=0 while i<a[0] and j<a[1]: if c[j]>=b[i]: j+=1 count+=1 i+=1 print(count) ```
3
721
A
One-dimensional Japanese Crossword
PROGRAMMING
800
[ "implementation" ]
null
null
Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=×<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)). Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=×<=*n*), which he wants to encrypt in the same way as in japanese crossword. Help Adaltik find the numbers encrypting the row he drew.
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W' — to white square in the row that Adaltik drew).
The first line should contain a single integer *k* — the number of integers encrypting the row, e.g. the number of groups of black squares in the row. The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right.
[ "3\nBBW\n", "5\nBWBWB\n", "4\nWWWW\n", "4\nBBBB\n", "13\nWBBBBWWBWBBBW\n" ]
[ "1\n2 ", "3\n1 1 1 ", "0\n", "1\n4 ", "3\n4 1 3 " ]
The last sample case correspond to the picture in the statement.
500
[ { "input": "3\nBBW", "output": "1\n2 " }, { "input": "5\nBWBWB", "output": "3\n1 1 1 " }, { "input": "4\nWWWW", "output": "0" }, { "input": "4\nBBBB", "output": "1\n4 " }, { "input": "13\nWBBBBWWBWBBBW", "output": "3\n4 1 3 " }, { "input": "1\nB", "output": "1\n1 " }, { "input": "2\nBB", "output": "1\n2 " }, { "input": "100\nWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWB", "output": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 " }, { "input": "1\nW", "output": "0" }, { "input": "2\nWW", "output": "0" }, { "input": "2\nWB", "output": "1\n1 " }, { "input": "2\nBW", "output": "1\n1 " }, { "input": "3\nBBB", "output": "1\n3 " }, { "input": "3\nBWB", "output": "2\n1 1 " }, { "input": "3\nWBB", "output": "1\n2 " }, { "input": "3\nWWB", "output": "1\n1 " }, { "input": "3\nWBW", "output": "1\n1 " }, { "input": "3\nBWW", "output": "1\n1 " }, { "input": "3\nWWW", "output": "0" }, { "input": "100\nBBBWWWWWWBBWWBBWWWBBWBBBBBBBBBBBWBBBWBBWWWBBWWBBBWBWWBBBWWBBBWBBBBBWWWBWWBBWWWWWWBWBBWWBWWWBWBWWWWWB", "output": "21\n3 2 2 2 11 3 2 2 3 1 3 3 5 1 2 1 2 1 1 1 1 " }, { "input": "5\nBBBWB", "output": "2\n3 1 " }, { "input": "5\nBWWWB", "output": "2\n1 1 " }, { "input": "5\nWWWWB", "output": "1\n1 " }, { "input": "5\nBWWWW", "output": "1\n1 " }, { "input": "5\nBBBWW", "output": "1\n3 " }, { "input": "5\nWWBBB", "output": "1\n3 " }, { "input": "10\nBBBBBWWBBB", "output": "2\n5 3 " }, { "input": "10\nBBBBWBBWBB", "output": "3\n4 2 2 " }, { "input": "20\nBBBBBWWBWBBWBWWBWBBB", "output": "6\n5 1 2 1 1 3 " }, { "input": "20\nBBBWWWWBBWWWBWBWWBBB", "output": "5\n3 2 1 1 3 " }, { "input": "20\nBBBBBBBBWBBBWBWBWBBB", "output": "5\n8 3 1 1 3 " }, { "input": "20\nBBBWBWBWWWBBWWWWBWBB", "output": "6\n3 1 1 2 1 2 " }, { "input": "40\nBBBBBBWWWWBWBWWWBWWWWWWWWWWWBBBBBBBBBBBB", "output": "5\n6 1 1 1 12 " }, { "input": "40\nBBBBBWBWWWBBWWWBWBWWBBBBWWWWBWBWBBBBBBBB", "output": "9\n5 1 2 1 1 4 1 1 8 " }, { "input": "50\nBBBBBBBBBBBWWWWBWBWWWWBBBBBBBBWWWWWWWBWWWWBWBBBBBB", "output": "7\n11 1 1 8 1 1 6 " }, { "input": "50\nWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW", "output": "0" }, { "input": "50\nBBBBBWWWWWBWWWBWWWWWBWWWBWWWWWWBBWBBWWWWBWWWWWWWBW", "output": "9\n5 1 1 1 1 2 2 1 1 " }, { "input": "50\nWWWWBWWBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWBWWWWWWWBBBBB", "output": "6\n1 1 1 1 1 5 " }, { "input": "50\nBBBBBWBWBWWBWBWWWWWWBWBWBWWWWWWWWWWWWWBWBWWWWBWWWB", "output": "12\n5 1 1 1 1 1 1 1 1 1 1 1 " }, { "input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "1\n50 " }, { "input": "100\nBBBBBBBBBBBWBWWWWBWWBBWBBWWWWWWWWWWBWBWWBWWWWWWWWWWWBBBWWBBWWWWWBWBWWWWBWWWWWWWWWWWBWWWWWBBBBBBBBBBB", "output": "15\n11 1 1 2 2 1 1 1 3 2 1 1 1 1 11 " }, { "input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "1\n100 " }, { "input": "100\nBBBBBBBBBBBBBBBBBBBBWBWBWWWWWBWWWWWWWWWWWWWWBBWWWBWWWWBWWBWWWWWWBWWWWWWWWWWWWWBWBBBBBBBBBBBBBBBBBBBB", "output": "11\n20 1 1 1 2 1 1 1 1 1 20 " }, { "input": "100\nBBBBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWWWWWBWBWWWWWWBBWWWWWWWWWWWWBWWWWBWWWWWWWWWWWWBWWWWWWWBWWWWWWWBBBBBB", "output": "11\n4 1 1 1 1 2 1 1 1 1 6 " }, { "input": "5\nBWBWB", "output": "3\n1 1 1 " }, { "input": "10\nWWBWWWBWBB", "output": "3\n1 1 2 " }, { "input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "1\n50 " }, { "input": "50\nBBBBBBBBBBBBBBBBBWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "2\n17 31 " }, { "input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "2\n24 42 " }, { "input": "90\nWWBWWBWBBWBBWWBWBWBBBWBWBBBWBWBWBWBWBWBWBWBBBBBWBBWWWWBWBBWBWWBBBWBWBWWBWBWBWBWWWWWWBWBBBB", "output": "30\n1 1 2 2 1 1 3 1 3 1 1 1 1 1 1 1 5 2 1 2 1 3 1 1 1 1 1 1 1 4 " }, { "input": "100\nBWWWBWBWBBBBBWBWWBWBWWWBWBWBWWBBWWBBBWBBBWWBWBWWBBBBWBWBBBWBWBBWWWWWWBWWBBBBWBWBWWBWBWWWBWBWWBWBWWWB", "output": "31\n1 1 1 5 1 1 1 1 1 1 2 3 3 1 1 4 1 3 1 2 1 4 1 1 1 1 1 1 1 1 1 " }, { "input": "90\nWBWBBBBBBWWWBBWWBWWWBBWWBWWWBWBBWBWBBWWWWBWBWBBWBBWBWWWBBWBBWWWWBWBBWWWBBBWBBWBWBBBBWWBWWB", "output": "25\n1 6 2 1 2 1 1 2 1 2 1 1 2 2 1 2 2 1 2 3 2 1 4 1 1 " }, { "input": "80\nBBWWBBBWBBWWWWBBWBWBBWWWWWBWBBWWBWBWBWBWBWWBWWBWWWBWBBWBBWBBWBBBWWBBBBBBBWBBBWBB", "output": "23\n2 3 2 2 1 2 1 2 1 1 1 1 1 1 1 1 2 2 2 3 7 3 2 " }, { "input": "65\nWWWWBWWWBBBBBWWWWWWBBBWWBBBBWWWWWWWWBBBWWWWBWBWWBBWWWWBWWWBBWBBBB", "output": "11\n1 5 3 4 3 1 1 2 1 2 4 " } ]
1,692,297,130
2,147,483,647
Python 3
OK
TESTS
54
31
0
n = int(input()) layout = input() count = 0 flag = -1 num_blocks = layout.count('BW') if layout[n - 1] == 'B': num_blocks += 1 print(num_blocks) for i in range(n): if layout[i] == 'W': if flag == 1: print(count) flag = 0 count = 0 if layout[i] == 'B': flag = 1 count += 1 if i == n - 1: print(count)
Title: One-dimensional Japanese Crossword Time Limit: None seconds Memory Limit: None megabytes Problem Description: Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=×<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)). Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=×<=*n*), which he wants to encrypt in the same way as in japanese crossword. Help Adaltik find the numbers encrypting the row he drew. Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W' — to white square in the row that Adaltik drew). Output Specification: The first line should contain a single integer *k* — the number of integers encrypting the row, e.g. the number of groups of black squares in the row. The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right. Demo Input: ['3\nBBW\n', '5\nBWBWB\n', '4\nWWWW\n', '4\nBBBB\n', '13\nWBBBBWWBWBBBW\n'] Demo Output: ['1\n2 ', '3\n1 1 1 ', '0\n', '1\n4 ', '3\n4 1 3 '] Note: The last sample case correspond to the picture in the statement.
```python n = int(input()) layout = input() count = 0 flag = -1 num_blocks = layout.count('BW') if layout[n - 1] == 'B': num_blocks += 1 print(num_blocks) for i in range(n): if layout[i] == 'W': if flag == 1: print(count) flag = 0 count = 0 if layout[i] == 'B': flag = 1 count += 1 if i == n - 1: print(count) ```
3
427
A
Police Recruits
PROGRAMMING
800
[ "implementation" ]
null
null
The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups. Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime. If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated. Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated.
The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers. If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time.
Print a single integer, the number of crimes which will go untreated.
[ "3\n-1 -1 1\n", "8\n1 -1 1 -1 -1 1 1 1\n", "11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n" ]
[ "2\n", "1\n", "8\n" ]
Lets consider the second example: 1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired. The answer is one, as one crime (on step 5) will go untreated.
500
[ { "input": "3\n-1 -1 1", "output": "2" }, { "input": "8\n1 -1 1 -1 -1 1 1 1", "output": "1" }, { "input": "11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1", "output": "8" }, { "input": "7\n-1 -1 1 1 -1 -1 1", "output": "2" }, { "input": "21\n-1 -1 -1 -1 -1 3 2 -1 6 -1 -1 2 1 -1 2 2 1 6 5 -1 5", "output": "5" }, { "input": "98\n-1 -1 1 -1 -1 -1 -1 1 -1 -1 1 -1 -1 1 -1 1 1 1 -1 1 1 1 1 1 -1 1 -1 -1 -1 -1 1 -1 -1 1 1 -1 1 1 1 -1 -1 -1 -1 -1 -1 1 -1 -1 -1 1 -1 1 -1 1 -1 1 1 1 1 1 1 1 -1 -1 1 1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 1 -1 1 1 1 -1 1 1 -1 -1 -1 1 1 1 -1 -1 -1 1 -1 1 1", "output": "13" }, { "input": "3\n-1 5 4", "output": "1" }, { "input": "146\n4 -1 -1 -1 -1 -1 -1 -1 -1 -1 4 -1 3 -1 3 -1 -1 1 4 -1 2 -1 -1 3 -1 -1 -1 4 1 -1 -1 -1 4 -1 -1 -1 -1 -1 -1 3 2 -1 3 2 4 5 2 4 1 5 -1 -1 2 -1 -1 1 -1 5 3 -1 1 2 2 3 5 3 -1 -1 3 -1 -1 3 5 5 -1 -1 5 -1 4 4 1 -1 -1 -1 2 1 -1 -1 -1 2 5 3 -1 -1 -1 3 -1 5 4 -1 1 -1 -1 3 -1 -1 3 1 1 2 -1 -1 -1 1 3 1 -1 2 -1 -1 5 5 -1 -1 3 4 5 1 -1 2 -1 -1 -1 3 -1 5 3 2 -1 2 -1 -1 5 -1 3 -1", "output": "5" }, { "input": "1\n2", "output": "0" }, { "input": "1\n-1", "output": "1" }, { "input": "2\n1 -1", "output": "0" }, { "input": "2\n-1 1", "output": "1" }, { "input": "2\n1 1", "output": "0" }, { "input": "2\n-1 -1", "output": "2" }, { "input": "4\n10 -1 -1 -1", "output": "0" }, { "input": "1\n1", "output": "0" }, { "input": "4\n-1 -1 1 1", "output": "2" } ]
1,687,807,270
2,147,483,647
Python 3
OK
TESTS
63
78
8,704,000
n = int(input()) val = input() list = val.split(" ") free = 0 final = 0 for i in list: if int(i) < 0: if free != 0: free -= 1 continue else: final += int(i) * (-1) elif int(i) > 0: free += int(i) print(final)
Title: Police Recruits Time Limit: None seconds Memory Limit: None megabytes Problem Description: The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups. Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime. If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated. Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated. Input Specification: The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers. If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time. Output Specification: Print a single integer, the number of crimes which will go untreated. Demo Input: ['3\n-1 -1 1\n', '8\n1 -1 1 -1 -1 1 1 1\n', '11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n'] Demo Output: ['2\n', '1\n', '8\n'] Note: Lets consider the second example: 1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired. The answer is one, as one crime (on step 5) will go untreated.
```python n = int(input()) val = input() list = val.split(" ") free = 0 final = 0 for i in list: if int(i) < 0: if free != 0: free -= 1 continue else: final += int(i) * (-1) elif int(i) > 0: free += int(i) print(final) ```
3
911
D
Inversion Counting
PROGRAMMING
1,800
[ "brute force", "math" ]
null
null
A permutation of size *n* is an array of size *n* such that each integer from 1 to *n* occurs exactly once in this array. An inversion in a permutation *p* is a pair of indices (*i*,<=*j*) such that *i*<=&gt;<=*j* and *a**i*<=&lt;<=*a**j*. For example, a permutation [4,<=1,<=3,<=2] contains 4 inversions: (2,<=1), (3,<=1), (4,<=1), (4,<=3). You are given a permutation *a* of size *n* and *m* queries to it. Each query is represented by two indices *l* and *r* denoting that you have to reverse the segment [*l*,<=*r*] of the permutation. For example, if *a*<==<=[1,<=2,<=3,<=4] and a query *l*<==<=2, *r*<==<=4 is applied, then the resulting permutation is [1,<=4,<=3,<=2]. After each query you have to determine whether the number of inversions is odd or even.
The first line contains one integer *n* (1<=≤<=*n*<=≤<=1500) — the size of the permutation. The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=*n*) — the elements of the permutation. These integers are pairwise distinct. The third line contains one integer *m* (1<=≤<=*m*<=≤<=2·105) — the number of queries to process. Then *m* lines follow, *i*-th line containing two integers *l**i*, *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*) denoting that *i*-th query is to reverse a segment [*l**i*,<=*r**i*] of the permutation. All queries are performed one after another.
Print *m* lines. *i*-th of them must be equal to odd if the number of inversions in the permutation after *i*-th query is odd, and even otherwise.
[ "3\n1 2 3\n2\n1 2\n2 3\n", "4\n1 2 4 3\n4\n1 1\n1 4\n1 4\n2 3\n" ]
[ "odd\neven\n", "odd\nodd\nodd\neven\n" ]
The first example: 1. after the first query *a* = [2, 1, 3], inversion: (2, 1); 1. after the second query *a* = [2, 3, 1], inversions: (3, 1), (3, 2). The second example: 1. *a* = [1, 2, 4, 3], inversion: (4, 3); 1. *a* = [3, 4, 2, 1], inversions: (3, 1), (4, 1), (3, 2), (4, 2), (4, 3); 1. *a* = [1, 2, 4, 3], inversion: (4, 3); 1. *a* = [1, 4, 2, 3], inversions: (3, 2), (4, 2).
0
[ { "input": "3\n1 2 3\n2\n1 2\n2 3", "output": "odd\neven" }, { "input": "4\n1 2 4 3\n4\n1 1\n1 4\n1 4\n2 3", "output": "odd\nodd\nodd\neven" }, { "input": "7\n2 6 1 7 4 5 3\n5\n4 5\n7 7\n5 6\n4 5\n4 5", "output": "odd\nodd\neven\nodd\neven" }, { "input": "3\n2 1 3\n3\n2 3\n1 1\n1 3", "output": "even\neven\nodd" }, { "input": "1\n1\n10\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "even\neven\neven\neven\neven\neven\neven\neven\neven\neven" } ]
1,621,468,202
1,802
PyPy 3
OK
TESTS
23
389
10,649,600
import sys input = sys.stdin.buffer.readline n = int(input()) a = list(map(int,input().split())) parity = 0 for i in range(n): for j in range(i+1,n): if a[j] < a[i]: parity ^= 1 m = int(input()) for i in range(m): l,r = map(int,input().split()) dist = (r-l+1) pairs = (dist-1)*(dist)//2 if pairs & 1: parity ^= 1 if parity: print("odd") else: print("even")
Title: Inversion Counting Time Limit: None seconds Memory Limit: None megabytes Problem Description: A permutation of size *n* is an array of size *n* such that each integer from 1 to *n* occurs exactly once in this array. An inversion in a permutation *p* is a pair of indices (*i*,<=*j*) such that *i*<=&gt;<=*j* and *a**i*<=&lt;<=*a**j*. For example, a permutation [4,<=1,<=3,<=2] contains 4 inversions: (2,<=1), (3,<=1), (4,<=1), (4,<=3). You are given a permutation *a* of size *n* and *m* queries to it. Each query is represented by two indices *l* and *r* denoting that you have to reverse the segment [*l*,<=*r*] of the permutation. For example, if *a*<==<=[1,<=2,<=3,<=4] and a query *l*<==<=2, *r*<==<=4 is applied, then the resulting permutation is [1,<=4,<=3,<=2]. After each query you have to determine whether the number of inversions is odd or even. Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=1500) — the size of the permutation. The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=*n*) — the elements of the permutation. These integers are pairwise distinct. The third line contains one integer *m* (1<=≤<=*m*<=≤<=2·105) — the number of queries to process. Then *m* lines follow, *i*-th line containing two integers *l**i*, *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*) denoting that *i*-th query is to reverse a segment [*l**i*,<=*r**i*] of the permutation. All queries are performed one after another. Output Specification: Print *m* lines. *i*-th of them must be equal to odd if the number of inversions in the permutation after *i*-th query is odd, and even otherwise. Demo Input: ['3\n1 2 3\n2\n1 2\n2 3\n', '4\n1 2 4 3\n4\n1 1\n1 4\n1 4\n2 3\n'] Demo Output: ['odd\neven\n', 'odd\nodd\nodd\neven\n'] Note: The first example: 1. after the first query *a* = [2, 1, 3], inversion: (2, 1); 1. after the second query *a* = [2, 3, 1], inversions: (3, 1), (3, 2). The second example: 1. *a* = [1, 2, 4, 3], inversion: (4, 3); 1. *a* = [3, 4, 2, 1], inversions: (3, 1), (4, 1), (3, 2), (4, 2), (4, 3); 1. *a* = [1, 2, 4, 3], inversion: (4, 3); 1. *a* = [1, 4, 2, 3], inversions: (3, 2), (4, 2).
```python import sys input = sys.stdin.buffer.readline n = int(input()) a = list(map(int,input().split())) parity = 0 for i in range(n): for j in range(i+1,n): if a[j] < a[i]: parity ^= 1 m = int(input()) for i in range(m): l,r = map(int,input().split()) dist = (r-l+1) pairs = (dist-1)*(dist)//2 if pairs & 1: parity ^= 1 if parity: print("odd") else: print("even") ```
3
581
A
Vasya the Hipster
PROGRAMMING
800
[ "implementation", "math" ]
null
null
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks. According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot. Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them. Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Can you help him?
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
[ "3 1\n", "2 3\n", "7 3\n" ]
[ "1 1\n", "2 0\n", "3 2\n" ]
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
500
[ { "input": "3 1", "output": "1 1" }, { "input": "2 3", "output": "2 0" }, { "input": "7 3", "output": "3 2" }, { "input": "100 100", "output": "100 0" }, { "input": "4 10", "output": "4 3" }, { "input": "6 10", "output": "6 2" }, { "input": "6 11", "output": "6 2" }, { "input": "10 40", "output": "10 15" }, { "input": "11 56", "output": "11 22" }, { "input": "34 30", "output": "30 2" }, { "input": "33 33", "output": "33 0" }, { "input": "100 45", "output": "45 27" }, { "input": "100 23", "output": "23 38" }, { "input": "45 12", "output": "12 16" }, { "input": "1 1", "output": "1 0" }, { "input": "1 100", "output": "1 49" }, { "input": "100 1", "output": "1 49" }, { "input": "68 59", "output": "59 4" }, { "input": "45 99", "output": "45 27" }, { "input": "99 100", "output": "99 0" }, { "input": "100 98", "output": "98 1" }, { "input": "59 12", "output": "12 23" }, { "input": "86 4", "output": "4 41" }, { "input": "68 21", "output": "21 23" }, { "input": "100 11", "output": "11 44" }, { "input": "100 10", "output": "10 45" }, { "input": "15 45", "output": "15 15" }, { "input": "11 32", "output": "11 10" }, { "input": "34 96", "output": "34 31" }, { "input": "89 89", "output": "89 0" } ]
1,687,691,504
2,147,483,647
PyPy 3-64
OK
TESTS
30
77
0
a, b = map(int, input().split()) days_different_socks = min(a, b) remaining_socks = max(a, b) - days_different_socks days_same_socks = remaining_socks // 2 print(days_different_socks, days_same_socks)
Title: Vasya the Hipster Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks. According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot. Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them. Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Can you help him? Input Specification: The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got. Output Specification: Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day. Demo Input: ['3 1\n', '2 3\n', '7 3\n'] Demo Output: ['1 1\n', '2 0\n', '3 2\n'] Note: In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
```python a, b = map(int, input().split()) days_different_socks = min(a, b) remaining_socks = max(a, b) - days_different_socks days_same_socks = remaining_socks // 2 print(days_different_socks, days_same_socks) ```
3
289
B
Polo the Penguin and Matrix
PROGRAMMING
1,400
[ "brute force", "dp", "implementation", "sortings", "ternary search" ]
null
null
Little penguin Polo has an *n*<=×<=*m* matrix, consisting of integers. Let's index the matrix rows from 1 to *n* from top to bottom and let's index the columns from 1 to *m* from left to right. Let's represent the matrix element on the intersection of row *i* and column *j* as *a**ij*. In one move the penguin can add or subtract number *d* from some matrix element. Find the minimum number of moves needed to make all matrix elements equal. If the described plan is impossible to carry out, say so.
The first line contains three integers *n*, *m* and *d* (1<=≤<=*n*,<=*m*<=≤<=100,<=1<=≤<=*d*<=≤<=104) — the matrix sizes and the *d* parameter. Next *n* lines contain the matrix: the *j*-th integer in the *i*-th row is the matrix element *a**ij* (1<=≤<=*a**ij*<=≤<=104).
In a single line print a single integer — the minimum number of moves the penguin needs to make all matrix elements equal. If that is impossible, print "-1" (without the quotes).
[ "2 2 2\n2 4\n6 8\n", "1 2 7\n6 7\n" ]
[ "4\n", "-1\n" ]
none
1,000
[ { "input": "2 2 2\n2 4\n6 8", "output": "4" }, { "input": "1 2 7\n6 7", "output": "-1" }, { "input": "3 2 1\n5 7\n1 2\n5 100", "output": "104" }, { "input": "3 3 3\n5 8 5\n11 11 17\n14 5 2", "output": "12" }, { "input": "3 3 3\n5 8 5\n11 11 17\n14 5 3", "output": "-1" }, { "input": "2 2 4\n5 5\n5 5", "output": "0" }, { "input": "7 4 5\n7 7 7 12\n7 12 12 7\n7 7 7 7\n7 7 12 7\n7 7 12 12\n12 12 7 12\n7 7 7 7", "output": "9" }, { "input": "7 7 47\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91", "output": "0" }, { "input": "7 7 47\n47 47 47 47 47 47 47\n47 47 47 47 77 47 47\n47 47 47 47 47 47 47\n47 47 47 47 47 47 47\n47 47 47 47 47 47 47\n47 47 47 47 47 47 47\n47 47 47 47 47 127 47", "output": "-1" }, { "input": "7 5 47\n9583 1734 4601 5353 2110\n3802 5165 7985 6293 324\n7045 653 9160 7891 4930\n1781 3520 4178 2298 3943\n1405 2956 5447 5494 6528\n3097 1640 7750 4883 8032\n4225 8455 1875 4789 4366", "output": "1508" }, { "input": "1 1 1\n1", "output": "0" }, { "input": "1 1 8\n12", "output": "0" } ]
1,631,624,279
2,147,483,647
PyPy 3
OK
TESTS
31
248
22,016,000
r, c, d = [int(i) for i in input().split()] arr = [] for i in range(r): t = [int(i) for i in input().split()] arr.extend(t) arr.sort() c = arr[i]%d for i in arr: if i%d != c: print(-1) exit(0) mid = len(arr)//2 res = 0 for i in arr: res += abs(i - arr[mid])/d print(int(res))
Title: Polo the Penguin and Matrix Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little penguin Polo has an *n*<=×<=*m* matrix, consisting of integers. Let's index the matrix rows from 1 to *n* from top to bottom and let's index the columns from 1 to *m* from left to right. Let's represent the matrix element on the intersection of row *i* and column *j* as *a**ij*. In one move the penguin can add or subtract number *d* from some matrix element. Find the minimum number of moves needed to make all matrix elements equal. If the described plan is impossible to carry out, say so. Input Specification: The first line contains three integers *n*, *m* and *d* (1<=≤<=*n*,<=*m*<=≤<=100,<=1<=≤<=*d*<=≤<=104) — the matrix sizes and the *d* parameter. Next *n* lines contain the matrix: the *j*-th integer in the *i*-th row is the matrix element *a**ij* (1<=≤<=*a**ij*<=≤<=104). Output Specification: In a single line print a single integer — the minimum number of moves the penguin needs to make all matrix elements equal. If that is impossible, print "-1" (without the quotes). Demo Input: ['2 2 2\n2 4\n6 8\n', '1 2 7\n6 7\n'] Demo Output: ['4\n', '-1\n'] Note: none
```python r, c, d = [int(i) for i in input().split()] arr = [] for i in range(r): t = [int(i) for i in input().split()] arr.extend(t) arr.sort() c = arr[i]%d for i in arr: if i%d != c: print(-1) exit(0) mid = len(arr)//2 res = 0 for i in arr: res += abs(i - arr[mid])/d print(int(res)) ```
3
127
B
Canvas Frames
PROGRAMMING
1,000
[ "implementation" ]
null
null
Nicholas, a painter is going to paint several new canvases. Nicholas is sure that the canvases will turn out so great that each one will need framing and being hung on the wall. Frames are what Nicholas decided to begin with. Nicholas has *n* sticks whose lengths equal *a*1,<=*a*2,<=... *a**n*. Nicholas does not want to break the sticks or glue them together. To make a *h*<=×<=*w*-sized frame, he needs two sticks whose lengths equal *h* and two sticks whose lengths equal *w*. Specifically, to make a square frame (when *h*<==<=*w*), he needs four sticks of the same length. Now Nicholas wants to make from the sticks that he has as many frames as possible; to be able to paint as many canvases as possible to fill the frames. Help him in this uneasy task. Note that it is not necessary to use all the sticks Nicholas has.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of sticks. The second line contains *n* space-separated integers. The *i*-th integer equals the length of the *i*-th stick *a**i* (1<=≤<=*a**i*<=≤<=100).
Print the single number — the maximum number of frames Nicholas can make for his future canvases.
[ "5\n2 4 3 2 3\n", "13\n2 2 4 4 4 4 6 6 6 7 7 9 9\n", "4\n3 3 3 5\n" ]
[ "1", "3", "0" ]
none
1,000
[ { "input": "5\n2 4 3 2 3", "output": "1" }, { "input": "13\n2 2 4 4 4 4 6 6 6 7 7 9 9", "output": "3" }, { "input": "4\n3 3 3 5", "output": "0" }, { "input": "2\n3 5", "output": "0" }, { "input": "9\n1 2 3 4 5 6 7 8 9", "output": "0" }, { "input": "14\n2 4 2 6 2 3 4 1 4 5 4 3 4 1", "output": "2" }, { "input": "33\n1 2 2 6 10 10 33 11 17 32 25 6 7 29 11 32 33 8 13 17 17 6 11 11 11 8 10 26 29 26 32 33 36", "output": "5" }, { "input": "1\n1", "output": "0" }, { "input": "1\n10", "output": "0" }, { "input": "2\n1 1", "output": "0" }, { "input": "3\n1 1 1", "output": "0" }, { "input": "3\n1 2 2", "output": "0" }, { "input": "3\n3 2 1", "output": "0" }, { "input": "4\n1 1 1 1", "output": "1" }, { "input": "4\n1 2 1 2", "output": "1" }, { "input": "4\n1 100 1 100", "output": "1" }, { "input": "4\n10 100 100 10", "output": "1" }, { "input": "4\n1 2 3 3", "output": "0" }, { "input": "4\n8 5 9 13", "output": "0" }, { "input": "4\n100 100 100 100", "output": "1" }, { "input": "5\n1 1 1 1 1", "output": "1" }, { "input": "5\n1 4 4 1 1", "output": "1" }, { "input": "5\n1 100 1 1 100", "output": "1" }, { "input": "5\n100 100 1 1 100", "output": "1" }, { "input": "5\n100 1 100 100 100", "output": "1" }, { "input": "5\n100 100 100 100 100", "output": "1" }, { "input": "6\n1 1 1 1 1 1", "output": "1" }, { "input": "6\n1 1 5 1 1 5", "output": "1" }, { "input": "6\n1 100 100 1 1 1", "output": "1" }, { "input": "6\n100 1 1 100 1 100", "output": "1" }, { "input": "6\n1 2 3 2 3 1", "output": "1" }, { "input": "6\n1 50 1 100 50 100", "output": "1" }, { "input": "6\n10 10 10 12 13 14", "output": "0" }, { "input": "7\n1 1 1 1 1 1 1", "output": "1" }, { "input": "7\n1 2 1 1 1 1 1", "output": "1" }, { "input": "7\n1 2 2 1 2 1 2", "output": "1" }, { "input": "7\n1 1 2 2 1 2 3", "output": "1" }, { "input": "7\n1 3 2 2 3 1 4", "output": "1" }, { "input": "7\n1 3 4 3 5 4 6", "output": "1" }, { "input": "7\n7 6 5 4 3 2 1", "output": "0" }, { "input": "8\n1 2 1 2 2 2 2 2", "output": "2" }, { "input": "8\n1 2 2 1 1 2 2 2", "output": "1" }, { "input": "8\n1 2 2 2 3 1 1 3", "output": "1" }, { "input": "8\n1 2 3 4 1 2 3 4", "output": "2" }, { "input": "8\n1 1 1 1 2 3 2 3", "output": "2" }, { "input": "8\n1 2 3 4 5 5 5 5", "output": "1" }, { "input": "8\n1 2 1 3 4 1 5 6", "output": "0" }, { "input": "8\n1 2 3 4 5 6 1 7", "output": "0" }, { "input": "8\n8 6 3 4 5 2 1 7", "output": "0" }, { "input": "8\n100 100 100 100 100 100 100 100", "output": "2" }, { "input": "10\n1 1 1 1 1 1 1 1 1 1", "output": "2" }, { "input": "10\n19 9 14 14 19 5 5 18 10 17", "output": "1" }, { "input": "10\n72 86 73 25 84 29 33 34 20 29", "output": "0" }, { "input": "10\n93 93 99 98 91 96 92 98 94 98", "output": "1" }, { "input": "13\n35 6 21 30 67 55 70 39 75 72 11 13 69", "output": "0" }, { "input": "17\n90 97 12 56 94 11 49 96 22 7 15 48 71 71 94 72 100", "output": "1" }, { "input": "18\n39 72 67 28 69 41 43 51 66 99 4 57 68 93 28 27 37 27", "output": "1" }, { "input": "23\n88 82 2 67 4 6 67 83 77 58 48 64 86 37 96 83 35 46 13 79 72 18 35", "output": "1" }, { "input": "30\n43 34 38 50 47 24 26 20 7 5 26 29 98 87 90 46 10 53 88 61 90 39 78 81 65 13 72 95 53 27", "output": "1" }, { "input": "33\n1 3 34 55 38 58 64 26 66 44 50 63 46 62 62 99 73 87 35 20 30 38 39 85 49 24 93 68 8 25 86 30 51", "output": "1" }, { "input": "38\n65 69 80 93 28 36 40 81 53 75 55 50 82 95 8 51 66 65 50 4 40 92 18 70 38 68 42 100 34 57 98 79 95 84 82 35 100 89", "output": "3" }, { "input": "40\n4 2 62 38 76 68 19 71 44 91 76 31 3 63 56 62 93 98 10 61 52 59 81 46 23 27 36 26 24 38 37 66 15 16 78 41 95 82 73 90", "output": "1" }, { "input": "43\n62 31 14 43 67 2 60 77 64 70 91 9 3 43 76 7 56 84 5 20 88 50 47 42 7 39 8 56 71 24 49 59 70 61 81 17 76 44 80 61 77 5 96", "output": "4" }, { "input": "49\n75 64 7 2 1 66 31 84 78 53 34 5 40 90 7 62 86 54 99 77 8 92 30 3 18 18 61 38 38 11 79 88 84 89 50 94 72 8 54 85 100 1 19 4 97 91 13 39 91", "output": "4" }, { "input": "57\n83 94 42 57 19 9 40 25 56 92 9 38 58 66 43 19 50 10 100 3 49 96 77 36 20 3 48 15 38 19 99 100 66 14 52 13 16 73 65 99 29 85 75 18 97 64 57 82 70 19 16 25 40 11 9 22 89", "output": "6" }, { "input": "67\n36 22 22 86 52 53 36 68 46 82 99 37 15 43 57 35 33 99 22 96 7 8 80 93 70 70 55 51 61 74 6 28 85 72 84 42 29 1 4 71 7 40 61 95 93 36 42 61 16 40 10 85 31 86 93 19 44 20 52 66 10 22 40 53 25 29 23", "output": "8" }, { "input": "74\n90 26 58 69 87 23 44 9 32 25 33 13 79 84 52 90 4 7 93 77 29 85 22 1 96 69 98 16 76 87 57 16 44 41 57 28 18 70 77 83 37 17 59 87 27 19 89 63 14 84 77 40 46 77 82 73 86 73 30 58 6 30 70 36 31 12 43 50 93 3 3 57 38 91", "output": "7" }, { "input": "87\n10 19 83 58 15 48 26 58 89 46 50 34 81 40 25 51 62 85 9 80 71 44 100 22 30 48 74 69 54 40 38 81 66 42 40 90 60 20 75 24 74 98 28 62 79 65 65 6 14 23 3 59 29 24 64 13 8 38 29 85 75 81 36 42 3 63 99 24 72 92 35 8 71 19 77 77 66 3 79 65 15 18 15 69 60 77 91", "output": "11" }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "25" }, { "input": "100\n1 9 3 5 10 10 9 8 10 1 7 6 5 6 7 9 1 5 8 3 2 3 3 10 2 3 10 7 10 3 6 3 2 10 1 10 2 3 4 3 3 1 7 5 10 2 3 8 9 2 5 4 7 2 5 9 2 1 7 9 9 8 4 4 6 1 6 6 4 7 2 3 1 1 1 6 9 1 2 9 3 7 6 10 3 6 2 5 2 5 3 9 10 6 4 2 9 9 4 5", "output": "23" }, { "input": "100\n70 70 75 70 74 70 70 73 72 73 74 75 70 74 73 70 70 74 72 72 75 70 73 72 70 75 73 70 74 70 73 75 71 74 70 71 75 74 75 71 74 70 73 73 70 75 71 73 73 74 73 74 71 73 73 71 72 71 70 75 74 74 72 72 71 72 75 75 70 73 71 73 72 71 70 75 71 75 73 75 73 72 75 71 73 71 72 74 75 70 70 74 75 73 70 73 73 75 71 74", "output": "24" }, { "input": "100\n99 98 98 99 98 98 98 100 98 99 99 98 99 98 98 98 99 99 98 99 99 100 98 100 98 98 98 99 98 100 100 98 100 99 100 98 99 99 99 98 100 98 100 99 99 99 98 100 98 98 98 100 100 99 98 98 100 100 100 99 98 99 99 99 100 99 99 98 99 98 99 100 100 98 98 100 100 99 99 99 98 98 98 100 99 99 100 99 100 99 98 100 98 100 98 98 99 98 99 98", "output": "24" }, { "input": "100\n94 87 92 91 94 89 93 94 87 93 93 94 89 91 87 87 92 91 87 94 90 89 92 92 87 88 90 90 90 89 90 92 91 91 89 88 93 89 88 94 91 89 88 87 92 89 91 87 88 90 88 92 90 87 93 94 94 92 92 87 90 88 88 91 94 93 87 94 93 93 87 90 92 92 90 88 88 90 92 91 90 88 89 91 91 88 90 93 90 94 94 93 90 91 91 93 94 94 92 93", "output": "24" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "25" }, { "input": "10\n1 1 1 1 1 1 1 1 1 1", "output": "2" }, { "input": "7\n13 13 13 13 6 2 3", "output": "1" }, { "input": "8\n1 1 1 1 1 1 1 1", "output": "2" }, { "input": "5\n100 100 99 99 5", "output": "1" }, { "input": "8\n2 2 2 2 2 2 2 2", "output": "2" }, { "input": "8\n1 2 3 4 5 6 7 7", "output": "0" }, { "input": "8\n4 4 4 4 4 4 4 4", "output": "2" }, { "input": "10\n1 1 1 1 1 1 1 1 2 2", "output": "2" }, { "input": "4\n100 100 100 99", "output": "0" }, { "input": "4\n2 2 2 2", "output": "1" }, { "input": "5\n100 100 99 99 2", "output": "1" }, { "input": "9\n1 1 1 1 1 1 1 1 1", "output": "2" }, { "input": "5\n2 2 3 4 4", "output": "1" }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "25" }, { "input": "13\n1 2 3 4 5 6 7 8 9 10 11 12 13", "output": "0" }, { "input": "20\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "5" }, { "input": "4\n4 4 4 4", "output": "1" }, { "input": "5\n1 1 2 3 3", "output": "1" }, { "input": "5\n30 30 30 1 1", "output": "1" } ]
1,657,881,869
2,147,483,647
PyPy 3
OK
TESTS
93
93
307,200
n = int(input()) A = list(map(int, input().split())) from collections import Counter C = Counter(A) cnt = 0 for k, v in C.items(): cnt += v//2 print(cnt//2)
Title: Canvas Frames Time Limit: None seconds Memory Limit: None megabytes Problem Description: Nicholas, a painter is going to paint several new canvases. Nicholas is sure that the canvases will turn out so great that each one will need framing and being hung on the wall. Frames are what Nicholas decided to begin with. Nicholas has *n* sticks whose lengths equal *a*1,<=*a*2,<=... *a**n*. Nicholas does not want to break the sticks or glue them together. To make a *h*<=×<=*w*-sized frame, he needs two sticks whose lengths equal *h* and two sticks whose lengths equal *w*. Specifically, to make a square frame (when *h*<==<=*w*), he needs four sticks of the same length. Now Nicholas wants to make from the sticks that he has as many frames as possible; to be able to paint as many canvases as possible to fill the frames. Help him in this uneasy task. Note that it is not necessary to use all the sticks Nicholas has. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of sticks. The second line contains *n* space-separated integers. The *i*-th integer equals the length of the *i*-th stick *a**i* (1<=≤<=*a**i*<=≤<=100). Output Specification: Print the single number — the maximum number of frames Nicholas can make for his future canvases. Demo Input: ['5\n2 4 3 2 3\n', '13\n2 2 4 4 4 4 6 6 6 7 7 9 9\n', '4\n3 3 3 5\n'] Demo Output: ['1', '3', '0'] Note: none
```python n = int(input()) A = list(map(int, input().split())) from collections import Counter C = Counter(A) cnt = 0 for k, v in C.items(): cnt += v//2 print(cnt//2) ```
3
312
B
Archer
PROGRAMMING
1,300
[ "math", "probabilities" ]
null
null
SmallR is an archer. SmallR is taking a match of archer with Zanoes. They try to shoot in the target in turns, and SmallR shoots first. The probability of shooting the target each time is for SmallR while for Zanoes. The one who shoots in the target first should be the winner. Output the probability that SmallR will win the match.
A single line contains four integers .
Print a single real number, the probability that SmallR will win the match. The answer will be considered correct if the absolute or relative error doesn't exceed 10<=-<=6.
[ "1 2 1 2\n" ]
[ "0.666666666667" ]
none
1,000
[ { "input": "1 2 1 2", "output": "0.666666666667" }, { "input": "1 3 1 3", "output": "0.600000000000" }, { "input": "1 3 2 3", "output": "0.428571428571" }, { "input": "3 4 3 4", "output": "0.800000000000" }, { "input": "1 2 10 11", "output": "0.523809523810" }, { "input": "4 5 4 5", "output": "0.833333333333" }, { "input": "466 701 95 721", "output": "0.937693791148" }, { "input": "268 470 444 885", "output": "0.725614009325" }, { "input": "632 916 713 821", "output": "0.719292895126" }, { "input": "269 656 918 992", "output": "0.428937461623" }, { "input": "71 657 187 695", "output": "0.310488463257" }, { "input": "435 852 973 978", "output": "0.511844133157" }, { "input": "518 816 243 359", "output": "0.719734031025" }, { "input": "882 962 311 811", "output": "0.966386645447" }, { "input": "684 774 580 736", "output": "0.906051574446" }, { "input": "486 868 929 999", "output": "0.577723252958" }, { "input": "132 359 996 998", "output": "0.368154532345" }, { "input": "933 977 266 450", "output": "0.972879407907" }, { "input": "298 833 615 872", "output": "0.441270817024" }, { "input": "34 554 14 958", "output": "0.817324099167" }, { "input": "836 934 800 905", "output": "0.906105535462" }, { "input": "482 815 69 509", "output": "0.914365577772" }, { "input": "284 423 137 521", "output": "0.885974839378" }, { "input": "648 881 486 703", "output": "0.800911421248" }, { "input": "450 885 755 836", "output": "0.533901011176" }, { "input": "533 773 823 998", "output": "0.729222130525" }, { "input": "897 957 92 898", "output": "0.993193806364" }, { "input": "699 925 441 928", "output": "0.866816866175" }, { "input": "64 704 148 603", "output": "0.289486317811" }, { "input": "719 735 626 990", "output": "0.986124079764" }, { "input": "1 1000 1 1000", "output": "0.500250125063" } ]
1,621,137,617
2,147,483,647
Python 3
OK
TESTS
31
62
0
l1 = list(map(int, input().split())) a = l1[0] b = l1[1] c = l1[2] d = l1[3] p = a/b q = (1-c/d)*(1-a/b) prob = p/(1-q) print(prob)
Title: Archer Time Limit: None seconds Memory Limit: None megabytes Problem Description: SmallR is an archer. SmallR is taking a match of archer with Zanoes. They try to shoot in the target in turns, and SmallR shoots first. The probability of shooting the target each time is for SmallR while for Zanoes. The one who shoots in the target first should be the winner. Output the probability that SmallR will win the match. Input Specification: A single line contains four integers . Output Specification: Print a single real number, the probability that SmallR will win the match. The answer will be considered correct if the absolute or relative error doesn't exceed 10<=-<=6. Demo Input: ['1 2 1 2\n'] Demo Output: ['0.666666666667'] Note: none
```python l1 = list(map(int, input().split())) a = l1[0] b = l1[1] c = l1[2] d = l1[3] p = a/b q = (1-c/d)*(1-a/b) prob = p/(1-q) print(prob) ```
3
540
A
Combination Lock
PROGRAMMING
800
[ "implementation" ]
null
null
Scrooge McDuck keeps his most treasured savings in a home safe with a combination lock. Each time he wants to put there the treasures that he's earned fair and square, he has to open the lock. The combination lock is represented by *n* rotating disks with digits from 0 to 9 written on them. Scrooge McDuck has to turn some disks so that the combination of digits on the disks forms a secret combination. In one move, he can rotate one disk one digit forwards or backwards. In particular, in one move he can go from digit 0 to digit 9 and vice versa. What minimum number of actions does he need for that?
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of disks on the combination lock. The second line contains a string of *n* digits — the original state of the disks. The third line contains a string of *n* digits — Scrooge McDuck's combination that opens the lock.
Print a single integer — the minimum number of moves Scrooge McDuck needs to open the lock.
[ "5\n82195\n64723\n" ]
[ "13\n" ]
In the sample he needs 13 moves: - 1 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b8967f65a723782358b93eff9ce69f336817cf70.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 2 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/07fa58573ece0d32c4d555e498d2b24d2f70f36a.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 3 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cc2275d9252aae35a6867c6a5b4ba7596e9a7626.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 4 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b100aea470fcaaab4e9529b234ba0d7875943c10.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 5 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/eb2cbe4324cebca65b85816262a85e473cd65967.png" style="max-width: 100.0%;max-height: 100.0%;"/>
500
[ { "input": "5\n82195\n64723", "output": "13" }, { "input": "12\n102021090898\n010212908089", "output": "16" }, { "input": "1\n8\n1", "output": "3" }, { "input": "2\n83\n57", "output": "7" }, { "input": "10\n0728592530\n1362615763", "output": "27" }, { "input": "100\n4176196363694273682807653052945037727131821799902563705176501742060696655282954944720643131654235909\n3459912084922154505910287499879975659298239371519889866585472674423008837878123067103005344986554746", "output": "245" }, { "input": "1\n8\n1", "output": "3" }, { "input": "2\n83\n57", "output": "7" }, { "input": "3\n607\n684", "output": "5" }, { "input": "4\n0809\n0636", "output": "8" }, { "input": "5\n84284\n08941", "output": "16" }, { "input": "25\n8037856825987124762280548\n9519431339078678836940020", "output": "72" }, { "input": "125\n23269567683904664184142384849516523616863461607751021071772615078579713054027902974007001544768640273491193035874486891541257\n47635110303703399505805044019026243695451609639556649012447370081552870340011971572363458960190590266459684717415349529509024", "output": "305" }, { "input": "5\n84284\n08941", "output": "16" }, { "input": "25\n8037856825987124762285484\n9519431339078678836940202", "output": "74" }, { "input": "125\n23269567689466418414238845152168634610771021717726157879713054270294007001544768647391193035874486891412573389247025830678706\n47635110307339950580504010224954516093956649124473708152870340117152363458960190596659684717415349529090241694059599629136831", "output": "357" }, { "input": "5\n84284\n08941", "output": "16" }, { "input": "25\n8378525987476228048406972\n9194339078883694020217816", "output": "55" }, { "input": "125\n23269576839046618414238484916523616863461607750210717761078579713054027902974007015447686027349193035874486891541257338624472\n47635103037033950580504401926243695451609639556490124437081552870340011971572363489601905026645984717415349529509024169604599", "output": "274" }, { "input": "1\n0\n0", "output": "0" }, { "input": "1\n7\n7", "output": "0" }, { "input": "1\n0\n5", "output": "5" }, { "input": "1\n2\n7", "output": "5" }, { "input": "1\n7\n9", "output": "2" }, { "input": "1\n9\n7", "output": "2" }, { "input": "1\n2\n9", "output": "3" }, { "input": "1\n9\n2", "output": "3" }, { "input": "25\n3164978461316464614169874\n9413979197249127496597357", "output": "66" }, { "input": "4\n9999\n9999", "output": "0" }, { "input": "2\n11\n11", "output": "0" } ]
1,609,575,796
2,147,483,647
Python 3
OK
TESTS
43
108
0
n = input() s1 = input() s2 = input() c = 0 for i in range(int(n)): t1,t2 = int(s1[i]),int(s2[i]) t3 = abs(t1-t2) # print(t3,10-t3) c = c + min(t3,10-t3) print(c)
Title: Combination Lock Time Limit: None seconds Memory Limit: None megabytes Problem Description: Scrooge McDuck keeps his most treasured savings in a home safe with a combination lock. Each time he wants to put there the treasures that he's earned fair and square, he has to open the lock. The combination lock is represented by *n* rotating disks with digits from 0 to 9 written on them. Scrooge McDuck has to turn some disks so that the combination of digits on the disks forms a secret combination. In one move, he can rotate one disk one digit forwards or backwards. In particular, in one move he can go from digit 0 to digit 9 and vice versa. What minimum number of actions does he need for that? Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of disks on the combination lock. The second line contains a string of *n* digits — the original state of the disks. The third line contains a string of *n* digits — Scrooge McDuck's combination that opens the lock. Output Specification: Print a single integer — the minimum number of moves Scrooge McDuck needs to open the lock. Demo Input: ['5\n82195\n64723\n'] Demo Output: ['13\n'] Note: In the sample he needs 13 moves: - 1 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b8967f65a723782358b93eff9ce69f336817cf70.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 2 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/07fa58573ece0d32c4d555e498d2b24d2f70f36a.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 3 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cc2275d9252aae35a6867c6a5b4ba7596e9a7626.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 4 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b100aea470fcaaab4e9529b234ba0d7875943c10.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 5 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/eb2cbe4324cebca65b85816262a85e473cd65967.png" style="max-width: 100.0%;max-height: 100.0%;"/>
```python n = input() s1 = input() s2 = input() c = 0 for i in range(int(n)): t1,t2 = int(s1[i]),int(s2[i]) t3 = abs(t1-t2) # print(t3,10-t3) c = c + min(t3,10-t3) print(c) ```
3
431
A
Black Square
PROGRAMMING
800
[ "implementation" ]
null
null
Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone. In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip. You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares?
The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=≤<=*a*1,<=*a*2,<=*a*3,<=*a*4<=≤<=104). The second line contains string *s* (1<=≤<=|*s*|<=≤<=105), where the *і*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip.
Print a single integer — the total number of calories that Jury wastes.
[ "1 2 3 4\n123214\n", "1 5 3 2\n11221\n" ]
[ "13\n", "13\n" ]
none
500
[ { "input": "1 2 3 4\n123214", "output": "13" }, { "input": "1 5 3 2\n11221", "output": "13" }, { "input": "5 5 5 1\n3422", "output": "16" }, { "input": "4 3 2 1\n2", "output": "3" }, { "input": "5651 6882 6954 4733\n2442313421", "output": "60055" }, { "input": "0 0 0 0\n4132", "output": "0" }, { "input": "3163 5778 83 7640\n11141442444", "output": "64270" }, { "input": "1809 1302 7164 6122\n3144121413113111223311232232114144321414421243443243422322144324121433444342231344234443332241322442", "output": "420780" }, { "input": "0 0 0 0\n1", "output": "0" }, { "input": "1 2 3 4\n4", "output": "4" }, { "input": "2343 7653 1242 5432\n1", "output": "2343" }, { "input": "2343 7653 1242 5432\n2", "output": "7653" }, { "input": "2343 7653 1242 5432\n3", "output": "1242" }, { "input": "2343 7653 1242 5432\n4", "output": "5432" }, { "input": "1 2 3 4\n123412", "output": "13" }, { "input": "50 50 50 50\n11111111111111111111111111111111111111111111111111111", "output": "2650" }, { "input": "1 2 3 4\n11111111111111111111111111111111111111111111111111", "output": "50" }, { "input": "1 2 3 4\n23123231321231231231231231221232123121312321", "output": "87" }, { "input": "1 2 3 4\n1111111111111222222222233333333333444444444444444", "output": "126" }, { "input": "2 3 1 4\n121321232412342112312313213123123412131231231232", "output": "105" } ]
1,678,267,340
2,147,483,647
Python 3
OK
TESTS
49
171
0
print((lambda a, b: sum([int(x) for x in a.split()][int(i)-1] for i in b))(input(),input()))
Title: Black Square Time Limit: None seconds Memory Limit: None megabytes Problem Description: Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone. In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip. You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares? Input Specification: The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=≤<=*a*1,<=*a*2,<=*a*3,<=*a*4<=≤<=104). The second line contains string *s* (1<=≤<=|*s*|<=≤<=105), where the *і*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip. Output Specification: Print a single integer — the total number of calories that Jury wastes. Demo Input: ['1 2 3 4\n123214\n', '1 5 3 2\n11221\n'] Demo Output: ['13\n', '13\n'] Note: none
```python print((lambda a, b: sum([int(x) for x in a.split()][int(i)-1] for i in b))(input(),input())) ```
3
69
A
Young Physicist
PROGRAMMING
1,000
[ "implementation", "math" ]
A. Young Physicist
2
256
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
[ "3\n4 1 7\n-2 4 -1\n1 -5 -3\n", "3\n3 -1 7\n-5 2 -4\n2 -1 -3\n" ]
[ "NO", "YES" ]
none
500
[ { "input": "3\n4 1 7\n-2 4 -1\n1 -5 -3", "output": "NO" }, { "input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3", "output": "YES" }, { "input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41", "output": "NO" }, { "input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33", "output": "NO" }, { "input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7", "output": "NO" }, { "input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38", "output": "NO" }, { "input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6", "output": "YES" }, { "input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0", "output": "YES" }, { "input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0", "output": "YES" }, { "input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0", "output": "YES" }, { "input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0", "output": "YES" }, { "input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0", "output": "YES" }, { "input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87", "output": "YES" }, { "input": "3\n1 2 3\n3 2 1\n0 0 0", "output": "NO" }, { "input": "2\n5 -23 12\n0 0 0", "output": "NO" }, { "input": "1\n0 0 0", "output": "YES" }, { "input": "1\n1 -2 0", "output": "NO" }, { "input": "2\n-23 77 -86\n23 -77 86", "output": "YES" }, { "input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82", "output": "YES" }, { "input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0", "output": "YES" }, { "input": "3\n96 49 -12\n2 -66 28\n-98 17 -16", "output": "YES" }, { "input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0", "output": "YES" }, { "input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53", "output": "YES" }, { "input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1", "output": "YES" }, { "input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0", "output": "YES" }, { "input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0", "output": "YES" }, { "input": "3\n0 2 -2\n1 -1 3\n-3 0 0", "output": "NO" } ]
1,619,672,132
2,147,483,647
Python 3
OK
TESTS
81
154
0
number = int(input()) columnOne = 0 columnTwo = 0 columnThree = 0 for k in range(number): s = input() c = s.split() columnOne+=int(c[0]) columnTwo+=int(c[1]) columnThree+=int(c[2]) if(columnOne == 0 and columnTwo == 0 and columnThree == 0): print('YES') else: print('NO')
Title: Young Physicist Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. Input Specification: The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). Output Specification: Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. Demo Input: ['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n'] Demo Output: ['NO', 'YES'] Note: none
```python number = int(input()) columnOne = 0 columnTwo = 0 columnThree = 0 for k in range(number): s = input() c = s.split() columnOne+=int(c[0]) columnTwo+=int(c[1]) columnThree+=int(c[2]) if(columnOne == 0 and columnTwo == 0 and columnThree == 0): print('YES') else: print('NO') ```
3.9615
765
D
Artsem and Saunders
PROGRAMMING
1,700
[ "constructive algorithms", "dsu", "math" ]
null
null
Artsem has a friend Saunders from University of Chicago. Saunders presented him with the following problem. Let [*n*] denote the set {1,<=...,<=*n*}. We will also write *f*:<=[*x*]<=→<=[*y*] when a function *f* is defined in integer points 1, ..., *x*, and all its values are integers from 1 to *y*. Now then, you are given a function *f*:<=[*n*]<=→<=[*n*]. Your task is to find a positive integer *m*, and two functions *g*:<=[*n*]<=→<=[*m*], *h*:<=[*m*]<=→<=[*n*], such that *g*(*h*(*x*))<==<=*x* for all , and *h*(*g*(*x*))<==<=*f*(*x*) for all , or determine that finding these is impossible.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=105). The second line contains *n* space-separated integers — values *f*(1),<=...,<=*f*(*n*) (1<=≤<=*f*(*i*)<=≤<=*n*).
If there is no answer, print one integer -1. Otherwise, on the first line print the number *m* (1<=≤<=*m*<=≤<=106). On the second line print *n* numbers *g*(1),<=...,<=*g*(*n*). On the third line print *m* numbers *h*(1),<=...,<=*h*(*m*). If there are several correct answers, you may output any of them. It is guaranteed that if a valid answer exists, then there is an answer satisfying the above restrictions.
[ "3\n1 2 3\n", "3\n2 2 2\n", "2\n2 1\n" ]
[ "3\n1 2 3\n1 2 3\n", "1\n1 1 1\n2\n", "-1\n" ]
none
2,000
[ { "input": "3\n1 2 3", "output": "3\n1 2 3\n1 2 3" }, { "input": "3\n2 2 2", "output": "1\n1 1 1\n2" }, { "input": "2\n2 1", "output": "-1" }, { "input": "1\n1", "output": "1\n1\n1" }, { "input": "2\n2 1", "output": "-1" }, { "input": "2\n2 2", "output": "1\n1 1\n2" }, { "input": "5\n5 5 5 3 5", "output": "-1" }, { "input": "10\n4 4 4 4 4 4 4 4 4 4", "output": "1\n1 1 1 1 1 1 1 1 1 1\n4" }, { "input": "2\n1 2", "output": "2\n1 2\n1 2" }, { "input": "3\n3 2 3", "output": "2\n2 1 2\n2 3" }, { "input": "3\n1 2 1", "output": "2\n1 2 1\n1 2" }, { "input": "4\n4 2 4 4", "output": "2\n2 1 2 2\n2 4" }, { "input": "5\n1 4 5 4 5", "output": "3\n1 2 3 2 3\n1 4 5" }, { "input": "4\n1 2 1 2", "output": "2\n1 2 1 2\n1 2" }, { "input": "5\n1 3 3 4 4", "output": "3\n1 2 2 3 3\n1 3 4" }, { "input": "4\n4 2 2 4", "output": "2\n2 1 1 2\n2 4" }, { "input": "7\n7 3 3 5 5 7 7", "output": "3\n3 1 1 2 2 3 3\n3 5 7" }, { "input": "6\n1 1 1 3 3 3", "output": "-1" }, { "input": "4\n2 2 3 2", "output": "2\n1 1 2 1\n2 3" }, { "input": "6\n1 2 3 4 5 5", "output": "5\n1 2 3 4 5 5\n1 2 3 4 5" }, { "input": "3\n1 1 2", "output": "-1" }, { "input": "4\n3 4 3 4", "output": "2\n1 2 1 2\n3 4" }, { "input": "6\n1 1 1 4 4 4", "output": "2\n1 1 1 2 2 2\n1 4" }, { "input": "4\n1 2 1 1", "output": "2\n1 2 1 1\n1 2" }, { "input": "5\n1 2 3 4 3", "output": "4\n1 2 3 4 3\n1 2 3 4" }, { "input": "4\n2 2 4 4", "output": "2\n1 1 2 2\n2 4" }, { "input": "4\n1 1 3 3", "output": "2\n1 1 2 2\n1 3" }, { "input": "3\n2 2 3", "output": "2\n1 1 2\n2 3" }, { "input": "5\n5 3 3 3 5", "output": "2\n2 1 1 1 2\n3 5" } ]
1,487,426,230
2,147,483,647
PyPy 3
OK
TESTS
43
295
33,177,600
n = int(input()) f = [int(x) - 1 for x in input().split()] p = [-1] * n g = [0] * n h = [0] * n m = 0 for i in range(n): if f[i] == i: p[i] = m h[m] = i + 1 m += 1 h = h[:m] for i in range(n): if p[f[i]] == -1: print(-1) exit() g[i] = p[f[i]] + 1 print(m) print(" ".join([str(x) for x in g])) print(" ".join([str(x) for x in h]))
Title: Artsem and Saunders Time Limit: None seconds Memory Limit: None megabytes Problem Description: Artsem has a friend Saunders from University of Chicago. Saunders presented him with the following problem. Let [*n*] denote the set {1,<=...,<=*n*}. We will also write *f*:<=[*x*]<=→<=[*y*] when a function *f* is defined in integer points 1, ..., *x*, and all its values are integers from 1 to *y*. Now then, you are given a function *f*:<=[*n*]<=→<=[*n*]. Your task is to find a positive integer *m*, and two functions *g*:<=[*n*]<=→<=[*m*], *h*:<=[*m*]<=→<=[*n*], such that *g*(*h*(*x*))<==<=*x* for all , and *h*(*g*(*x*))<==<=*f*(*x*) for all , or determine that finding these is impossible. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=105). The second line contains *n* space-separated integers — values *f*(1),<=...,<=*f*(*n*) (1<=≤<=*f*(*i*)<=≤<=*n*). Output Specification: If there is no answer, print one integer -1. Otherwise, on the first line print the number *m* (1<=≤<=*m*<=≤<=106). On the second line print *n* numbers *g*(1),<=...,<=*g*(*n*). On the third line print *m* numbers *h*(1),<=...,<=*h*(*m*). If there are several correct answers, you may output any of them. It is guaranteed that if a valid answer exists, then there is an answer satisfying the above restrictions. Demo Input: ['3\n1 2 3\n', '3\n2 2 2\n', '2\n2 1\n'] Demo Output: ['3\n1 2 3\n1 2 3\n', '1\n1 1 1\n2\n', '-1\n'] Note: none
```python n = int(input()) f = [int(x) - 1 for x in input().split()] p = [-1] * n g = [0] * n h = [0] * n m = 0 for i in range(n): if f[i] == i: p[i] = m h[m] = i + 1 m += 1 h = h[:m] for i in range(n): if p[f[i]] == -1: print(-1) exit() g[i] = p[f[i]] + 1 print(m) print(" ".join([str(x) for x in g])) print(" ".join([str(x) for x in h])) ```
3
743
C
Vladik and fractions
PROGRAMMING
1,500
[ "brute force", "constructive algorithms", "math", "number theory" ]
null
null
Vladik and Chloe decided to determine who of them is better at math. Vladik claimed that for any positive integer *n* he can represent fraction as a sum of three distinct positive fractions in form . Help Vladik with that, i.e for a given *n* find three distinct positive integers *x*, *y* and *z* such that . Because Chloe can't check Vladik's answer if the numbers are large, he asks you to print numbers not exceeding 109. If there is no such answer, print -1.
The single line contains single integer *n* (1<=≤<=*n*<=≤<=104).
If the answer exists, print 3 distinct numbers *x*, *y* and *z* (1<=≤<=*x*,<=*y*,<=*z*<=≤<=109, *x*<=≠<=*y*, *x*<=≠<=*z*, *y*<=≠<=*z*). Otherwise print -1. If there are multiple answers, print any of them.
[ "3\n", "7\n" ]
[ "2 7 42\n", "7 8 56\n" ]
none
1,250
[ { "input": "3", "output": "2 7 42" }, { "input": "7", "output": "7 8 56" }, { "input": "2", "output": "2 3 6" }, { "input": "5", "output": "5 6 30" }, { "input": "4", "output": "4 5 20" }, { "input": "7", "output": "7 8 56" }, { "input": "82", "output": "82 83 6806" }, { "input": "56", "output": "56 57 3192" }, { "input": "30", "output": "30 31 930" }, { "input": "79", "output": "79 80 6320" }, { "input": "28", "output": "28 29 812" }, { "input": "4116", "output": "4116 4117 16945572" }, { "input": "1", "output": "-1" }, { "input": "6491", "output": "6491 6492 42139572" }, { "input": "8865", "output": "8865 8866 78597090" }, { "input": "1239", "output": "1239 1240 1536360" }, { "input": "3614", "output": "3614 3615 13064610" }, { "input": "5988", "output": "5988 5989 35862132" }, { "input": "8363", "output": "8363 8364 69948132" }, { "input": "737", "output": "737 738 543906" }, { "input": "3112", "output": "3112 3113 9687656" }, { "input": "9562", "output": "9562 9563 91441406" }, { "input": "1936", "output": "1936 1937 3750032" }, { "input": "4311", "output": "4311 4312 18589032" }, { "input": "6685", "output": "6685 6686 44695910" }, { "input": "9060", "output": "9060 9061 82092660" }, { "input": "1434", "output": "1434 1435 2057790" }, { "input": "3809", "output": "3809 3810 14512290" }, { "input": "6183", "output": "6183 6184 38235672" }, { "input": "8558", "output": "8558 8559 73247922" }, { "input": "932", "output": "932 933 869556" }, { "input": "7274", "output": "7274 7275 52918350" }, { "input": "9648", "output": "9648 9649 93093552" }, { "input": "2023", "output": "2023 2024 4094552" }, { "input": "4397", "output": "4397 4398 19338006" }, { "input": "6772", "output": "6772 6773 45866756" }, { "input": "9146", "output": "9146 9147 83658462" }, { "input": "1521", "output": "1521 1522 2314962" }, { "input": "4938", "output": "4938 4939 24388782" }, { "input": "6143", "output": "6143 6144 37742592" }, { "input": "6230", "output": "6230 6231 38819130" }, { "input": "10000", "output": "10000 10001 100010000" }, { "input": "1", "output": "-1" }, { "input": "101", "output": "101 102 10302" }, { "input": "9999", "output": "9999 10000 99990000" }, { "input": "512", "output": "512 513 262656" }, { "input": "511", "output": "511 512 261632" }, { "input": "513", "output": "513 514 263682" }, { "input": "9973", "output": "9973 9974 99470702" }, { "input": "9972", "output": "9972 9973 99450756" }, { "input": "9974", "output": "9974 9975 99490650" }, { "input": "9409", "output": "9409 9410 88538690" }, { "input": "9408", "output": "9408 9409 88519872" }, { "input": "9410", "output": "9410 9411 88557510" }, { "input": "719", "output": "719 720 517680" }, { "input": "720", "output": "720 721 519120" }, { "input": "721", "output": "721 722 520562" }, { "input": "9796", "output": "9796 9797 95971412" }, { "input": "9797", "output": "9797 9798 95991006" }, { "input": "9798", "output": "9798 9799 96010602" }, { "input": "4999", "output": "4999 5000 24995000" }, { "input": "9998", "output": "9998 9999 99970002" } ]
1,486,320,878
2,147,483,647
Python 3
OK
TESTS
62
77
4,608,000
n=input() n=int(n) if n!=1: print(n,n+1,n*(n+1)) else: print(-1)
Title: Vladik and fractions Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vladik and Chloe decided to determine who of them is better at math. Vladik claimed that for any positive integer *n* he can represent fraction as a sum of three distinct positive fractions in form . Help Vladik with that, i.e for a given *n* find three distinct positive integers *x*, *y* and *z* such that . Because Chloe can't check Vladik's answer if the numbers are large, he asks you to print numbers not exceeding 109. If there is no such answer, print -1. Input Specification: The single line contains single integer *n* (1<=≤<=*n*<=≤<=104). Output Specification: If the answer exists, print 3 distinct numbers *x*, *y* and *z* (1<=≤<=*x*,<=*y*,<=*z*<=≤<=109, *x*<=≠<=*y*, *x*<=≠<=*z*, *y*<=≠<=*z*). Otherwise print -1. If there are multiple answers, print any of them. Demo Input: ['3\n', '7\n'] Demo Output: ['2 7 42\n', '7 8 56\n'] Note: none
```python n=input() n=int(n) if n!=1: print(n,n+1,n*(n+1)) else: print(-1) ```
3
855
A
Tom Riddle's Diary
PROGRAMMING
800
[ "brute force", "implementation", "strings" ]
null
null
Harry Potter is on a mission to destroy You-Know-Who's Horcruxes. The first Horcrux that he encountered in the Chamber of Secrets is Tom Riddle's diary. The diary was with Ginny and it forced her to open the Chamber of Secrets. Harry wants to know the different people who had ever possessed the diary to make sure they are not under its influence. He has names of *n* people who possessed the diary in order. You need to tell, for each person, if he/she possessed the diary at some point before or not. Formally, for a name *s**i* in the *i*-th line, output "YES" (without quotes) if there exists an index *j* such that *s**i*<==<=*s**j* and *j*<=&lt;<=*i*, otherwise, output "NO" (without quotes).
First line of input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of names in the list. Next *n* lines each contain a string *s**i*, consisting of lowercase English letters. The length of each string is between 1 and 100.
Output *n* lines each containing either "YES" or "NO" (without quotes), depending on whether this string was already present in the stream or not. You can print each letter in any case (upper or lower).
[ "6\ntom\nlucius\nginny\nharry\nginny\nharry\n", "3\na\na\na\n" ]
[ "NO\nNO\nNO\nNO\nYES\nYES\n", "NO\nYES\nYES\n" ]
In test case 1, for *i* = 5 there exists *j* = 3 such that *s*<sub class="lower-index">*i*</sub> = *s*<sub class="lower-index">*j*</sub> and *j* &lt; *i*, which means that answer for *i* = 5 is "YES".
500
[ { "input": "6\ntom\nlucius\nginny\nharry\nginny\nharry", "output": "NO\nNO\nNO\nNO\nYES\nYES" }, { "input": "3\na\na\na", "output": "NO\nYES\nYES" }, { "input": "1\nzn", "output": "NO" }, { "input": "9\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nhrtm\nssjqvixduertmotgagizamvfucfwtxqnhuowbqbzctgznivehelpcyigwrbbdsxnewfqvcf\nhyrtxvozpbveexfkgalmguozzakitjiwsduqxonb\nwcyxteiwtcyuztaguilqpbiwcwjaiq\nwcyxteiwtcyuztaguilqpbiwcwjaiq\nbdbivqzvhggth", "output": "NO\nYES\nYES\nNO\nNO\nNO\nNO\nYES\nNO" }, { "input": "10\nkkiubdktydpdcbbttwpfdplhhjhrpqmpg\nkkiubdktydpdcbbttwpfdplhhjhrpqmpg\nmvutw\nqooeqoxzxwetlpecqiwgdbogiqqulttysyohwhzxzphvsfmnplizxoebzcvvfyppqbhxjksuzepuezqqzxlfmdanoeaoqmor\nmvutw\nvchawxjoreboqzuklifv\nvchawxjoreboqzuklifv\nnivijte\nrflybruq\nvchawxjoreboqzuklifv", "output": "NO\nYES\nNO\nNO\nYES\nNO\nYES\nNO\nNO\nYES" }, { "input": "1\nz", "output": "NO" }, { "input": "9\nl\ny\nm\nj\nn\nr\nj\nk\nf", "output": "NO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nNO" }, { "input": "14\nw\na\nh\np\nk\nw\ny\nv\ns\nf\nx\nd\nk\nr", "output": "NO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO" }, { "input": "25\np\nk\nu\nl\nf\nt\nc\ns\nq\nd\nb\nq\no\ni\ni\nd\ni\nw\nn\ng\nw\nt\na\ne\ni", "output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nYES\nYES\nYES\nNO\nNO\nNO\nYES\nYES\nNO\nNO\nYES" }, { "input": "20\nd\nh\ng\no\np\ne\nt\nj\nv\ni\nt\nh\ns\ni\nw\nf\nx\na\nl\ni", "output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nYES\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nYES" }, { "input": "3\nbbbbbbb\nbbbbbbbbb\nbbbbbbbbbbbbbbbbbbbbbbbbbbbb", "output": "NO\nNO\nNO" }, { "input": "2\nab\nba", "output": "NO\nNO" }, { "input": "6\ntom\nlucius\nginnys\nharpy\nginny\nharry", "output": "NO\nNO\nNO\nNO\nNO\nNO" }, { "input": "2\nabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcde\nabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcde", "output": "NO\nYES" }, { "input": "42\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na", "output": "NO\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES" } ]
1,699,492,059
2,147,483,647
Python 3
OK
TESTS
55
46
0
b = int(input()) v = [] s = 0 for i in range(b): a = input() v.append(a) for o in v: s += 1 if v[:s].count(o) > 1: print("YES") else: print("NO")
Title: Tom Riddle's Diary Time Limit: None seconds Memory Limit: None megabytes Problem Description: Harry Potter is on a mission to destroy You-Know-Who's Horcruxes. The first Horcrux that he encountered in the Chamber of Secrets is Tom Riddle's diary. The diary was with Ginny and it forced her to open the Chamber of Secrets. Harry wants to know the different people who had ever possessed the diary to make sure they are not under its influence. He has names of *n* people who possessed the diary in order. You need to tell, for each person, if he/she possessed the diary at some point before or not. Formally, for a name *s**i* in the *i*-th line, output "YES" (without quotes) if there exists an index *j* such that *s**i*<==<=*s**j* and *j*<=&lt;<=*i*, otherwise, output "NO" (without quotes). Input Specification: First line of input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of names in the list. Next *n* lines each contain a string *s**i*, consisting of lowercase English letters. The length of each string is between 1 and 100. Output Specification: Output *n* lines each containing either "YES" or "NO" (without quotes), depending on whether this string was already present in the stream or not. You can print each letter in any case (upper or lower). Demo Input: ['6\ntom\nlucius\nginny\nharry\nginny\nharry\n', '3\na\na\na\n'] Demo Output: ['NO\nNO\nNO\nNO\nYES\nYES\n', 'NO\nYES\nYES\n'] Note: In test case 1, for *i* = 5 there exists *j* = 3 such that *s*<sub class="lower-index">*i*</sub> = *s*<sub class="lower-index">*j*</sub> and *j* &lt; *i*, which means that answer for *i* = 5 is "YES".
```python b = int(input()) v = [] s = 0 for i in range(b): a = input() v.append(a) for o in v: s += 1 if v[:s].count(o) > 1: print("YES") else: print("NO") ```
3
686
A
Free Ice Cream
PROGRAMMING
800
[ "constructive algorithms", "implementation" ]
null
null
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer. At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue). If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress. Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109). Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
[ "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n", "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n" ]
[ "22 1\n", "3 2\n" ]
Consider the first sample. 1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
500
[ { "input": "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20", "output": "22 1" }, { "input": "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98", "output": "3 2" }, { "input": "6 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000", "output": "7000000000 0" }, { "input": "5 12\n- 12\n+ 7\n- 6\n- 1\n+ 46", "output": "46 0" }, { "input": "11 1000\n- 100\n+ 100\n+ 100\n+ 100\n+ 100\n- 100\n- 100\n- 100\n- 100\n- 100\n- 100", "output": "700 0" }, { "input": "1 0\n- 526403222", "output": "0 1" }, { "input": "1 897986543\n- 371188251", "output": "526798292 0" }, { "input": "1 0\n+ 1", "output": "1 0" }, { "input": "1 0\n- 1", "output": "0 1" }, { "input": "1 10\n+ 10", "output": "20 0" }, { "input": "1 3\n- 5", "output": "3 1" }, { "input": "1 0\n- 5", "output": "0 1" }, { "input": "1 0\n+ 5", "output": "5 0" } ]
1,633,449,268
2,147,483,647
PyPy 3
OK
TESTS
34
124
21,606,400
a,b = map(int,input().split()) availablepacks = b d = 0 f = 0 g = 0 for i in range(a): s = input() p,q = map(str,s.split()) if p == "+": availablepacks += int(q) f += 1 else: if int(q) <= availablepacks: availablepacks -= int(q) g += 1 else: d += 1 print(availablepacks,d)
Title: Free Ice Cream Time Limit: None seconds Memory Limit: None megabytes Problem Description: After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer. At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue). If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress. Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids. Input Specification: The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109). Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place. Output Specification: Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress. Demo Input: ['5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n', '5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n'] Demo Output: ['22 1\n', '3 2\n'] Note: Consider the first sample. 1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
```python a,b = map(int,input().split()) availablepacks = b d = 0 f = 0 g = 0 for i in range(a): s = input() p,q = map(str,s.split()) if p == "+": availablepacks += int(q) f += 1 else: if int(q) <= availablepacks: availablepacks -= int(q) g += 1 else: d += 1 print(availablepacks,d) ```
3
932
A
Palindromic Supersequence
PROGRAMMING
800
[ "constructive algorithms" ]
null
null
You are given a string *A*. Find a string *B*, where *B* is a palindrome and *A* is a subsequence of *B*. A subsequence of a string is a string that can be derived from it by deleting some (not necessarily consecutive) characters without changing the order of the remaining characters. For example, "cotst" is a subsequence of "contest". A palindrome is a string that reads the same forward or backward. The length of string *B* should be at most 104. It is guaranteed that there always exists such string. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104.
First line contains a string *A* (1<=≤<=|*A*|<=≤<=103) consisting of lowercase Latin letters, where |*A*| is a length of *A*.
Output single line containing *B* consisting of only lowercase Latin letters. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. If there are many possible *B*, print any of them.
[ "aba\n", "ab\n" ]
[ "aba", "aabaa" ]
In the first example, "aba" is a subsequence of "aba" which is a palindrome. In the second example, "ab" is a subsequence of "aabaa" which is a palindrome.
500
[ { "input": "aba", "output": "abaaba" }, { "input": "ab", "output": "abba" }, { "input": "krnyoixirslfszfqivgkaflgkctvbvksipwomqxlyqxhlbceuhbjbfnhofcgpgwdseffycthmlpcqejgskwjkbkbbmifnurnwyhevsoqzmtvzgfiqajfrgyuzxnrtxectcnlyoisbglpdbjbslxlpoymrcxmdtqhcnlvtqdwftuzgbdxsyscwbrguostbelnvtaqdmkmihmoxqtqlxvlsssisvqvvzotoyqryuyqwoknnqcqggysrqpkrccvyhxsjmhoqoyocwcriplarjoyiqrmmpmueqbsbljddwrumauczfziodpudheexalbwpiypmdjlmwtgdrzhpxneofhqzjdmurgvmrwdotuwyknlrbvuvtnhiouvqitgyfgfieonbaapyhwpcrmehxcpkijzfiayfvoxkpa", "output": "krnyoixirslfszfqivgkaflgkctvbvksipwomqxlyqxhlbceuhbjbfnhofcgpgwdseffycthmlpcqejgskwjkbkbbmifnurnwyhevsoqzmtvzgfiqajfrgyuzxnrtxectcnlyoisbglpdbjbslxlpoymrcxmdtqhcnlvtqdwftuzgbdxsyscwbrguostbelnvtaqdmkmihmoxqtqlxvlsssisvqvvzotoyqryuyqwoknnqcqggysrqpkrccvyhxsjmhoqoyocwcriplarjoyiqrmmpmueqbsbljddwrumauczfziodpudheexalbwpiypmdjlmwtgdrzhpxneofhqzjdmurgvmrwdotuwyknlrbvuvtnhiouvqitgyfgfieonbaapyhwpcrmehxcpkijzfiayfvoxkpaapkxovfyaifzjikpcxhemrcpwhypaabnoeifgfygtiqvuoihntvuvbrlnkywutodwrmvgrumdjzqhfoenxphzrdgtwmljdm..." }, { "input": "mgrfmzxqpejcixxppqgvuawutgrmezjkteofjbnrvzzkvjtacfxjjokisavsgrslryxfqgrmdsqwptajbqzvethuljbdatxghfzqrwvfgakwmoawlzqjypmhllbbuuhbpriqsnibywlgjlxowyzagrfnqafvcqwktkcjwejevzbnxhsfmwojshcdypnvbuhhuzqmgovmvgwiizatoxgblyudipahfbkewmuneoqhjmbpdtwnznblwvtjrniwlbyblhppndspojrouffazpoxtqdfpjuhitvijrohavpqatofxwmksvjcvhdecxwwmosqiczjpkfafqlboxosnjgzgdraehzdltthemeusxhiiimrdrugabnxwsygsktkcslhjebfexucsyvlwrptebkjhefsvfrmcqqdlanbetrgzwylizmrystvpgrkhlicfadco", "output": "mgrfmzxqpejcixxppqgvuawutgrmezjkteofjbnrvzzkvjtacfxjjokisavsgrslryxfqgrmdsqwptajbqzvethuljbdatxghfzqrwvfgakwmoawlzqjypmhllbbuuhbpriqsnibywlgjlxowyzagrfnqafvcqwktkcjwejevzbnxhsfmwojshcdypnvbuhhuzqmgovmvgwiizatoxgblyudipahfbkewmuneoqhjmbpdtwnznblwvtjrniwlbyblhppndspojrouffazpoxtqdfpjuhitvijrohavpqatofxwmksvjcvhdecxwwmosqiczjpkfafqlboxosnjgzgdraehzdltthemeusxhiiimrdrugabnxwsygsktkcslhjebfexucsyvlwrptebkjhefsvfrmcqqdlanbetrgzwylizmrystvpgrkhlicfadcoocdafcilhkrgpvtsyrmzilywzgrtebnaldqqcmrfvsfehjkbetprwlvyscuxef..." }, { "input": "hdmasfcjuigrwjchmjslmpynewnzpphmudzcbxzdexjuhktdtcoibzvevsmwaxakrtdfoivkvoooypyemiidadquqepxwqkesdnakxkbzrcjkgvwwxtqxvfpxcwitljyehldgsjytmekimkkndjvnzqtjykiymkmdzpwakxdtkzcqcatlevppgfhyykgmipuodjrnfjzhcmjdbzvhywprbwdcfxiffpzbjbmbyijkqnosslqbfvvicxvoeuzruraetglthgourzhfpnubzvblfzmmbgepjjyshchthulxar", "output": "hdmasfcjuigrwjchmjslmpynewnzpphmudzcbxzdexjuhktdtcoibzvevsmwaxakrtdfoivkvoooypyemiidadquqepxwqkesdnakxkbzrcjkgvwwxtqxvfpxcwitljyehldgsjytmekimkkndjvnzqtjykiymkmdzpwakxdtkzcqcatlevppgfhyykgmipuodjrnfjzhcmjdbzvhywprbwdcfxiffpzbjbmbyijkqnosslqbfvvicxvoeuzruraetglthgourzhfpnubzvblfzmmbgepjjyshchthulxarraxluhthchsyjjpegbmmzflbvzbunpfhzruoghtlgtearurzueovxcivvfbqlssonqkjiybmbjbzpffixfcdwbrpwyhvzbdjmchzjfnrjdoupimgkyyhfgppveltacqczktdxkawpzdmkmyikyjtqznvjdnkkmikemtyjsgdlheyjltiwcxpfvxqtxwwvgkjcrzbkxkandsekqwxpequ..." }, { "input": "fggbyzobbmxtwdajawqdywnppflkkmtxzjvxopqvliwdwhzepcuiwelhbuotlkvesexnwkytonfrpqcxzzqzdvsmbsjcxxeugavekozfjlolrtqgwzqxsfgrnvrgfrqpixhsskbpzghndesvwptpvvkasfalzsetopervpwzmkgpcexqnvtnoulprwnowmsorscecvvvrjfwumcjqyrounqsgdruxttvtmrkivtxauhosokdiahsyrftzsgvgyveqwkzhqstbgywrvmsgfcfyuxpphvmyydzpohgdicoxbtjnsbyhoidnkrialowvlvmjpxcfeygqzphmbcjkupojsmmuqlydixbaluwezvnfasjfxilbyllwyipsmovdzosuwotcxerzcfuvxprtziseshjfcosalyqglpotxvxaanpocypsiyazsejjoximnbvqucftuvdksaxutvjeunodbipsumlaymjnzljurefjg", "output": "fggbyzobbmxtwdajawqdywnppflkkmtxzjvxopqvliwdwhzepcuiwelhbuotlkvesexnwkytonfrpqcxzzqzdvsmbsjcxxeugavekozfjlolrtqgwzqxsfgrnvrgfrqpixhsskbpzghndesvwptpvvkasfalzsetopervpwzmkgpcexqnvtnoulprwnowmsorscecvvvrjfwumcjqyrounqsgdruxttvtmrkivtxauhosokdiahsyrftzsgvgyveqwkzhqstbgywrvmsgfcfyuxpphvmyydzpohgdicoxbtjnsbyhoidnkrialowvlvmjpxcfeygqzphmbcjkupojsmmuqlydixbaluwezvnfasjfxilbyllwyipsmovdzosuwotcxerzcfuvxprtziseshjfcosalyqglpotxvxaanpocypsiyazsejjoximnbvqucftuvdksaxutvjeunodbipsumlaymjnzljurefjggjferujlznjmyalmuspib..." }, { "input": "qyyxqkbxsvfnjzttdqmpzinbdgayllxpfrpopwciejjjzadguurnnhvixgueukugkkjyghxknedojvmdrskswiotgatsajowionuiumuhyggjuoympuxyfahwftwufvocdguxmxabbxnfviscxtilzzauizsgugwcqtbqgoosefhkumhodwpgolfdkbuiwlzjydonwbgyzzrjwxnceltqgqelrrljmzdbftmaogiuosaqhngmdzxzlmyrwefzhqawmkdckfnyyjgdjgadtfjvrkdwysqofcgyqrnyzutycvspzbjmmesobvhshtqlrytztyieknnkporrbcmlopgtknlmsstzkigreqwgsvagmvbrvwypoxttmzzsgm", "output": "qyyxqkbxsvfnjzttdqmpzinbdgayllxpfrpopwciejjjzadguurnnhvixgueukugkkjyghxknedojvmdrskswiotgatsajowionuiumuhyggjuoympuxyfahwftwufvocdguxmxabbxnfviscxtilzzauizsgugwcqtbqgoosefhkumhodwpgolfdkbuiwlzjydonwbgyzzrjwxnceltqgqelrrljmzdbftmaogiuosaqhngmdzxzlmyrwefzhqawmkdckfnyyjgdjgadtfjvrkdwysqofcgyqrnyzutycvspzbjmmesobvhshtqlrytztyieknnkporrbcmlopgtknlmsstzkigreqwgsvagmvbrvwypoxttmzzsgmmgszzmttxopywvrbvmgavsgwqergikztssmlnktgpolmcbrropknnkeiytztyrlqthshvbosemmjbzpsvcytuzynrqygcfoqsywdkrvjftdagjdgjyynfkcdkmwaqhzfewry..." }, { "input": "scvlhflaqvniyiyofonowwcuqajuwscdrzhbvasymvqfnthzvtjcfuaftrbjghhvslcohwpxkggrbtatjtgehuqtorwinwvrtdldyoeeozxwippuahgkuehvsmyqtodqvlufqqmqautaqirvwzvtodzxtgxiinubhrbeoiybidutrqamsdnasctxatzkvkjkrmavdravnsxyngjlugwftmhmcvvxdbfndurrbmcpuoigjpssqcortmqoqttrabhoqvopjkxvpbqdqsilvlplhgqazauyvnodsxtwnomlinjpozwhrgrkqwmlwcwdkxjxjftexiavwrejvdjcfptterblxysjcheesyqsbgdrzjxbfjqgjgmvccqcyj", "output": "scvlhflaqvniyiyofonowwcuqajuwscdrzhbvasymvqfnthzvtjcfuaftrbjghhvslcohwpxkggrbtatjtgehuqtorwinwvrtdldyoeeozxwippuahgkuehvsmyqtodqvlufqqmqautaqirvwzvtodzxtgxiinubhrbeoiybidutrqamsdnasctxatzkvkjkrmavdravnsxyngjlugwftmhmcvvxdbfndurrbmcpuoigjpssqcortmqoqttrabhoqvopjkxvpbqdqsilvlplhgqazauyvnodsxtwnomlinjpozwhrgrkqwmlwcwdkxjxjftexiavwrejvdjcfptterblxysjcheesyqsbgdrzjxbfjqgjgmvccqcyjjycqccvmgjgqjfbxjzrdgbsqyseehcjsyxlbrettpfcjdvjerwvaixetfjxjxkdwcwlmwqkrgrhwzopjnilmonwtxsdonvyuazaqghlplvlisqdqbpvxkjpovqohbarttqoqm..." }, { "input": "oohkqxxtvxzmvfjjxyjwlbqmeqwwlienzkdbhswgfbkhfygltsucdijozwaiewpixapyazfztksjeoqjugjfhdbqzuezbuajfvvffkwprroyivfoocvslejffgxuiofisenroxoeixmdbzonmreikpflciwsbafrdqfvdfojgoziiibqhwwsvhnzmptgirqqulkgmyzrfekzqqujmdumxkudsgexisupedisgmdgebvlvrpyfrbrqjknrxyzfpwmsxjxismgd", "output": "oohkqxxtvxzmvfjjxyjwlbqmeqwwlienzkdbhswgfbkhfygltsucdijozwaiewpixapyazfztksjeoqjugjfhdbqzuezbuajfvvffkwprroyivfoocvslejffgxuiofisenroxoeixmdbzonmreikpflciwsbafrdqfvdfojgoziiibqhwwsvhnzmptgirqqulkgmyzrfekzqqujmdumxkudsgexisupedisgmdgebvlvrpyfrbrqjknrxyzfpwmsxjxismgddgmsixjxsmwpfzyxrnkjqrbrfyprvlvbegdmgsidepusixegsdukxmudmjuqqzkefrzymgkluqqrigtpmznhvswwhqbiiizogjofdvfqdrfabswiclfpkiermnozbdmxieoxornesifoiuxgffjelsvcoofviyorrpwkffvvfjaubzeuzqbdhfjgujqoejsktzfzaypaxipweiawzojidcustlgyfhkbfgwshbdkzneilwwqemqblw..." }, { "input": "gilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlwzjyeyfktduzdjnivcldjjarfzmmdbyytvipbbnjqolfnlqjpidotxxfobgtgpvjmpddcyddwdcjsxxumuoyznhpvpqccgqnuouzojntanfwctthcgynrukcvshsuuqrxfdvqqggaatwytikkitywtaaggqqvdfxrquushsvckurnygchttcwfnatnjozuounqgccqpvphnzyoumuxxsjcdwddycddpmjvpgtgbofxxtodipjqlnfloqjnbbpivtyybdmmzfrajjdlcvinjdzudtkfyeyjzwlzcnrgkdxrnjwyfwtnzawmeljknllaqhrgdagttixpljuupcivnlejkemrqnafdigjzxiohlig", "output": "gilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlwzjyeyfktduzdjnivcldjjarfzmmdbyytvipbbnjqolfnlqjpidotxxfobgtgpvjmpddcyddwdcjsxxumuoyznhpvpqccgqnuouzojntanfwctthcgynrukcvshsuuqrxfdvqqggaatwytikkitywtaaggqqvdfxrquushsvckurnygchttcwfnatnjozuounqgccqpvphnzyoumuxxsjcdwddycddpmjvpgtgbofxxtodipjqlnfloqjnbbpivtyybdmmzfrajjdlcvinjdzudtkfyeyjzwlzcnrgkdxrnjwyfwtnzawmeljknllaqhrgdagttixpljuupcivnlejkemrqnafdigjzxiohliggilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlw..." }, { "input": "abcab", "output": "abcabbacba" }, { "input": "baaaaaaa", "output": "baaaaaaaaaaaaaab" }, { "input": "baaaaaa", "output": "baaaaaaaaaaaab" }, { "input": "baaaaaaaaa", "output": "baaaaaaaaaaaaaaaaaab" }, { "input": "baaaaaaaa", "output": "baaaaaaaaaaaaaaaab" } ]
1,518,707,592
2,292
Python 3
OK
TESTS
48
62
5,632,000
ar = input() abu = len(ar) - 1 while abu > -1: ar += ar[abu] abu -= 1 print(ar)
Title: Palindromic Supersequence Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a string *A*. Find a string *B*, where *B* is a palindrome and *A* is a subsequence of *B*. A subsequence of a string is a string that can be derived from it by deleting some (not necessarily consecutive) characters without changing the order of the remaining characters. For example, "cotst" is a subsequence of "contest". A palindrome is a string that reads the same forward or backward. The length of string *B* should be at most 104. It is guaranteed that there always exists such string. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. Input Specification: First line contains a string *A* (1<=≤<=|*A*|<=≤<=103) consisting of lowercase Latin letters, where |*A*| is a length of *A*. Output Specification: Output single line containing *B* consisting of only lowercase Latin letters. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. If there are many possible *B*, print any of them. Demo Input: ['aba\n', 'ab\n'] Demo Output: ['aba', 'aabaa'] Note: In the first example, "aba" is a subsequence of "aba" which is a palindrome. In the second example, "ab" is a subsequence of "aabaa" which is a palindrome.
```python ar = input() abu = len(ar) - 1 while abu > -1: ar += ar[abu] abu -= 1 print(ar) ```
3
246
B
Increase and Decrease
PROGRAMMING
1,300
[ "greedy", "math" ]
null
null
Polycarpus has an array, consisting of *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Polycarpus likes it when numbers in an array match. That's why he wants the array to have as many equal numbers as possible. For that Polycarpus performs the following operation multiple times: - he chooses two elements of the array *a**i*, *a**j* (*i*<=≠<=*j*); - he simultaneously increases number *a**i* by 1 and decreases number *a**j* by 1, that is, executes *a**i*<==<=*a**i*<=+<=1 and *a**j*<==<=*a**j*<=-<=1. The given operation changes exactly two distinct array elements. Polycarpus can apply the described operation an infinite number of times. Now he wants to know what maximum number of equal array elements he can get if he performs an arbitrary number of such operation. Help Polycarpus.
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the array size. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=104) — the original array.
Print a single integer — the maximum number of equal array elements he can get if he performs an arbitrary number of the given operation.
[ "2\n2 1\n", "3\n1 4 1\n" ]
[ "1\n", "3\n" ]
none
1,000
[ { "input": "2\n2 1", "output": "1" }, { "input": "3\n1 4 1", "output": "3" }, { "input": "4\n2 -7 -2 -6", "output": "3" }, { "input": "4\n2 0 -2 -1", "output": "3" }, { "input": "6\n-1 1 0 0 -1 -1", "output": "5" }, { "input": "5\n0 0 0 0 0", "output": "5" }, { "input": "100\n968 793 -628 -416 942 -308 977 168 728 -879 952 781 -425 -475 -480 738 -740 142 -319 -116 -701 -183 41 324 -918 -391 -176 781 763 888 475 -617 134 -802 -133 -211 855 -869 -236 503 550 387 137 -221 -957 -800 -56 -673 440 -791 -217 -959 -892 886 -593 427 890 223 -425 -342 -262 693 -137 924 860 156 -110 444 -12 703 421 -638 725 -551 597 -206 -80 393 -441 -759 617 424 -506 209 579 -685 -861 507 312 597 -81 -491 424 222 -892 629 512 743 -452 -504", "output": "99" } ]
1,587,990,531
2,147,483,647
Python 3
OK
TESTS
30
404
3,686,400
n = int(input()) l = list(map(int,input().split())) s = 0 for i in range(n): s = s + l[i] if s%n == 0: print(n) else: print(n-1)
Title: Increase and Decrease Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarpus has an array, consisting of *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Polycarpus likes it when numbers in an array match. That's why he wants the array to have as many equal numbers as possible. For that Polycarpus performs the following operation multiple times: - he chooses two elements of the array *a**i*, *a**j* (*i*<=≠<=*j*); - he simultaneously increases number *a**i* by 1 and decreases number *a**j* by 1, that is, executes *a**i*<==<=*a**i*<=+<=1 and *a**j*<==<=*a**j*<=-<=1. The given operation changes exactly two distinct array elements. Polycarpus can apply the described operation an infinite number of times. Now he wants to know what maximum number of equal array elements he can get if he performs an arbitrary number of such operation. Help Polycarpus. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the array size. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=104) — the original array. Output Specification: Print a single integer — the maximum number of equal array elements he can get if he performs an arbitrary number of the given operation. Demo Input: ['2\n2 1\n', '3\n1 4 1\n'] Demo Output: ['1\n', '3\n'] Note: none
```python n = int(input()) l = list(map(int,input().split())) s = 0 for i in range(n): s = s + l[i] if s%n == 0: print(n) else: print(n-1) ```
3
535
B
Tavas and SaDDas
PROGRAMMING
1,100
[ "bitmasks", "brute force", "combinatorics", "implementation" ]
null
null
Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you." The problem is: You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. If we sort all lucky numbers in increasing order, what's the 1-based index of *n*? Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back.
The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109).
Print the index of *n* among all lucky numbers.
[ "4\n", "7\n", "77\n" ]
[ "1\n", "2\n", "6\n" ]
none
1,000
[ { "input": "4", "output": "1" }, { "input": "7", "output": "2" }, { "input": "77", "output": "6" }, { "input": "4", "output": "1" }, { "input": "474744", "output": "83" }, { "input": "777774", "output": "125" }, { "input": "447", "output": "8" }, { "input": "774", "output": "13" }, { "input": "4", "output": "1" }, { "input": "4447747", "output": "140" }, { "input": "7747474", "output": "233" }, { "input": "4444", "output": "15" }, { "input": "4447", "output": "16" }, { "input": "7", "output": "2" }, { "input": "4", "output": "1" }, { "input": "4447744", "output": "139" }, { "input": "77474", "output": "57" }, { "input": "7747", "output": "28" }, { "input": "444", "output": "7" }, { "input": "7", "output": "2" }, { "input": "7774477", "output": "242" }, { "input": "4477774", "output": "157" }, { "input": "7444", "output": "23" }, { "input": "7474747", "output": "212" }, { "input": "77", "output": "6" }, { "input": "774477", "output": "114" }, { "input": "7", "output": "2" }, { "input": "47", "output": "4" }, { "input": "747777", "output": "110" }, { "input": "444444444", "output": "511" }, { "input": "777777777", "output": "1022" }, { "input": "477477447", "output": "728" }, { "input": "777744747", "output": "996" } ]
1,501,528,186
2,147,483,647
Python 3
OK
TESTS
33
77
4,608,000
l = 0 r = 1 for x in input()[::-1]: if x == '4': l+=r else: l+=r*2 r*=2 print(l)
Title: Tavas and SaDDas Time Limit: None seconds Memory Limit: None megabytes Problem Description: Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you." The problem is: You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. If we sort all lucky numbers in increasing order, what's the 1-based index of *n*? Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back. Input Specification: The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109). Output Specification: Print the index of *n* among all lucky numbers. Demo Input: ['4\n', '7\n', '77\n'] Demo Output: ['1\n', '2\n', '6\n'] Note: none
```python l = 0 r = 1 for x in input()[::-1]: if x == '4': l+=r else: l+=r*2 r*=2 print(l) ```
3
328
B
Sheldon and Ice Pieces
PROGRAMMING
1,500
[ "greedy" ]
null
null
Do you remember how Kai constructed the word "eternity" using pieces of ice as components? Little Sheldon plays with pieces of ice, each piece has exactly one digit between 0 and 9. He wants to construct his favourite number *t*. He realized that digits 6 and 9 are very similar, so he can rotate piece of ice with 6 to use as 9 (and vice versa). Similary, 2 and 5 work the same. There is no other pair of digits with similar effect. He called this effect "Digital Mimicry". Sheldon favourite number is *t*. He wants to have as many instances of *t* as possible. How many instances he can construct using the given sequence of ice pieces. He can use any piece at most once.
The first line contains integer *t* (1<=≤<=*t*<=≤<=10000). The second line contains the sequence of digits on the pieces. The length of line is equal to the number of pieces and between 1 and 200, inclusive. It contains digits between 0 and 9.
Print the required number of instances.
[ "42\n23454\n", "169\n12118999\n" ]
[ "2\n", "1\n" ]
This problem contains very weak pretests.
500
[ { "input": "42\n23454", "output": "2" }, { "input": "169\n12118999", "output": "1" }, { "input": "1\n1", "output": "1" }, { "input": "7\n777", "output": "3" }, { "input": "18\n8118", "output": "2" }, { "input": "33\n33333333", "output": "4" }, { "input": "1780\n8170880870810081711018110878070777078711", "output": "10" }, { "input": "2\n5255", "output": "4" }, { "input": "5\n22252", "output": "5" }, { "input": "9\n666969", "output": "6" }, { "input": "6\n9669969", "output": "7" }, { "input": "25\n52", "output": "1" }, { "input": "2591\n5291", "output": "1" }, { "input": "9697\n979966799976", "output": "3" }, { "input": "5518\n22882121", "output": "2" }, { "input": "533\n355233333332", "output": "4" }, { "input": "2569\n9592525295556669222269569596622566529699", "output": "10" }, { "input": "2559\n5252555622565626", "output": "4" }, { "input": "555\n225225252222255", "output": "5" }, { "input": "266\n565596629695965699", "output": "6" }, { "input": "22\n25552222222255", "output": "7" }, { "input": "99\n966969969696699969", "output": "9" }, { "input": "2591\n95195222396509125191259289255559161259521226176117", "output": "10" }, { "input": "9697\n76694996266995167659667796999669903799299696697971977966766996767667996967697669766777697969669669297966667776967677699767966667666769699790768276666766", "output": "34" }, { "input": "5518\n9827108589585181118358352282425981568508825302611217254345831149357236227288533838583629451589201341265988858338548185158221291825821019993179835186961954871454", "output": "23" }, { "input": "100\n11111000000000001010110010101100011011110101000000000001100110007111110010100000011000010011000011000010010000111101000010000000801000100111000410010100100000001011000000000101100010110001001100010001", "output": "63" }, { "input": "2569\n09629965966225566262579565696595696954525955599926383255926955906666526913925296256629966292216925259225261263256229509529259756291959568892569599592218262625256926619266669279659295979299556965525222", "output": "44" }, { "input": "2559\n52555995269265555695922255525995255259555259252562655622526292929555265526255252526255555296956995596262965522222225655655262255226222259622295225295525265995566255556225522559559295225625559595222652", "output": "48" }, { "input": "555\n25225222525252252255252525552255255522522522225252252525225555225552525255255252252225225255225552522252552252252522555255522225555252255555222225252525522252252255522522225252255522525552525225522552", "output": "66" }, { "input": "266\n26266956652996996666662666992669966292555295699956956255562529696222966929669665256625596629565696225696662556996969659952659665522965269529566599526566699292225569566599656596562966965669929996226599", "output": "62" }, { "input": "22\n35354953025524221524235223225255512262254275553262592555522123522225045753552560550228255220622552552252517202252456715552032250226729355222227262525262552362252277292927052612301558753527582221622055", "output": "66" }, { "input": "9\n99669996666966699999666999999666999699966669696969999696666669696967969666969696696696699669696999669669966696699666669996696666996699999696666696996666666969996996696696969666999999996666699966996696", "output": "199" }, { "input": "2569\n2569256925692569256925692569256925692569", "output": "10" }, { "input": "52\n222222222222222", "output": "7" }, { "input": "11\n1", "output": "0" }, { "input": "5\n2", "output": "1" } ]
1,593,376,772
2,147,483,647
Python 3
OK
TESTS
36
218
6,963,200
a = input() b = input() d = {} for e in b: if e == '9': e = '6' if e == '5': e = '2' if e in d: d[e] = d[e] + 1 else: d[e] = 1 n = {} for e in a: if e == '9': e = '6' if e == '5': e = '2' if e in n: n[e] += 1 else: n[e] = 1 result = 10000000 for e in n: if e not in d: result = 0 break else: temp_result = int(d[e] / n[e]) if temp_result < result: result = temp_result print(result)
Title: Sheldon and Ice Pieces Time Limit: None seconds Memory Limit: None megabytes Problem Description: Do you remember how Kai constructed the word "eternity" using pieces of ice as components? Little Sheldon plays with pieces of ice, each piece has exactly one digit between 0 and 9. He wants to construct his favourite number *t*. He realized that digits 6 and 9 are very similar, so he can rotate piece of ice with 6 to use as 9 (and vice versa). Similary, 2 and 5 work the same. There is no other pair of digits with similar effect. He called this effect "Digital Mimicry". Sheldon favourite number is *t*. He wants to have as many instances of *t* as possible. How many instances he can construct using the given sequence of ice pieces. He can use any piece at most once. Input Specification: The first line contains integer *t* (1<=≤<=*t*<=≤<=10000). The second line contains the sequence of digits on the pieces. The length of line is equal to the number of pieces and between 1 and 200, inclusive. It contains digits between 0 and 9. Output Specification: Print the required number of instances. Demo Input: ['42\n23454\n', '169\n12118999\n'] Demo Output: ['2\n', '1\n'] Note: This problem contains very weak pretests.
```python a = input() b = input() d = {} for e in b: if e == '9': e = '6' if e == '5': e = '2' if e in d: d[e] = d[e] + 1 else: d[e] = 1 n = {} for e in a: if e == '9': e = '6' if e == '5': e = '2' if e in n: n[e] += 1 else: n[e] = 1 result = 10000000 for e in n: if e not in d: result = 0 break else: temp_result = int(d[e] / n[e]) if temp_result < result: result = temp_result print(result) ```
3
965
A
Paper Airplanes
PROGRAMMING
800
[ "math" ]
null
null
To make a paper airplane, one has to use a rectangular piece of paper. From a sheet of standard size you can make $s$ airplanes. A group of $k$ people decided to make $n$ airplanes each. They are going to buy several packs of paper, each of them containing $p$ sheets, and then distribute the sheets between the people. Each person should have enough sheets to make $n$ airplanes. How many packs should they buy?
The only line contains four integers $k$, $n$, $s$, $p$ ($1 \le k, n, s, p \le 10^4$) — the number of people, the number of airplanes each should make, the number of airplanes that can be made using one sheet and the number of sheets in one pack, respectively.
Print a single integer — the minimum number of packs they should buy.
[ "5 3 2 3\n", "5 3 100 1\n" ]
[ "4\n", "5\n" ]
In the first sample they have to buy $4$ packs of paper: there will be $12$ sheets in total, and giving $2$ sheets to each person is enough to suit everyone's needs. In the second sample they have to buy a pack for each person as they can't share sheets.
500
[ { "input": "5 3 2 3", "output": "4" }, { "input": "5 3 100 1", "output": "5" }, { "input": "10000 10000 1 1", "output": "100000000" }, { "input": "1 1 10000 10000", "output": "1" }, { "input": "300 300 21 23", "output": "196" }, { "input": "300 2 37 51", "output": "6" }, { "input": "2 400 23 57", "output": "1" }, { "input": "1 1 1 1", "output": "1" }, { "input": "10000 10000 3 2", "output": "16670000" }, { "input": "1 2 1 2", "output": "1" }, { "input": "1 1 2 2", "output": "1" }, { "input": "1 1 10 10", "output": "1" }, { "input": "5324 5439 32 13", "output": "69622" }, { "input": "9000 1 2432 1", "output": "9000" }, { "input": "230 1234 9124 23", "output": "10" }, { "input": "11 1 1 1", "output": "11" }, { "input": "6246 8489 1227 9", "output": "4858" }, { "input": "9 20 5 7", "output": "6" } ]
1,697,207,623
2,147,483,647
Python 3
OK
TESTS
18
46
0
k, n, s, p = map(int, input().split()) per_person = n // s if n % s == 0 else (n // s) + 1 tot_sheets = k * per_person print((tot_sheets // p) + 1 if tot_sheets % p != 0 else tot_sheets // p)
Title: Paper Airplanes Time Limit: None seconds Memory Limit: None megabytes Problem Description: To make a paper airplane, one has to use a rectangular piece of paper. From a sheet of standard size you can make $s$ airplanes. A group of $k$ people decided to make $n$ airplanes each. They are going to buy several packs of paper, each of them containing $p$ sheets, and then distribute the sheets between the people. Each person should have enough sheets to make $n$ airplanes. How many packs should they buy? Input Specification: The only line contains four integers $k$, $n$, $s$, $p$ ($1 \le k, n, s, p \le 10^4$) — the number of people, the number of airplanes each should make, the number of airplanes that can be made using one sheet and the number of sheets in one pack, respectively. Output Specification: Print a single integer — the minimum number of packs they should buy. Demo Input: ['5 3 2 3\n', '5 3 100 1\n'] Demo Output: ['4\n', '5\n'] Note: In the first sample they have to buy $4$ packs of paper: there will be $12$ sheets in total, and giving $2$ sheets to each person is enough to suit everyone's needs. In the second sample they have to buy a pack for each person as they can't share sheets.
```python k, n, s, p = map(int, input().split()) per_person = n // s if n % s == 0 else (n // s) + 1 tot_sheets = k * per_person print((tot_sheets // p) + 1 if tot_sheets % p != 0 else tot_sheets // p) ```
3
9
C
Hexadecimal's Numbers
PROGRAMMING
1,200
[ "brute force", "implementation", "math" ]
C. Hexadecimal's Numbers
1
64
One beautiful July morning a terrible thing happened in Mainframe: a mean virus Megabyte somehow got access to the memory of his not less mean sister Hexadecimal. He loaded there a huge amount of *n* different natural numbers from 1 to *n* to obtain total control over her energy. But his plan failed. The reason for this was very simple: Hexadecimal didn't perceive any information, apart from numbers written in binary format. This means that if a number in a decimal representation contained characters apart from 0 and 1, it was not stored in the memory. Now Megabyte wants to know, how many numbers were loaded successfully.
Input data contains the only number *n* (1<=≤<=*n*<=≤<=109).
Output the only number — answer to the problem.
[ "10\n" ]
[ "2" ]
For *n* = 10 the answer includes numbers 1 and 10.
0
[ { "input": "10", "output": "2" }, { "input": "20", "output": "3" }, { "input": "72", "output": "3" }, { "input": "99", "output": "3" }, { "input": "100", "output": "4" }, { "input": "101", "output": "5" }, { "input": "102", "output": "5" }, { "input": "111", "output": "7" }, { "input": "112", "output": "7" }, { "input": "745", "output": "7" }, { "input": "23536", "output": "31" }, { "input": "1", "output": "1" }, { "input": "1010011", "output": "83" }, { "input": "312410141", "output": "511" }, { "input": "1000000000", "output": "512" }, { "input": "999999999", "output": "511" }, { "input": "111111111", "output": "511" }, { "input": "101010101", "output": "341" }, { "input": "121212121", "output": "511" }, { "input": "106341103", "output": "383" }, { "input": "901556123", "output": "511" }, { "input": "832513432", "output": "511" }, { "input": "3", "output": "1" }, { "input": "732875234", "output": "511" }, { "input": "7", "output": "1" }, { "input": "9", "output": "1" }, { "input": "2", "output": "1" }, { "input": "11", "output": "3" }, { "input": "12", "output": "3" }, { "input": "13", "output": "3" }, { "input": "101020101", "output": "351" }, { "input": "111100100", "output": "484" }, { "input": "110110101", "output": "437" }, { "input": "100111001", "output": "313" }, { "input": "100100", "output": "36" }, { "input": "110100102", "output": "421" } ]
1,606,361,768
2,147,483,647
PyPy 3
OK
TESTS
36
280
0
import sys input = sys.stdin.readline for _ in range(1): n=int(input()) ans=[0] def helper(curr): if curr>n: return ans[0]+=1 for i in [0,1]: helper(curr*10+i) return helper(1) print(ans[0])
Title: Hexadecimal's Numbers Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: One beautiful July morning a terrible thing happened in Mainframe: a mean virus Megabyte somehow got access to the memory of his not less mean sister Hexadecimal. He loaded there a huge amount of *n* different natural numbers from 1 to *n* to obtain total control over her energy. But his plan failed. The reason for this was very simple: Hexadecimal didn't perceive any information, apart from numbers written in binary format. This means that if a number in a decimal representation contained characters apart from 0 and 1, it was not stored in the memory. Now Megabyte wants to know, how many numbers were loaded successfully. Input Specification: Input data contains the only number *n* (1<=≤<=*n*<=≤<=109). Output Specification: Output the only number — answer to the problem. Demo Input: ['10\n'] Demo Output: ['2'] Note: For *n* = 10 the answer includes numbers 1 and 10.
```python import sys input = sys.stdin.readline for _ in range(1): n=int(input()) ans=[0] def helper(curr): if curr>n: return ans[0]+=1 for i in [0,1]: helper(curr*10+i) return helper(1) print(ans[0]) ```
3.86
228
A
Is your horseshoe on the other hoof?
PROGRAMMING
800
[ "implementation" ]
null
null
Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party.
The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has. Consider all possible colors indexed with integers.
Print a single integer — the minimum number of horseshoes Valera needs to buy.
[ "1 7 3 3\n", "7 7 7 7\n" ]
[ "1\n", "3\n" ]
none
500
[ { "input": "1 7 3 3", "output": "1" }, { "input": "7 7 7 7", "output": "3" }, { "input": "81170865 673572653 756938629 995577259", "output": "0" }, { "input": "3491663 217797045 522540872 715355328", "output": "0" }, { "input": "251590420 586975278 916631563 586975278", "output": "1" }, { "input": "259504825 377489979 588153796 377489979", "output": "1" }, { "input": "652588203 931100304 931100304 652588203", "output": "2" }, { "input": "391958720 651507265 391958720 651507265", "output": "2" }, { "input": "90793237 90793237 90793237 90793237", "output": "3" }, { "input": "551651653 551651653 551651653 551651653", "output": "3" }, { "input": "156630260 609654355 668943582 973622757", "output": "0" }, { "input": "17061017 110313588 434481173 796661222", "output": "0" }, { "input": "24975422 256716298 337790533 690960249", "output": "0" }, { "input": "255635360 732742923 798648949 883146723", "output": "0" }, { "input": "133315691 265159773 734556507 265159773", "output": "1" }, { "input": "28442865 741657755 978106882 978106882", "output": "1" }, { "input": "131245479 174845575 497483467 131245479", "output": "1" }, { "input": "139159884 616215581 958341883 616215581", "output": "1" }, { "input": "147784432 947653080 947653080 947653080", "output": "2" }, { "input": "94055790 756126496 756126496 94055790", "output": "2" }, { "input": "240458500 511952208 240458500 511952208", "output": "2" }, { "input": "681828506 972810624 972810624 681828506", "output": "2" }, { "input": "454961014 454961014 454961014 454961014", "output": "3" }, { "input": "915819430 915819430 915819430 915819430", "output": "3" }, { "input": "671645142 671645142 671645142 671645142", "output": "3" }, { "input": "132503558 132503558 132503558 132503558", "output": "3" }, { "input": "5 5 999999 6", "output": "1" }, { "input": "1 1 2 5", "output": "1" }, { "input": "2 1 2 3", "output": "1" }, { "input": "1 1 3 5", "output": "1" }, { "input": "1 1 3 3", "output": "2" }, { "input": "2 2 2 1", "output": "2" }, { "input": "3 1 1 1", "output": "2" }, { "input": "1 2 2 2", "output": "2" } ]
1,694,153,390
2,147,483,647
Python 3
OK
TESTS
34
92
0
import sys arr = [int(i) for i in sys.stdin.readline().split()] arr1 = dict.fromkeys(arr) print(len(arr) - len(arr1))
Title: Is your horseshoe on the other hoof? Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party. Input Specification: The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has. Consider all possible colors indexed with integers. Output Specification: Print a single integer — the minimum number of horseshoes Valera needs to buy. Demo Input: ['1 7 3 3\n', '7 7 7 7\n'] Demo Output: ['1\n', '3\n'] Note: none
```python import sys arr = [int(i) for i in sys.stdin.readline().split()] arr1 = dict.fromkeys(arr) print(len(arr) - len(arr1)) ```
3
194
A
Exams
PROGRAMMING
900
[ "implementation", "math" ]
null
null
One day the Codeforces round author sat exams. He had *n* exams and he needed to get an integer from 2 to 5 for each exam. He will have to re-sit each failed exam, i.e. the exam that gets mark 2. The author would need to spend too much time and effort to make the sum of his marks strictly more than *k*. That could have spoilt the Codeforces round. On the other hand, if the sum of his marks is strictly less than *k*, the author's mum won't be pleased at all. The Codeforces authors are very smart and they always get the mark they choose themselves. Also, the Codeforces authors just hate re-sitting exams. Help the author and find the minimum number of exams he will have to re-sit if he passes the exams in the way that makes the sum of marks for all *n* exams equal exactly *k*.
The single input line contains space-separated integers *n* and *k* (1<=≤<=*n*<=≤<=50, 1<=≤<=*k*<=≤<=250) — the number of exams and the required sum of marks. It is guaranteed that there exists a way to pass *n* exams in the way that makes the sum of marks equal exactly *k*.
Print the single number — the minimum number of exams that the author will get a 2 for, considering that the sum of marks for all exams must equal *k*.
[ "4 8\n", "4 10\n", "1 3\n" ]
[ "4\n", "2\n", "0\n" ]
In the first sample the author has to get a 2 for all his exams. In the second sample he should get a 3 for two exams and a 2 for two more. In the third sample he should get a 3 for one exam.
500
[ { "input": "4 8", "output": "4" }, { "input": "4 10", "output": "2" }, { "input": "1 3", "output": "0" }, { "input": "1 2", "output": "1" }, { "input": "4 9", "output": "3" }, { "input": "50 234", "output": "0" }, { "input": "50 100", "output": "50" }, { "input": "50 250", "output": "0" }, { "input": "29 116", "output": "0" }, { "input": "20 69", "output": "0" }, { "input": "46 127", "output": "11" }, { "input": "3 7", "output": "2" }, { "input": "36 99", "output": "9" }, { "input": "45 104", "output": "31" }, { "input": "13 57", "output": "0" }, { "input": "25 106", "output": "0" }, { "input": "8 19", "output": "5" }, { "input": "20 69", "output": "0" }, { "input": "13 32", "output": "7" }, { "input": "47 128", "output": "13" }, { "input": "17 73", "output": "0" }, { "input": "3 7", "output": "2" }, { "input": "16 70", "output": "0" }, { "input": "1 5", "output": "0" }, { "input": "38 137", "output": "0" }, { "input": "7 20", "output": "1" }, { "input": "1 5", "output": "0" }, { "input": "36 155", "output": "0" }, { "input": "5 15", "output": "0" }, { "input": "27 75", "output": "6" }, { "input": "21 73", "output": "0" }, { "input": "2 5", "output": "1" }, { "input": "49 177", "output": "0" }, { "input": "7 20", "output": "1" }, { "input": "44 173", "output": "0" }, { "input": "49 219", "output": "0" }, { "input": "16 70", "output": "0" }, { "input": "10 28", "output": "2" } ]
1,596,432,733
2,147,483,647
PyPy 3
OK
TESTS
38
280
20,172,800
def f(l): n,k = l return max(n*3-k,0) l = list(map(int,input().split())) print(f(l))
Title: Exams Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day the Codeforces round author sat exams. He had *n* exams and he needed to get an integer from 2 to 5 for each exam. He will have to re-sit each failed exam, i.e. the exam that gets mark 2. The author would need to spend too much time and effort to make the sum of his marks strictly more than *k*. That could have spoilt the Codeforces round. On the other hand, if the sum of his marks is strictly less than *k*, the author's mum won't be pleased at all. The Codeforces authors are very smart and they always get the mark they choose themselves. Also, the Codeforces authors just hate re-sitting exams. Help the author and find the minimum number of exams he will have to re-sit if he passes the exams in the way that makes the sum of marks for all *n* exams equal exactly *k*. Input Specification: The single input line contains space-separated integers *n* and *k* (1<=≤<=*n*<=≤<=50, 1<=≤<=*k*<=≤<=250) — the number of exams and the required sum of marks. It is guaranteed that there exists a way to pass *n* exams in the way that makes the sum of marks equal exactly *k*. Output Specification: Print the single number — the minimum number of exams that the author will get a 2 for, considering that the sum of marks for all exams must equal *k*. Demo Input: ['4 8\n', '4 10\n', '1 3\n'] Demo Output: ['4\n', '2\n', '0\n'] Note: In the first sample the author has to get a 2 for all his exams. In the second sample he should get a 3 for two exams and a 2 for two more. In the third sample he should get a 3 for one exam.
```python def f(l): n,k = l return max(n*3-k,0) l = list(map(int,input().split())) print(f(l)) ```
3
352
B
Jeff and Periods
PROGRAMMING
1,300
[ "implementation", "sortings" ]
null
null
One day Jeff got hold of an integer sequence *a*1, *a*2, ..., *a**n* of length *n*. The boy immediately decided to analyze the sequence. For that, he needs to find all values of *x*, for which these conditions hold: - *x* occurs in sequence *a*. - Consider all positions of numbers *x* in the sequence *a* (such *i*, that *a**i*<==<=*x*). These numbers, sorted in the increasing order, must form an arithmetic progression. Help Jeff, find all *x* that meet the problem conditions.
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105). The numbers are separated by spaces.
In the first line print integer *t* — the number of valid *x*. On each of the next *t* lines print two integers *x* and *p**x*, where *x* is current suitable value, *p**x* is the common difference between numbers in the progression (if *x* occurs exactly once in the sequence, *p**x* must equal 0). Print the pairs in the order of increasing *x*.
[ "1\n2\n", "8\n1 2 1 3 1 2 1 5\n" ]
[ "1\n2 0\n", "4\n1 2\n2 4\n3 0\n5 0\n" ]
In the first test 2 occurs exactly once in the sequence, ergo *p*<sub class="lower-index">2</sub> = 0.
1,000
[ { "input": "1\n2", "output": "1\n2 0" }, { "input": "8\n1 2 1 3 1 2 1 5", "output": "4\n1 2\n2 4\n3 0\n5 0" }, { "input": "3\n1 10 5", "output": "3\n1 0\n5 0\n10 0" }, { "input": "4\n9 9 3 5", "output": "3\n3 0\n5 0\n9 1" }, { "input": "6\n1 2 2 1 1 2", "output": "0" }, { "input": "6\n2 6 3 8 7 2", "output": "5\n2 5\n3 0\n6 0\n7 0\n8 0" }, { "input": "7\n2 1 2 1 2 1 2", "output": "2\n1 2\n2 2" }, { "input": "8\n1 1 1 1 1 1 1 1", "output": "1\n1 1" }, { "input": "9\n2 3 3 3 2 1 2 3 2", "output": "1\n1 0" }, { "input": "10\n3 1 1 1 1 3 1 2 2 1", "output": "2\n2 1\n3 5" }, { "input": "12\n10 9 8 7 7 8 9 10 10 9 8 7", "output": "0" } ]
1,653,570,822
2,147,483,647
PyPy 3-64
OK
TESTS
36
810
45,670,400
from collections import defaultdict n = int(input()) a = list(map(int, input().split())) d = defaultdict(list) for i in range(n): d[a[i]].append(i) l = list(d.keys()) l.sort() ans = [] for i in l: if(len(d[i]) == 1): ans.append([i, 0]) continue c = d[i][1] - d[i][0] for j in range(2, len(d[i])): if(d[i][j] - d[i][j - 1] != c): break else: ans.append([i, c]) print(len(ans)) for i in ans: print(*i)
Title: Jeff and Periods Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Jeff got hold of an integer sequence *a*1, *a*2, ..., *a**n* of length *n*. The boy immediately decided to analyze the sequence. For that, he needs to find all values of *x*, for which these conditions hold: - *x* occurs in sequence *a*. - Consider all positions of numbers *x* in the sequence *a* (such *i*, that *a**i*<==<=*x*). These numbers, sorted in the increasing order, must form an arithmetic progression. Help Jeff, find all *x* that meet the problem conditions. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105). The numbers are separated by spaces. Output Specification: In the first line print integer *t* — the number of valid *x*. On each of the next *t* lines print two integers *x* and *p**x*, where *x* is current suitable value, *p**x* is the common difference between numbers in the progression (if *x* occurs exactly once in the sequence, *p**x* must equal 0). Print the pairs in the order of increasing *x*. Demo Input: ['1\n2\n', '8\n1 2 1 3 1 2 1 5\n'] Demo Output: ['1\n2 0\n', '4\n1 2\n2 4\n3 0\n5 0\n'] Note: In the first test 2 occurs exactly once in the sequence, ergo *p*<sub class="lower-index">2</sub> = 0.
```python from collections import defaultdict n = int(input()) a = list(map(int, input().split())) d = defaultdict(list) for i in range(n): d[a[i]].append(i) l = list(d.keys()) l.sort() ans = [] for i in l: if(len(d[i]) == 1): ans.append([i, 0]) continue c = d[i][1] - d[i][0] for j in range(2, len(d[i])): if(d[i][j] - d[i][j - 1] != c): break else: ans.append([i, c]) print(len(ans)) for i in ans: print(*i) ```
3
202
A
LLPS
PROGRAMMING
800
[ "binary search", "bitmasks", "brute force", "greedy", "implementation", "strings" ]
null
null
This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline. You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence. We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=&lt;<=*p*2<=&lt;<=...<=&lt;<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba". String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| &gt; |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=&lt;<=|*x*|, *r*<=&lt;<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=&gt;<=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post". String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z".
The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10.
Print the lexicographically largest palindromic subsequence of string *s*.
[ "radar\n", "bowwowwow\n", "codeforces\n", "mississipp\n" ]
[ "rr\n", "wwwww\n", "s\n", "ssss\n" ]
Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
500
[ { "input": "radar", "output": "rr" }, { "input": "bowwowwow", "output": "wwwww" }, { "input": "codeforces", "output": "s" }, { "input": "mississipp", "output": "ssss" }, { "input": "tourist", "output": "u" }, { "input": "romka", "output": "r" }, { "input": "helloworld", "output": "w" }, { "input": "zzzzzzzazz", "output": "zzzzzzzzz" }, { "input": "testcase", "output": "tt" }, { "input": "hahahahaha", "output": "hhhhh" }, { "input": "abbbbbbbbb", "output": "bbbbbbbbb" }, { "input": "zaz", "output": "zz" }, { "input": "aza", "output": "z" }, { "input": "dcbaedcba", "output": "e" }, { "input": "abcdeabcd", "output": "e" }, { "input": "edcbabcde", "output": "ee" }, { "input": "aaaaaaaaab", "output": "b" }, { "input": "testzzzzzz", "output": "zzzzzz" }, { "input": "zzzzzzwait", "output": "zzzzzz" }, { "input": "rrrrrqponm", "output": "rrrrr" }, { "input": "zzyzyy", "output": "zzz" }, { "input": "aababb", "output": "bbb" }, { "input": "zanzibar", "output": "zz" }, { "input": "hhgfedcbaa", "output": "hh" }, { "input": "aabcdefghh", "output": "hh" }, { "input": "aruaru", "output": "uu" }, { "input": "uraura", "output": "uu" }, { "input": "aru", "output": "u" }, { "input": "aburvabur", "output": "v" }, { "input": "ura", "output": "u" }, { "input": "eurottat", "output": "u" }, { "input": "referee", "output": "rr" }, { "input": "joking", "output": "o" }, { "input": "seriously", "output": "y" }, { "input": "sets", "output": "t" }, { "input": "test", "output": "tt" }, { "input": "klmgameklm", "output": "mmm" }, { "input": "dfkjafdkdd", "output": "kk" }, { "input": "zzzzzzzzzz", "output": "zzzzzzzzzz" }, { "input": "aaaaaaaaaa", "output": "aaaaaaaaaa" }, { "input": "buzz", "output": "zz" }, { "input": "b", "output": "b" }, { "input": "y", "output": "y" }, { "input": "yy", "output": "yy" }, { "input": "zz", "output": "zz" }, { "input": "bb", "output": "bb" }, { "input": "aa", "output": "aa" }, { "input": "a", "output": "a" }, { "input": "z", "output": "z" }, { "input": "zz", "output": "zz" }, { "input": "zzazazzzaz", "output": "zzzzzzz" }, { "input": "hellhellhe", "output": "llll" }, { "input": "hellohello", "output": "oo" }, { "input": "refer", "output": "rr" } ]
1,624,375,557
2,147,483,647
PyPy 3
OK
TESTS
54
218
0
s = input() temp = sorted(s) d = {} for i in s: if i in d: d[i]+=1 else: d[i] = 1 ele = temp[-1] occurence = d[ele] print(ele*occurence)
Title: LLPS Time Limit: None seconds Memory Limit: None megabytes Problem Description: This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline. You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence. We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=&lt;<=*p*2<=&lt;<=...<=&lt;<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba". String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| &gt; |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=&lt;<=|*x*|, *r*<=&lt;<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=&gt;<=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post". String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z". Input Specification: The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10. Output Specification: Print the lexicographically largest palindromic subsequence of string *s*. Demo Input: ['radar\n', 'bowwowwow\n', 'codeforces\n', 'mississipp\n'] Demo Output: ['rr\n', 'wwwww\n', 's\n', 'ssss\n'] Note: Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
```python s = input() temp = sorted(s) d = {} for i in s: if i in d: d[i]+=1 else: d[i] = 1 ele = temp[-1] occurence = d[ele] print(ele*occurence) ```
3
520
A
Pangram
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
A word or a sentence in some language is called a pangram if all the characters of the alphabet of this language appear in it at least once. Pangrams are often used to demonstrate fonts in printing or test the output devices. You are given a string consisting of lowercase and uppercase Latin letters. Check whether this string is a pangram. We say that the string contains a letter of the Latin alphabet if this letter occurs in the string in uppercase or lowercase.
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of characters in the string. The second line contains the string. The string consists only of uppercase and lowercase Latin letters.
Output "YES", if the string is a pangram and "NO" otherwise.
[ "12\ntoosmallword\n", "35\nTheQuickBrownFoxJumpsOverTheLazyDog\n" ]
[ "NO\n", "YES\n" ]
none
500
[ { "input": "12\ntoosmallword", "output": "NO" }, { "input": "35\nTheQuickBrownFoxJumpsOverTheLazyDog", "output": "YES" }, { "input": "1\na", "output": "NO" }, { "input": "26\nqwertyuiopasdfghjklzxcvbnm", "output": "YES" }, { "input": "26\nABCDEFGHIJKLMNOPQRSTUVWXYZ", "output": "YES" }, { "input": "48\nthereisasyetinsufficientdataforameaningfulanswer", "output": "NO" }, { "input": "30\nToBeOrNotToBeThatIsTheQuestion", "output": "NO" }, { "input": "30\njackdawslovemybigsphinxofquarz", "output": "NO" }, { "input": "31\nTHEFIVEBOXINGWIZARDSJUMPQUICKLY", "output": "YES" }, { "input": "26\naaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "NO" }, { "input": "26\nMGJYIZDKsbhpVeNFlquRTcWoAx", "output": "YES" }, { "input": "26\nfWMOhAPsbIVtyUEZrGNQXDklCJ", "output": "YES" }, { "input": "26\nngPMVFSThiRCwLEuyOAbKxQzDJ", "output": "YES" }, { "input": "25\nnxYTzLFwzNolAumjgcAboyxAj", "output": "NO" }, { "input": "26\npRWdodGdxUESvcScPGbUoooZsC", "output": "NO" }, { "input": "66\nBovdMlDzTaqKllZILFVfxbLGsRnzmtVVTmqiIDTYrossLEPlmsPrkUYtWEsGHVOnFj", "output": "NO" }, { "input": "100\nmKtsiDRJypUieHIkvJaMFkwaKxcCIbBszZQLIyPpCDCjhNpAnYFngLjRpnKWpKWtGnwoSteeZXuFHWQxxxOpFlNeYTwKocsXuCoa", "output": "YES" }, { "input": "26\nEoqxUbsLjPytUHMiFnvcGWZdRK", "output": "NO" }, { "input": "26\nvCUFRKElZOnjmXGylWQaHDiPst", "output": "NO" }, { "input": "26\nWtrPuaHdXLKJMsnvQfgOiJZBEY", "output": "NO" }, { "input": "26\npGiFluRteQwkaVoPszJyNBChxM", "output": "NO" }, { "input": "26\ncTUpqjPmANrdbzSFhlWIoKxgVY", "output": "NO" }, { "input": "26\nLndjgvAEuICHKxPwqYztosrmBN", "output": "NO" }, { "input": "26\nMdaXJrCipnOZLykfqHWEStevbU", "output": "NO" }, { "input": "26\nEjDWsVxfKTqGXRnUMOLYcIzPba", "output": "NO" }, { "input": "26\nxKwzRMpunYaqsdfaBgJcVElTHo", "output": "NO" }, { "input": "26\nnRYUQsTwCPLZkgshfEXvBdoiMa", "output": "NO" }, { "input": "26\nHNCQPfJutyAlDGsvRxZWMEbIdO", "output": "NO" }, { "input": "26\nDaHJIpvKznQcmUyWsTGObXRFDe", "output": "NO" }, { "input": "26\nkqvAnFAiRhzlJbtyuWedXSPcOG", "output": "NO" }, { "input": "26\nhlrvgdwsIOyjcmUZXtAKEqoBpF", "output": "NO" }, { "input": "26\njLfXXiMhBTcAwQVReGnpKzdsYu", "output": "NO" }, { "input": "26\nlNMcVuwItjxRBGAekjhyDsQOzf", "output": "NO" }, { "input": "26\nRkSwbNoYldUGtAZvpFMcxhIJFE", "output": "NO" }, { "input": "26\nDqspXZJTuONYieKgaHLMBwfVSC", "output": "NO" }, { "input": "26\necOyUkqNljFHRVXtIpWabGMLDz", "output": "NO" }, { "input": "26\nEKAvqZhBnPmVCDRlgWJfOusxYI", "output": "NO" }, { "input": "26\naLbgqeYchKdMrsZxIPFvTOWNjA", "output": "NO" }, { "input": "26\nxfpBLsndiqtacOCHGmeWUjRkYz", "output": "NO" }, { "input": "26\nXsbRKtqleZPNIVCdfUhyagAomJ", "output": "NO" }, { "input": "26\nAmVtbrwquEthZcjKPLiyDgSoNF", "output": "NO" }, { "input": "26\nOhvXDcwqAUmSEPRZGnjFLiKtNB", "output": "NO" }, { "input": "26\nEKWJqCFLRmstxVBdYuinpbhaOg", "output": "NO" }, { "input": "26\nmnbvcxxlkjhgfdsapoiuytrewq", "output": "NO" }, { "input": "26\naAbcdefghijklmnopqrstuvwxy", "output": "NO" }, { "input": "30\nABCDEFGHTYRIOPLabcdefghtyriopl", "output": "NO" }, { "input": "25\nabcdefghijklmnopqrstuvwxy", "output": "NO" }, { "input": "26\nabcdefhijklmnopqrstVxyzABC", "output": "NO" }, { "input": "25\nqwertyuiopasdfghjklxcvbnm", "output": "NO" }, { "input": "34\nTheQuickBrownFoxJumpsOverTheLayDog", "output": "NO" }, { "input": "26\nabcdefghigklmnopqrstuvwxyz", "output": "NO" }, { "input": "26\nabcdefghijklmnopqrstuvwxyA", "output": "NO" }, { "input": "50\nqazwsxedcrfvtgbyhnujmikolQWERTYUIOASDFGHJKLZXCVBNM", "output": "NO" }, { "input": "35\nTheQuickBrownFoxJumpsOverTheLasyDog", "output": "NO" }, { "input": "25\nbcdefghijklmnopqrstuvwxyz", "output": "NO" }, { "input": "38\nAbCdEfGhIjKlMnOpQrStVwXyZzzzzzzaaaaaaa", "output": "NO" }, { "input": "26\nabcdefghiklmnopqrstvxyzABC", "output": "NO" }, { "input": "26\nabcdefghijklmnopqrstuvwxzZ", "output": "NO" }, { "input": "50\nabcdefghijklmnopqrstuvwxyABCDEFGHIJKLMNOPQRSTUVWXY", "output": "NO" } ]
1,697,631,930
2,147,483,647
Python 3
OK
TESTS
59
46
0
a = input() b = input() def pan(b): alphabet = 'abcdefghijklmnopqrstuvwxyz' for h in alphabet: if h not in b.lower(): return False return True if(pan(b) == True): print("YES") else: print("NO")
Title: Pangram Time Limit: None seconds Memory Limit: None megabytes Problem Description: A word or a sentence in some language is called a pangram if all the characters of the alphabet of this language appear in it at least once. Pangrams are often used to demonstrate fonts in printing or test the output devices. You are given a string consisting of lowercase and uppercase Latin letters. Check whether this string is a pangram. We say that the string contains a letter of the Latin alphabet if this letter occurs in the string in uppercase or lowercase. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of characters in the string. The second line contains the string. The string consists only of uppercase and lowercase Latin letters. Output Specification: Output "YES", if the string is a pangram and "NO" otherwise. Demo Input: ['12\ntoosmallword\n', '35\nTheQuickBrownFoxJumpsOverTheLazyDog\n'] Demo Output: ['NO\n', 'YES\n'] Note: none
```python a = input() b = input() def pan(b): alphabet = 'abcdefghijklmnopqrstuvwxyz' for h in alphabet: if h not in b.lower(): return False return True if(pan(b) == True): print("YES") else: print("NO") ```
3
686
A
Free Ice Cream
PROGRAMMING
800
[ "constructive algorithms", "implementation" ]
null
null
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer. At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue). If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress. Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109). Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
[ "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n", "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n" ]
[ "22 1\n", "3 2\n" ]
Consider the first sample. 1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
500
[ { "input": "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20", "output": "22 1" }, { "input": "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98", "output": "3 2" }, { "input": "6 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000", "output": "7000000000 0" }, { "input": "5 12\n- 12\n+ 7\n- 6\n- 1\n+ 46", "output": "46 0" }, { "input": "11 1000\n- 100\n+ 100\n+ 100\n+ 100\n+ 100\n- 100\n- 100\n- 100\n- 100\n- 100\n- 100", "output": "700 0" }, { "input": "1 0\n- 526403222", "output": "0 1" }, { "input": "1 897986543\n- 371188251", "output": "526798292 0" }, { "input": "1 0\n+ 1", "output": "1 0" }, { "input": "1 0\n- 1", "output": "0 1" }, { "input": "1 10\n+ 10", "output": "20 0" }, { "input": "1 3\n- 5", "output": "3 1" }, { "input": "1 0\n- 5", "output": "0 1" }, { "input": "1 0\n+ 5", "output": "5 0" } ]
1,647,430,520
2,147,483,647
Python 3
OK
TESTS
34
46
0
n,d=input().split() d=int(d) c=0 for i in range(int(n)): m,s=input().split() if m=="+" : d+=int(s) elif m=="-" : if d>=int(s) : d-=int(s) else : c+=1 continue print(d,c)
Title: Free Ice Cream Time Limit: None seconds Memory Limit: None megabytes Problem Description: After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer. At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue). If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress. Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids. Input Specification: The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109). Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place. Output Specification: Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress. Demo Input: ['5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n', '5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n'] Demo Output: ['22 1\n', '3 2\n'] Note: Consider the first sample. 1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
```python n,d=input().split() d=int(d) c=0 for i in range(int(n)): m,s=input().split() if m=="+" : d+=int(s) elif m=="-" : if d>=int(s) : d-=int(s) else : c+=1 continue print(d,c) ```
3
127
A
Wasted Time
PROGRAMMING
900
[ "geometry" ]
null
null
Mr. Scrooge, a very busy man, decided to count the time he wastes on all sorts of useless stuff to evaluate the lost profit. He has already counted the time he wastes sleeping and eating. And now Mr. Scrooge wants to count the time he has wasted signing papers. Mr. Scrooge's signature can be represented as a polyline *A*1*A*2... *A**n*. Scrooge signs like that: first it places a pen at the point *A*1, then draws a segment from point *A*1 to point *A*2, then he draws a segment from point *A*2 to point *A*3 and so on to point *A**n*, where he stops signing and takes the pen off the paper. At that the resulting line can intersect with itself and partially repeat itself but Scrooge pays no attention to it and never changes his signing style. As Scrooge makes the signature, he never takes the pen off the paper and his writing speed is constant — 50 millimeters per second. Scrooge signed exactly *k* papers throughout his life and all those signatures look the same. Find the total time Scrooge wasted signing the papers.
The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000). Each of the following *n* lines contains the coordinates of the polyline's endpoints. The *i*-th one contains coordinates of the point *A**i* — integers *x**i* and *y**i*, separated by a space. All points *A**i* are different. The absolute value of all coordinates does not exceed 20. The coordinates are measured in millimeters.
Print one real number — the total time Scrooges wastes on signing the papers in seconds. The absolute or relative error should not exceed 10<=-<=6.
[ "2 1\n0 0\n10 0\n", "5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0\n", "6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0\n" ]
[ "0.200000000", "6.032163204", "3.000000000" ]
none
500
[ { "input": "2 1\n0 0\n10 0", "output": "0.200000000" }, { "input": "5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0", "output": "6.032163204" }, { "input": "6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0", "output": "3.000000000" }, { "input": "10 95\n-20 -5\n2 -8\n14 13\n10 3\n17 11\n13 -12\n-6 11\n14 -15\n-13 14\n19 8", "output": "429.309294877" }, { "input": "30 1000\n4 -13\n14 13\n-14 -16\n-9 18\n17 11\n2 -8\n2 15\n8 -1\n-9 13\n8 -12\n-2 20\n11 -12\n19 8\n9 -15\n-20 -5\n-18 20\n-13 14\n-12 -17\n-4 3\n13 -12\n11 -10\n18 7\n-6 11\n10 13\n10 3\n6 -14\n-1 10\n14 -15\n2 11\n-8 10", "output": "13629.282573522" }, { "input": "2 1\n-20 -10\n-10 -6", "output": "0.215406592" }, { "input": "2 13\n13 -10\n-3 -2", "output": "4.651021393" }, { "input": "2 21\n13 8\n14 10", "output": "0.939148551" }, { "input": "2 75\n-3 12\n1 12", "output": "6.000000000" }, { "input": "2 466\n10 16\n-6 -3", "output": "231.503997374" }, { "input": "2 999\n6 16\n-17 -14", "output": "755.286284531" }, { "input": "2 1000\n-17 -14\n-14 -8", "output": "134.164078650" }, { "input": "3 384\n-4 -19\n-17 -2\n3 4", "output": "324.722285390" }, { "input": "5 566\n-11 8\n2 -7\n7 0\n-7 -9\n-7 5", "output": "668.956254495" }, { "input": "7 495\n-10 -13\n-9 -5\n4 9\n8 13\n-4 2\n2 10\n-18 15", "output": "789.212495576" }, { "input": "10 958\n7 13\n20 19\n12 -7\n10 -10\n-13 -15\n-10 -7\n20 -5\n-11 19\n-7 3\n-4 18", "output": "3415.618464093" }, { "input": "13 445\n-15 16\n-8 -14\n8 7\n4 15\n8 -13\n15 -11\n-12 -4\n2 -13\n-5 0\n-20 -14\n-8 -7\n-10 -18\n18 -5", "output": "2113.552527680" }, { "input": "18 388\n11 -8\n13 10\n18 -17\n-15 3\n-13 -15\n20 -7\n1 -10\n-13 -12\n-12 -15\n-17 -8\n1 -2\n3 -20\n-8 -9\n15 -13\n-19 -6\n17 3\n-17 2\n6 6", "output": "2999.497312668" }, { "input": "25 258\n-5 -3\n-18 -14\n12 3\n6 11\n4 2\n-19 -3\n19 -7\n-15 19\n-19 -12\n-11 -10\n-5 17\n10 15\n-4 1\n-3 -20\n6 16\n18 -19\n11 -19\n-17 10\n-17 17\n-2 -17\n-3 -9\n18 13\n14 8\n-2 -5\n-11 4", "output": "2797.756635934" }, { "input": "29 848\n11 -10\n-19 1\n18 18\n19 -19\n0 -5\n16 10\n-20 -14\n7 15\n6 8\n-15 -16\n9 3\n16 -20\n-12 12\n18 -1\n-11 14\n18 10\n11 -20\n-20 -16\n-1 11\n13 10\n-6 13\n-7 -10\n-11 -10\n-10 3\n15 -13\n-4 11\n-13 -11\n-11 -17\n11 -5", "output": "12766.080247922" }, { "input": "36 3\n-11 20\n-11 13\n-17 9\n15 9\n-6 9\n-1 11\n12 -11\n16 -10\n-20 7\n-18 6\n-15 -2\n20 -20\n16 4\n-20 -8\n-12 -15\n-13 -6\n-9 -4\n0 -10\n8 -1\n1 4\n5 8\n8 -15\n16 -12\n19 1\n0 -4\n13 -4\n17 -13\n-7 11\n14 9\n-14 -9\n5 -8\n11 -8\n-17 -5\n1 -3\n-16 -17\n2 -3", "output": "36.467924851" }, { "input": "48 447\n14 9\n9 -17\n-17 11\n-14 14\n19 -8\n-14 -17\n-7 10\n-6 -11\n-9 -19\n19 10\n-4 2\n-5 16\n20 9\n-10 20\n-7 -17\n14 -16\n-2 -10\n-18 -17\n14 12\n-6 -19\n5 -18\n-3 2\n-3 10\n-5 5\n13 -12\n10 -18\n10 -12\n-2 4\n7 -15\n-5 -5\n11 14\n11 10\n-6 -9\n13 -4\n13 9\n6 12\n-13 17\n-9 -12\n14 -19\n10 12\n-15 8\n-1 -11\n19 8\n11 20\n-9 -3\n16 1\n-14 19\n8 -4", "output": "9495.010556306" }, { "input": "50 284\n-17 -13\n7 12\n-13 0\n13 1\n14 6\n14 -9\n-5 -1\n0 -10\n12 -3\n-14 6\n-8 10\n-16 17\n0 -1\n4 -9\n2 6\n1 8\n-8 -14\n3 9\n1 -15\n-4 -19\n-7 -20\n18 10\n3 -11\n10 16\n2 -6\n-9 19\n-3 -1\n20 9\n-12 -5\n-10 -2\n16 -7\n-16 -18\n-2 17\n2 8\n7 -15\n4 1\n6 -17\n19 9\n-10 -20\n5 2\n10 -2\n3 7\n20 0\n8 -14\n-16 -1\n-20 7\n20 -19\n17 18\n-11 -18\n-16 14", "output": "6087.366930474" }, { "input": "57 373\n18 3\n-4 -1\n18 5\n-7 -15\n-6 -10\n-19 1\n20 15\n15 4\n-1 -2\n13 -14\n0 12\n10 3\n-16 -17\n-14 -9\n-11 -10\n17 19\n-2 6\n-12 -15\n10 20\n16 7\n9 -1\n4 13\n8 -2\n-1 -16\n-3 8\n14 11\n-12 3\n-5 -6\n3 4\n5 7\n-9 9\n11 4\n-19 10\n-7 4\n-20 -12\n10 16\n13 11\n13 -11\n7 -1\n17 18\n-19 7\n14 13\n5 -1\n-7 6\n-1 -6\n6 20\n-16 2\n4 17\n16 -11\n-4 -20\n19 -18\n17 16\n-14 -8\n3 2\n-6 -16\n10 -10\n-13 -11", "output": "8929.162822862" }, { "input": "60 662\n15 17\n-2 -19\n-4 -17\n10 0\n15 10\n-8 -14\n14 9\n-15 20\n6 5\n-9 0\n-13 20\n13 -2\n10 9\n7 5\n4 18\n-10 1\n6 -15\n15 -16\n6 13\n4 -6\n2 5\n18 19\n8 3\n-7 14\n-12 -20\n14 19\n-15 0\n-2 -12\n9 18\n14 4\n2 -20\n3 0\n20 9\n-5 11\n-11 1\n2 -19\n-14 -4\n18 6\n16 16\n15 3\n-1 -5\n9 20\n12 -8\n-1 10\n-4 -9\n3 6\n3 -12\n14 -10\n-8 10\n-18 6\n14 -2\n-14 -12\n-10 -7\n10 -6\n14 1\n6 14\n15 19\n4 14\n3 -14\n-9 -13", "output": "16314.207721932" }, { "input": "61 764\n-9 15\n11 -8\n-6 -7\n-13 -19\n16 -16\n-5 -1\n20 -19\n-14 -1\n-11 4\n7 -2\n-3 2\n-14 -17\n15 18\n20 15\n-13 -2\n15 8\n3 13\n19 -10\n2 -6\n15 -3\n-12 11\n4 -16\n-14 20\n0 2\n11 -7\n-6 -11\n16 7\n8 -3\n16 -10\n-3 9\n9 5\n4 -1\n-17 9\n14 -4\n8 6\n-19 12\n10 -17\n-5 7\n7 -3\n5 3\n6 -14\n9 9\n-16 -19\n11 -16\n-17 15\n8 5\n16 -19\n-7 10\n14 -15\n15 19\n-20 -16\n6 -2\n-4 6\n7 -15\n1 -8\n20 -17\n3 7\n10 12\n10 -11\n-19 10\n0 -11", "output": "22153.369189802" } ]
1,601,668,084
2,147,483,647
PyPy 3
OK
TESTS
42
280
0
import math def main(): n, k = map(int, input().split()) last_x, last_y = map(float, input().split()) distance = 0 for _ in range(n - 1): x, y = map(float, input().split()) distance += math.sqrt((x - last_x) ** 2 + (y - last_y) ** 2) last_x, last_y = x, y print(distance / 50 * k) if __name__ == '__main__': main()
Title: Wasted Time Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mr. Scrooge, a very busy man, decided to count the time he wastes on all sorts of useless stuff to evaluate the lost profit. He has already counted the time he wastes sleeping and eating. And now Mr. Scrooge wants to count the time he has wasted signing papers. Mr. Scrooge's signature can be represented as a polyline *A*1*A*2... *A**n*. Scrooge signs like that: first it places a pen at the point *A*1, then draws a segment from point *A*1 to point *A*2, then he draws a segment from point *A*2 to point *A*3 and so on to point *A**n*, where he stops signing and takes the pen off the paper. At that the resulting line can intersect with itself and partially repeat itself but Scrooge pays no attention to it and never changes his signing style. As Scrooge makes the signature, he never takes the pen off the paper and his writing speed is constant — 50 millimeters per second. Scrooge signed exactly *k* papers throughout his life and all those signatures look the same. Find the total time Scrooge wasted signing the papers. Input Specification: The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000). Each of the following *n* lines contains the coordinates of the polyline's endpoints. The *i*-th one contains coordinates of the point *A**i* — integers *x**i* and *y**i*, separated by a space. All points *A**i* are different. The absolute value of all coordinates does not exceed 20. The coordinates are measured in millimeters. Output Specification: Print one real number — the total time Scrooges wastes on signing the papers in seconds. The absolute or relative error should not exceed 10<=-<=6. Demo Input: ['2 1\n0 0\n10 0\n', '5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0\n', '6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0\n'] Demo Output: ['0.200000000', '6.032163204', '3.000000000'] Note: none
```python import math def main(): n, k = map(int, input().split()) last_x, last_y = map(float, input().split()) distance = 0 for _ in range(n - 1): x, y = map(float, input().split()) distance += math.sqrt((x - last_x) ** 2 + (y - last_y) ** 2) last_x, last_y = x, y print(distance / 50 * k) if __name__ == '__main__': main() ```
3
277
A
Learning Languages
PROGRAMMING
1,400
[ "dfs and similar", "dsu" ]
null
null
The "BerCorp" company has got *n* employees. These employees can use *m* approved official languages for the formal correspondence. The languages are numbered with integers from 1 to *m*. For each employee we have the list of languages, which he knows. This list could be empty, i. e. an employee may know no official languages. But the employees are willing to learn any number of official languages, as long as the company pays their lessons. A study course in one language for one employee costs 1 berdollar. Find the minimum sum of money the company needs to spend so as any employee could correspond to any other one (their correspondence can be indirect, i. e. other employees can help out translating).
The first line contains two integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of employees and the number of languages. Then *n* lines follow — each employee's language list. At the beginning of the *i*-th line is integer *k**i* (0<=≤<=*k**i*<=≤<=*m*) — the number of languages the *i*-th employee knows. Next, the *i*-th line contains *k**i* integers — *a**ij* (1<=≤<=*a**ij*<=≤<=*m*) — the identifiers of languages the *i*-th employee knows. It is guaranteed that all the identifiers in one list are distinct. Note that an employee may know zero languages. The numbers in the lines are separated by single spaces.
Print a single integer — the minimum amount of money to pay so that in the end every employee could write a letter to every other one (other employees can help out translating).
[ "5 5\n1 2\n2 2 3\n2 3 4\n2 4 5\n1 5\n", "8 7\n0\n3 1 2 3\n1 1\n2 5 4\n2 6 7\n1 3\n2 7 4\n1 1\n", "2 2\n1 2\n0\n" ]
[ "0\n", "2\n", "1\n" ]
In the second sample the employee 1 can learn language 2, and employee 8 can learn language 4. In the third sample employee 2 must learn language 2.
500
[ { "input": "5 5\n1 2\n2 2 3\n2 3 4\n2 4 5\n1 5", "output": "0" }, { "input": "8 7\n0\n3 1 2 3\n1 1\n2 5 4\n2 6 7\n1 3\n2 7 4\n1 1", "output": "2" }, { "input": "2 2\n1 2\n0", "output": "1" }, { "input": "2 2\n0\n0", "output": "2" }, { "input": "5 5\n1 3\n0\n0\n2 4 1\n0", "output": "4" }, { "input": "6 2\n0\n0\n2 1 2\n1 1\n1 1\n0", "output": "3" }, { "input": "7 3\n3 1 3 2\n3 2 1 3\n2 2 3\n1 1\n2 2 3\n3 3 2 1\n3 2 3 1", "output": "0" }, { "input": "8 4\n0\n0\n4 2 3 1 4\n4 2 1 4 3\n3 4 3 1\n1 2\n2 4 1\n2 4 2", "output": "2" }, { "input": "10 10\n5 7 5 2 8 1\n7 10 6 9 5 8 2 4\n2 2 7\n5 8 6 9 10 1\n2 9 5\n3 6 5 2\n6 5 8 7 9 10 4\n0\n1 1\n2 8 6", "output": "1" }, { "input": "11 42\n4 20 26 9 24\n14 34 7 28 32 12 15 26 4 10 38 21 20 8 11\n4 21 8 36 6\n11 32 1 39 11 21 10 25 17 26 15 4\n2 8 12\n2 21 31\n8 17 10 3 39 32 30 5 15\n20 24 20 38 17 4 7 21 19 32 28 31 22 30 37 10 5 33 2 13 9\n7 38 34 42 27 20 11 6\n3 40 3 39\n14 39 40 4 30 33 8 36 28 14 23 16 7 25 9", "output": "0" }, { "input": "100 100\n1 33\n0\n2 35 4\n2 40 78\n1 69\n0\n1 2\n0\n0\n2 81 34\n1 45\n0\n1 87\n1 50\n1 97\n0\n2 100 59\n0\n0\n0\n1 45\n0\n0\n0\n1 6\n1 54\n0\n0\n0\n4 79 96 52 84\n1 86\n0\n0\n0\n0\n0\n0\n0\n0\n3 90 2 80\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 2\n0\n1 64\n0\n1 78\n1 82\n0\n0\n0\n0\n0\n1 6\n0\n0\n2 47 57\n1 95\n0\n2 91 79\n0\n1 27\n0\n1 74\n0\n0\n1 14\n0\n0\n2 90 19\n0\n1 10\n0\n0\n0\n0\n0\n1 57\n0\n2 28 50\n0\n0\n0\n1 47\n0\n0\n1 14\n0\n1 84\n1 1\n0\n0", "output": "87" }, { "input": "2 2\n2 1 2\n2 1 2", "output": "0" }, { "input": "2 2\n2 1 2\n1 1", "output": "0" }, { "input": "2 2\n1 2\n1 1", "output": "1" }, { "input": "3 100\n0\n0\n0", "output": "3" }, { "input": "100 100\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0", "output": "100" }, { "input": "3 3\n0\n0\n0", "output": "3" } ]
1,679,714,070
2,147,483,647
PyPy 3-64
OK
TESTS
33
154
6,553,600
par = list(range(101)) rnk = [0] * 101 freq = [0] * 101 def find_parent(x): if x != par[x]: par[x] = find_parent(par[x]) return par[x] def union(x, y): a = find_parent(x) b = find_parent(y) if a == b: return if rnk[a] < rnk[b]: par[a] = b else: par[b] = a if rnk[a] == rnk[b]: rnk[b] += 1 if __name__ == '__main__': n, m = map(int, input().split()) no_lang = 0 for i in range(m + 1): par[i] = i for i in range(n): k, *elems = map(int, input().split()) if k == 0: no_lang += 1 continue u = elems[0] freq[u] += 1 for j in range(1, k): v = elems[j] freq[v] += 1 union(u, v) ans = 0 cnt = 0 for i in range(1, m + 1): if freq[i] == 0: cnt += 1 elif par[i] == i: ans += 1 ans -= 1 if cnt == m: print(n) else: print(ans + no_lang)
Title: Learning Languages Time Limit: None seconds Memory Limit: None megabytes Problem Description: The "BerCorp" company has got *n* employees. These employees can use *m* approved official languages for the formal correspondence. The languages are numbered with integers from 1 to *m*. For each employee we have the list of languages, which he knows. This list could be empty, i. e. an employee may know no official languages. But the employees are willing to learn any number of official languages, as long as the company pays their lessons. A study course in one language for one employee costs 1 berdollar. Find the minimum sum of money the company needs to spend so as any employee could correspond to any other one (their correspondence can be indirect, i. e. other employees can help out translating). Input Specification: The first line contains two integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of employees and the number of languages. Then *n* lines follow — each employee's language list. At the beginning of the *i*-th line is integer *k**i* (0<=≤<=*k**i*<=≤<=*m*) — the number of languages the *i*-th employee knows. Next, the *i*-th line contains *k**i* integers — *a**ij* (1<=≤<=*a**ij*<=≤<=*m*) — the identifiers of languages the *i*-th employee knows. It is guaranteed that all the identifiers in one list are distinct. Note that an employee may know zero languages. The numbers in the lines are separated by single spaces. Output Specification: Print a single integer — the minimum amount of money to pay so that in the end every employee could write a letter to every other one (other employees can help out translating). Demo Input: ['5 5\n1 2\n2 2 3\n2 3 4\n2 4 5\n1 5\n', '8 7\n0\n3 1 2 3\n1 1\n2 5 4\n2 6 7\n1 3\n2 7 4\n1 1\n', '2 2\n1 2\n0\n'] Demo Output: ['0\n', '2\n', '1\n'] Note: In the second sample the employee 1 can learn language 2, and employee 8 can learn language 4. In the third sample employee 2 must learn language 2.
```python par = list(range(101)) rnk = [0] * 101 freq = [0] * 101 def find_parent(x): if x != par[x]: par[x] = find_parent(par[x]) return par[x] def union(x, y): a = find_parent(x) b = find_parent(y) if a == b: return if rnk[a] < rnk[b]: par[a] = b else: par[b] = a if rnk[a] == rnk[b]: rnk[b] += 1 if __name__ == '__main__': n, m = map(int, input().split()) no_lang = 0 for i in range(m + 1): par[i] = i for i in range(n): k, *elems = map(int, input().split()) if k == 0: no_lang += 1 continue u = elems[0] freq[u] += 1 for j in range(1, k): v = elems[j] freq[v] += 1 union(u, v) ans = 0 cnt = 0 for i in range(1, m + 1): if freq[i] == 0: cnt += 1 elif par[i] == i: ans += 1 ans -= 1 if cnt == m: print(n) else: print(ans + no_lang) ```
3
509
A
Maximum in Table
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
An *n*<=×<=*n* table *a* is defined as follows: - The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1. These conditions define all the values in the table. You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
Print a single line containing a positive integer *m* — the maximum value in the table.
[ "1\n", "5\n" ]
[ "1", "70" ]
In the second test the rows of the table look as follows:
0
[ { "input": "1", "output": "1" }, { "input": "5", "output": "70" }, { "input": "2", "output": "2" }, { "input": "3", "output": "6" }, { "input": "4", "output": "20" }, { "input": "6", "output": "252" }, { "input": "7", "output": "924" }, { "input": "9", "output": "12870" }, { "input": "10", "output": "48620" }, { "input": "8", "output": "3432" } ]
1,645,802,392
2,147,483,647
Python 3
OK
TESTS
10
31
0
class solution: def __init__(self,n): self.n = n self.answer = [] def caluclation(self): self.answer =[[1]*self.n]*self.n for i in range(1,self.n): for j in range(1,self.n): self.answer[i][j] = self.answer[i-1][j] + self.answer[i][j-1] n=int(input()) root = solution(n) root.caluclation() print(root.answer[-1][-1])
Title: Maximum in Table Time Limit: None seconds Memory Limit: None megabytes Problem Description: An *n*<=×<=*n* table *a* is defined as follows: - The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1. These conditions define all the values in the table. You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above. Input Specification: The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table. Output Specification: Print a single line containing a positive integer *m* — the maximum value in the table. Demo Input: ['1\n', '5\n'] Demo Output: ['1', '70'] Note: In the second test the rows of the table look as follows:
```python class solution: def __init__(self,n): self.n = n self.answer = [] def caluclation(self): self.answer =[[1]*self.n]*self.n for i in range(1,self.n): for j in range(1,self.n): self.answer[i][j] = self.answer[i-1][j] + self.answer[i][j-1] n=int(input()) root = solution(n) root.caluclation() print(root.answer[-1][-1]) ```
3
556
B
Case of Fake Numbers
PROGRAMMING
1,100
[ "brute force", "implementation" ]
null
null
Andrewid the Android is a galaxy-famous detective. He is now investigating a case of frauds who make fake copies of the famous Stolp's gears, puzzles that are as famous as the Rubik's cube once was. Its most important components are a button and a line of *n* similar gears. Each gear has *n* teeth containing all numbers from 0 to *n*<=-<=1 in the counter-clockwise order. When you push a button, the first gear rotates clockwise, then the second gear rotates counter-clockwise, the the third gear rotates clockwise an so on. Besides, each gear has exactly one active tooth. When a gear turns, a new active tooth is the one following after the current active tooth according to the direction of the rotation. For example, if *n*<==<=5, and the active tooth is the one containing number 0, then clockwise rotation makes the tooth with number 1 active, or the counter-clockwise rotating makes the tooth number 4 active. Andrewid remembers that the real puzzle has the following property: you can push the button multiple times in such a way that in the end the numbers on the active teeth of the gears from first to last form sequence 0,<=1,<=2,<=...,<=*n*<=-<=1. Write a program that determines whether the given puzzle is real or fake.
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of gears. The second line contains *n* digits *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=*n*<=-<=1) — the sequence of active teeth: the active tooth of the *i*-th gear contains number *a**i*.
In a single line print "Yes" (without the quotes), if the given Stolp's gears puzzle is real, and "No" (without the quotes) otherwise.
[ "3\n1 0 0\n", "5\n4 2 1 4 3\n", "4\n0 2 3 1\n" ]
[ "Yes\n", "Yes\n", "No\n" ]
In the first sample test when you push the button for the first time, the sequence of active teeth will be 2 2 1, when you push it for the second time, you get 0 1 2.
250
[ { "input": "3\n1 0 0", "output": "Yes" }, { "input": "5\n4 2 1 4 3", "output": "Yes" }, { "input": "4\n0 2 3 1", "output": "No" }, { "input": "1\n0", "output": "Yes" }, { "input": "2\n1 0", "output": "Yes" }, { "input": "5\n2 4 4 1 1", "output": "Yes" }, { "input": "10\n0 1 2 3 4 5 6 7 8 9", "output": "Yes" }, { "input": "10\n1 5 1 0 6 1 3 5 9 9", "output": "No" }, { "input": "20\n10 11 12 13 14 15 16 17 18 19 0 1 2 3 4 5 6 7 8 9", "output": "Yes" }, { "input": "20\n2 15 18 0 3 12 4 16 13 7 17 9 8 2 15 18 19 17 5 8", "output": "No" }, { "input": "50\n38 13 40 15 42 17 44 19 46 21 48 23 0 25 2 27 4 29 6 31 8 33 10 35 12 37 14 39 16 41 18 43 20 45 22 47 24 49 26 1 28 3 30 5 32 7 34 9 36 11", "output": "Yes" }, { "input": "50\n12 16 9 0 18 36 5 42 28 1 4 43 38 35 14 37 39 13 23 15 37 45 31 38 20 13 18 38 1 13 5 24 35 11 0 44 16 42 8 10 27 3 1 33 33 29 29 33 49 48", "output": "No" }, { "input": "100\n15 86 17 88 19 90 21 92 23 94 25 96 27 98 29 0 31 2 33 4 35 6 37 8 39 10 41 12 43 14 45 16 47 18 49 20 51 22 53 24 55 26 57 28 59 30 61 32 63 34 65 36 67 38 69 40 71 42 73 44 75 46 77 48 79 50 81 52 83 54 85 56 87 58 89 60 91 62 93 64 95 66 97 68 99 70 1 72 3 74 5 76 7 78 9 80 11 82 13 84", "output": "Yes" }, { "input": "15\n2 14 4 1 6 3 8 5 10 7 12 9 14 11 1", "output": "Yes" }, { "input": "30\n19 12 21 14 23 16 25 18 27 20 29 22 1 24 3 26 5 28 7 0 9 2 11 4 13 6 15 8 17 10", "output": "Yes" }, { "input": "50\n27 24 29 26 31 28 33 30 35 32 37 34 39 36 41 38 43 40 45 42 47 44 49 46 1 48 3 0 5 2 7 4 9 6 11 8 13 10 15 12 17 14 19 16 21 18 23 20 25 22", "output": "Yes" }, { "input": "50\n23 19 25 45 22 37 49 22 36 16 30 19 21 4 46 28 39 19 24 12 22 36 41 46 34 40 11 46 29 10 6 21 30 29 6 5 49 45 13 39 34 17 44 45 28 34 7 43 15 25", "output": "No" }, { "input": "100\n95 6 97 8 99 10 1 12 3 14 5 16 7 18 9 20 11 22 13 24 15 26 17 28 19 30 21 32 23 34 25 36 27 38 29 40 31 42 33 44 35 46 37 48 39 50 41 52 43 54 45 56 47 58 49 60 51 62 53 64 55 66 57 68 59 70 61 72 63 74 65 76 67 78 69 80 71 82 73 84 75 86 77 88 79 90 81 92 83 94 85 96 87 98 89 0 91 2 93 4", "output": "Yes" }, { "input": "100\n20 45 10 74 41 81 78 74 91 17 21 65 89 63 7 44 97 3 1 89 87 44 32 10 44 73 73 88 62 77 96 59 4 8 55 1 82 52 63 11 59 53 9 47 29 73 38 44 36 24 72 61 24 11 38 6 91 4 0 65 37 58 20 56 70 87 54 42 79 45 46 73 7 85 43 76 69 35 72 79 38 6 8 0 49 39 32 24 28 54 8 43 98 65 50 20 22 23 2 85", "output": "No" }, { "input": "100\n79 74 22 11 73 70 33 50 9 81 17 14 23 44 4 90 20 22 19 94 66 80 70 42 22 82 49 42 36 7 90 91 80 33 26 52 6 77 30 94 99 6 46 84 96 40 89 2 88 65 80 93 5 60 25 15 32 26 68 85 62 74 69 55 84 0 85 91 23 43 84 94 25 65 28 92 16 0 7 83 48 74 15 20 5 97 34 42 99 97 18 39 21 23 95 77 42 17 32 94", "output": "No" }, { "input": "100\n74 27 76 29 78 31 80 33 82 35 84 37 86 39 88 41 90 43 92 45 94 47 96 49 98 51 0 53 2 55 4 57 6 59 8 61 10 63 12 65 14 67 16 69 18 71 20 73 22 75 24 77 26 79 28 81 30 83 32 85 34 87 36 89 38 91 40 93 42 95 44 97 46 99 48 1 50 3 52 5 54 7 56 9 58 11 60 13 62 15 64 17 66 19 68 21 70 23 72 25", "output": "Yes" }, { "input": "2\n0 0", "output": "No" }, { "input": "2\n0 1", "output": "Yes" }, { "input": "2\n1 0", "output": "Yes" }, { "input": "2\n1 1", "output": "No" }, { "input": "3\n0 1 1", "output": "No" }, { "input": "3\n0 2 2", "output": "No" }, { "input": "4\n0 1 2 2", "output": "No" }, { "input": "3\n1 1 0", "output": "No" } ]
1,610,460,702
2,147,483,647
Python 3
OK
TESTS
50
62
307,200
def solve (n,seq) : if seq[0] != 0 : move = (n - seq[0]) else : move = 0 index = 1 while index < n : if index%2 == 0 : if (seq[index] + move)%n != index : return "No" else : toZero = seq[index] if move > toZero : remain = move - toZero remain -= 1 if (n-1)-remain != index : return "No" else : if seq[index] - move != index : return "No" index += 1 return "Yes" n = int(input()) seq = list(map(int,input().split())) print (solve(n,seq))
Title: Case of Fake Numbers Time Limit: None seconds Memory Limit: None megabytes Problem Description: Andrewid the Android is a galaxy-famous detective. He is now investigating a case of frauds who make fake copies of the famous Stolp's gears, puzzles that are as famous as the Rubik's cube once was. Its most important components are a button and a line of *n* similar gears. Each gear has *n* teeth containing all numbers from 0 to *n*<=-<=1 in the counter-clockwise order. When you push a button, the first gear rotates clockwise, then the second gear rotates counter-clockwise, the the third gear rotates clockwise an so on. Besides, each gear has exactly one active tooth. When a gear turns, a new active tooth is the one following after the current active tooth according to the direction of the rotation. For example, if *n*<==<=5, and the active tooth is the one containing number 0, then clockwise rotation makes the tooth with number 1 active, or the counter-clockwise rotating makes the tooth number 4 active. Andrewid remembers that the real puzzle has the following property: you can push the button multiple times in such a way that in the end the numbers on the active teeth of the gears from first to last form sequence 0,<=1,<=2,<=...,<=*n*<=-<=1. Write a program that determines whether the given puzzle is real or fake. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of gears. The second line contains *n* digits *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=*n*<=-<=1) — the sequence of active teeth: the active tooth of the *i*-th gear contains number *a**i*. Output Specification: In a single line print "Yes" (without the quotes), if the given Stolp's gears puzzle is real, and "No" (without the quotes) otherwise. Demo Input: ['3\n1 0 0\n', '5\n4 2 1 4 3\n', '4\n0 2 3 1\n'] Demo Output: ['Yes\n', 'Yes\n', 'No\n'] Note: In the first sample test when you push the button for the first time, the sequence of active teeth will be 2 2 1, when you push it for the second time, you get 0 1 2.
```python def solve (n,seq) : if seq[0] != 0 : move = (n - seq[0]) else : move = 0 index = 1 while index < n : if index%2 == 0 : if (seq[index] + move)%n != index : return "No" else : toZero = seq[index] if move > toZero : remain = move - toZero remain -= 1 if (n-1)-remain != index : return "No" else : if seq[index] - move != index : return "No" index += 1 return "Yes" n = int(input()) seq = list(map(int,input().split())) print (solve(n,seq)) ```
3
549
G
Happy Line
PROGRAMMING
2,200
[ "constructive algorithms", "greedy", "sortings" ]
null
null
Do you like summer? Residents of Berland do. They especially love eating ice cream in the hot summer. So this summer day a large queue of *n* Berland residents lined up in front of the ice cream stall. We know that each of them has a certain amount of berland dollars with them. The residents of Berland are nice people, so each person agrees to swap places with the person right behind him for just 1 dollar. More formally, if person *a* stands just behind person *b*, then person *a* can pay person *b* 1 dollar, then *a* and *b* get swapped. Of course, if person *a* has zero dollars, he can not swap places with person *b*. Residents of Berland are strange people. In particular, they get upset when there is someone with a strictly smaller sum of money in the line in front of them. Can you help the residents of Berland form such order in the line so that they were all happy? A happy resident is the one who stands first in the line or the one in front of who another resident stands with not less number of dollars. Note that the people of Berland are people of honor and they agree to swap places only in the manner described above.
The first line contains integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of residents who stand in the line. The second line contains *n* space-separated integers *a**i* (0<=≤<=*a**i*<=≤<=109), where *a**i* is the number of Berland dollars of a man standing on the *i*-th position in the line. The positions are numbered starting from the end of the line.
If it is impossible to make all the residents happy, print ":(" without the quotes. Otherwise, print in the single line *n* space-separated integers, the *i*-th of them must be equal to the number of money of the person on position *i* in the new line. If there are multiple answers, print any of them.
[ "2\n11 8\n", "5\n10 9 7 10 6\n", "3\n12 3 3\n" ]
[ "9 10 ", ":(\n", "4 4 10 " ]
In the first sample two residents should swap places, after that the first resident has 10 dollars and he is at the head of the line and the second resident will have 9 coins and he will be at the end of the line. In the second sample it is impossible to achieve the desired result. In the third sample the first person can swap with the second one, then they will have the following numbers of dollars: 4 11 3, then the second person (in the new line) swaps with the third one, and the resulting numbers of dollars will equal to: 4 4 10. In this line everybody will be happy.
1,500
[ { "input": "2\n11 8", "output": "9 10 " }, { "input": "5\n10 9 7 10 6", "output": ":(" }, { "input": "3\n12 3 3", "output": "4 4 10 " }, { "input": "4\n7 3 9 10", "output": "4 6 9 10 " }, { "input": "1\n1", "output": "1 " }, { "input": "5\n15 5 8 6 3", "output": "6 6 7 7 11 " }, { "input": "1\n1000000000", "output": "1000000000 " }, { "input": "2\n2 1", "output": ":(" }, { "input": "3\n11 1 9", "output": ":(" }, { "input": "1\n0", "output": "0 " }, { "input": "20\n38 32 21 44 26 24 15 32 34 40 31 33 33 13 26 28 12 10 14 18", "output": "21 22 24 24 24 24 24 25 25 28 28 28 28 28 28 28 28 28 29 30 " }, { "input": "20\n43 38 20 41 16 37 27 29 19 17 24 19 28 8 14 32 13 21 32 16", "output": "20 20 20 23 23 23 23 23 25 25 25 25 26 26 26 27 27 27 29 31 " }, { "input": "20\n44 50 41 18 28 31 21 38 12 20 28 15 12 29 16 31 34 24 19 15", "output": "20 20 22 23 23 24 24 25 26 27 27 27 29 29 29 29 29 29 32 32 " }, { "input": "10\n920480900 920480899 920480898 920480897 920480896 920480895 920480894 920480893 920480892 920480891", "output": ":(" }, { "input": "10\n536259132 536259132 536259132 536259132 536259132 536259132 536259132 536259132 536259132 536259132", "output": "536259132 536259132 536259132 536259132 536259132 536259132 536259132 536259132 536259132 536259132 " }, { "input": "10\n876584065 876584063 876584061 876584059 876584057 876584055 876584053 876584051 876584049 876584047", "output": "876584056 876584056 876584056 876584056 876584056 876584056 876584056 876584056 876584056 876584056 " }, { "input": "10\n528402489 528402486 528402483 528402480 528402477 528402474 528402471 528402468 528402465 528402462", "output": "528402471 528402472 528402473 528402474 528402475 528402476 528402477 528402478 528402479 528402480 " }, { "input": "10\n383593860 383593860 383593860 383593860 383593860 383593858 383593856 383593854 383593852 383593850", "output": ":(" }, { "input": "10\n198447418 198447416 198447414 198447412 198447410 198447410 198447410 198447410 198447410 198447410", "output": ":(" }, { "input": "10\n520230360 520230361 520230362 520230363 520230364 520230365 520230366 520230367 520230368 520230369", "output": "520230360 520230361 520230362 520230363 520230364 520230365 520230366 520230367 520230368 520230369 " } ]
1,570,057,512
2,147,483,647
Python 3
OK
TESTS
52
405
18,329,600
n=int(input()) fila=list(map(int, input().split())) break_ = False for i in range(n): fila[i] += i fila = sorted(list(set(fila))) if len(fila) < n: print(":(") else: for j in range(n): fila[j] -= j print(" ".join(map(str, fila)))
Title: Happy Line Time Limit: None seconds Memory Limit: None megabytes Problem Description: Do you like summer? Residents of Berland do. They especially love eating ice cream in the hot summer. So this summer day a large queue of *n* Berland residents lined up in front of the ice cream stall. We know that each of them has a certain amount of berland dollars with them. The residents of Berland are nice people, so each person agrees to swap places with the person right behind him for just 1 dollar. More formally, if person *a* stands just behind person *b*, then person *a* can pay person *b* 1 dollar, then *a* and *b* get swapped. Of course, if person *a* has zero dollars, he can not swap places with person *b*. Residents of Berland are strange people. In particular, they get upset when there is someone with a strictly smaller sum of money in the line in front of them. Can you help the residents of Berland form such order in the line so that they were all happy? A happy resident is the one who stands first in the line or the one in front of who another resident stands with not less number of dollars. Note that the people of Berland are people of honor and they agree to swap places only in the manner described above. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of residents who stand in the line. The second line contains *n* space-separated integers *a**i* (0<=≤<=*a**i*<=≤<=109), where *a**i* is the number of Berland dollars of a man standing on the *i*-th position in the line. The positions are numbered starting from the end of the line. Output Specification: If it is impossible to make all the residents happy, print ":(" without the quotes. Otherwise, print in the single line *n* space-separated integers, the *i*-th of them must be equal to the number of money of the person on position *i* in the new line. If there are multiple answers, print any of them. Demo Input: ['2\n11 8\n', '5\n10 9 7 10 6\n', '3\n12 3 3\n'] Demo Output: ['9 10 ', ':(\n', '4 4 10 '] Note: In the first sample two residents should swap places, after that the first resident has 10 dollars and he is at the head of the line and the second resident will have 9 coins and he will be at the end of the line. In the second sample it is impossible to achieve the desired result. In the third sample the first person can swap with the second one, then they will have the following numbers of dollars: 4 11 3, then the second person (in the new line) swaps with the third one, and the resulting numbers of dollars will equal to: 4 4 10. In this line everybody will be happy.
```python n=int(input()) fila=list(map(int, input().split())) break_ = False for i in range(n): fila[i] += i fila = sorted(list(set(fila))) if len(fila) < n: print(":(") else: for j in range(n): fila[j] -= j print(" ".join(map(str, fila))) ```
3
58
A
Chat room
PROGRAMMING
1,000
[ "greedy", "strings" ]
A. Chat room
1
256
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
If Vasya managed to say hello, print "YES", otherwise print "NO".
[ "ahhellllloou\n", "hlelo\n" ]
[ "YES\n", "NO\n" ]
none
500
[ { "input": "ahhellllloou", "output": "YES" }, { "input": "hlelo", "output": "NO" }, { "input": "helhcludoo", "output": "YES" }, { "input": "hehwelloho", "output": "YES" }, { "input": "pnnepelqomhhheollvlo", "output": "YES" }, { "input": "tymbzjyqhymedasloqbq", "output": "NO" }, { "input": "yehluhlkwo", "output": "NO" }, { "input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello", "output": "YES" }, { "input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq", "output": "YES" }, { "input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi", "output": "YES" }, { "input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo", "output": "YES" }, { "input": "lqllcolohwflhfhlnaow", "output": "NO" }, { "input": "heheeellollvoo", "output": "YES" }, { "input": "hellooo", "output": "YES" }, { "input": "o", "output": "NO" }, { "input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv", "output": "YES" }, { "input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk", "output": "YES" }, { "input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry", "output": "NO" }, { "input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq", "output": "NO" }, { "input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi", "output": "YES" }, { "input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm", "output": "YES" }, { "input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac", "output": "NO" }, { "input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok", "output": "YES" }, { "input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz", "output": "YES" }, { "input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb", "output": "YES" }, { "input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla", "output": "YES" }, { "input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz", "output": "YES" }, { "input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti", "output": "YES" }, { "input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli", "output": "YES" }, { "input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo", "output": "YES" }, { "input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk", "output": "NO" }, { "input": "loee", "output": "NO" }, { "input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo", "output": "NO" }, { "input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi", "output": "YES" }, { "input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv", "output": "NO" }, { "input": "hello", "output": "YES" }, { "input": "oohell", "output": "NO" }, { "input": "hell", "output": "NO" }, { "input": "eloellohoelo", "output": "NO" }, { "input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo", "output": "YES" } ]
1,683,202,072
2,147,483,647
PyPy 3-64
OK
TESTS
40
77
0
a = input() x= "NO" if "h" in a: b=a[a.find("h")+1:] if "e" in b: c= b[b.find("e")+1:] if "l" in c: d =c[c.find("l")+1:] if "l" in d: e =d[d.find("l")+1:] if "o" in e: x = "YES" print(x)
Title: Chat room Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*. Input Specification: The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters. Output Specification: If Vasya managed to say hello, print "YES", otherwise print "NO". Demo Input: ['ahhellllloou\n', 'hlelo\n'] Demo Output: ['YES\n', 'NO\n'] Note: none
```python a = input() x= "NO" if "h" in a: b=a[a.find("h")+1:] if "e" in b: c= b[b.find("e")+1:] if "l" in c: d =c[c.find("l")+1:] if "l" in d: e =d[d.find("l")+1:] if "o" in e: x = "YES" print(x) ```
3.9615
99
A
Help Far Away Kingdom
PROGRAMMING
800
[ "strings" ]
A. Help Far Away Kingdom
2
256
In a far away kingdom lived the King, the Prince, the Shoemaker, the Dressmaker and many other citizens. They lived happily until great trouble came into the Kingdom. The ACMers settled there. Most damage those strange creatures inflicted upon the kingdom was that they loved high precision numbers. As a result, the Kingdom healers had already had three appointments with the merchants who were asked to sell, say, exactly 0.273549107 beer barrels. To deal with the problem somehow, the King issued an order obliging rounding up all numbers to the closest integer to simplify calculations. Specifically, the order went like this: - If a number's integer part does not end with digit 9 and its fractional part is strictly less than 0.5, then the rounded up number coincides with the number’s integer part. - If a number's integer part does not end with digit 9 and its fractional part is not less than 0.5, the rounded up number is obtained if we add 1 to the last digit of the number’s integer part.- If the number’s integer part ends with digit 9, to round up the numbers one should go to Vasilisa the Wise. In the whole Kingdom she is the only one who can perform the tricky operation of carrying into the next position. Merchants found the algorithm very sophisticated and they asked you (the ACMers) to help them. Can you write a program that would perform the rounding according to the King’s order?
The first line contains a single number to round up — the integer part (a non-empty set of decimal digits that do not start with 0 — with the exception of a case when the set consists of a single digit — in this case 0 can go first), then follows character «.» (a dot), and then follows the fractional part (any non-empty set of decimal digits). The number's length does not exceed 1000 characters, including the dot. There are no other characters in the input data.
If the last number of the integer part is not equal to 9, print the rounded-up number without leading zeroes. Otherwise, print the message "GOTO Vasilisa." (without the quotes).
[ "0.0\n", "1.49\n", "1.50\n", "2.71828182845904523536\n", "3.14159265358979323846\n", "12345678901234567890.1\n", "123456789123456789.999\n" ]
[ "0", "1", "2", "3", "3", "12345678901234567890", "GOTO Vasilisa." ]
none
500
[ { "input": "0.0", "output": "0" }, { "input": "1.49", "output": "1" }, { "input": "1.50", "output": "2" }, { "input": "2.71828182845904523536", "output": "3" }, { "input": "3.14159265358979323846", "output": "3" }, { "input": "12345678901234567890.1", "output": "12345678901234567890" }, { "input": "123456789123456789.999", "output": "GOTO Vasilisa." }, { "input": "12345678901234567890.9", "output": "12345678901234567891" }, { "input": "123456789123456788.999", "output": "123456789123456789" }, { "input": "9.000", "output": "GOTO Vasilisa." }, { "input": "0.1", "output": "0" }, { "input": "0.2", "output": "0" }, { "input": "0.3", "output": "0" }, { "input": "0.4", "output": "0" }, { "input": "0.5", "output": "1" }, { "input": "0.6", "output": "1" }, { "input": "0.7", "output": "1" }, { "input": "0.8", "output": "1" }, { "input": "0.9", "output": "1" }, { "input": "1.0", "output": "1" }, { "input": "1.1", "output": "1" }, { "input": "1.2", "output": "1" }, { "input": "1.3", "output": "1" }, { "input": "1.4", "output": "1" }, { "input": "1.5", "output": "2" }, { "input": "1.6", "output": "2" }, { "input": "1.7", "output": "2" }, { "input": "1.8", "output": "2" }, { "input": "1.9", "output": "2" }, { "input": "2.0", "output": "2" }, { "input": "2.1", "output": "2" }, { "input": "2.2", "output": "2" }, { "input": "2.3", "output": "2" }, { "input": "2.4", "output": "2" }, { "input": "2.5", "output": "3" }, { "input": "2.6", "output": "3" }, { "input": "2.7", "output": "3" }, { "input": "2.8", "output": "3" }, { "input": "2.9", "output": "3" }, { "input": "3.0", "output": "3" }, { "input": "3.1", "output": "3" }, { "input": "3.2", "output": "3" }, { "input": "3.3", "output": "3" }, { "input": "3.4", "output": "3" }, { "input": "3.5", "output": "4" }, { "input": "3.6", "output": "4" }, { "input": "3.7", "output": "4" }, { "input": "3.8", "output": "4" }, { "input": "3.9", "output": "4" }, { "input": "4.0", "output": "4" }, { "input": "4.1", "output": "4" }, { "input": "4.2", "output": "4" }, { "input": "4.3", "output": "4" }, { "input": "4.4", "output": "4" }, { "input": "4.5", "output": "5" }, { "input": "4.6", "output": "5" }, { "input": "4.7", "output": "5" }, { "input": "4.8", "output": "5" }, { "input": "4.9", "output": "5" }, { "input": "5.0", "output": "5" }, { "input": "5.1", "output": "5" }, { "input": "5.2", "output": "5" }, { "input": "5.3", "output": "5" }, { "input": "5.4", "output": "5" }, { "input": "5.5", "output": "6" }, { "input": "5.6", "output": "6" }, { "input": "5.7", "output": "6" }, { "input": "5.8", "output": "6" }, { "input": "5.9", "output": "6" }, { "input": "6.0", "output": "6" }, { "input": "6.1", "output": "6" }, { "input": "6.2", "output": "6" }, { "input": "6.3", "output": "6" }, { "input": "6.4", "output": "6" }, { "input": "6.5", "output": "7" }, { "input": "6.6", "output": "7" }, { "input": "6.7", "output": "7" }, { "input": "6.8", "output": "7" }, { "input": "6.9", "output": "7" }, { "input": "7.0", "output": "7" }, { "input": "7.1", "output": "7" }, { "input": "7.2", "output": "7" }, { "input": "7.3", "output": "7" }, { "input": "7.4", "output": "7" }, { "input": "7.5", "output": "8" }, { "input": "7.6", "output": "8" }, { "input": "7.7", "output": "8" }, { "input": "7.8", "output": "8" }, { "input": "7.9", "output": "8" }, { "input": "8.0", "output": "8" }, { "input": "8.1", "output": "8" }, { "input": "8.2", "output": "8" }, { "input": "8.3", "output": "8" }, { "input": "8.4", "output": "8" }, { "input": "8.5", "output": "9" }, { "input": "8.6", "output": "9" }, { "input": "8.7", "output": "9" }, { "input": "8.8", "output": "9" }, { "input": "8.9", "output": "9" }, { "input": "9.0", "output": "GOTO Vasilisa." }, { "input": "9.1", "output": "GOTO Vasilisa." }, { "input": "9.2", "output": "GOTO Vasilisa." }, { "input": "9.3", "output": "GOTO Vasilisa." }, { "input": "9.4", "output": "GOTO Vasilisa." }, { "input": "9.5", "output": "GOTO Vasilisa." }, { "input": "9.6", "output": "GOTO Vasilisa." }, { "input": "9.7", "output": "GOTO Vasilisa." }, { "input": "9.8", "output": "GOTO Vasilisa." }, { "input": "9.9", "output": "GOTO Vasilisa." }, { "input": "609942239104813108618306232517836377583566292129955473517174437591594761209877970062547641606473593416245554763832875919009472288995880898848455284062760160557686724163817329189799336769669146848904803188614226720978399787805489531837751080926098.1664915772983166314490532653577560222779830866949001942720729759794777105570672781798092416748052690224813237139640723361527601154465287615917169132637313918577673651098507390501962", "output": "609942239104813108618306232517836377583566292129955473517174437591594761209877970062547641606473593416245554763832875919009472288995880898848455284062760160557686724163817329189799336769669146848904803188614226720978399787805489531837751080926098" }, { "input": "7002108534951820589946967018226114921984364117669853212254634761258884835434844673935047882480101006606512119541798298905598015607366335061012709906661245805358900665571472645463994925687210711492820804158354236327017974683658305043146543214454877759341394.20211856263503281388748282682120712214711232598021393495443628276945042110862480888110959179019986486690931930108026302665438087068150666835901617457150158918705186964935221768346957536540345814875615118637945520917367155931078965", "output": "7002108534951820589946967018226114921984364117669853212254634761258884835434844673935047882480101006606512119541798298905598015607366335061012709906661245805358900665571472645463994925687210711492820804158354236327017974683658305043146543214454877759341394" }, { "input": "1950583094879039694852660558765931995628486712128191844305265555887022812284005463780616067.5000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "1950583094879039694852660558765931995628486712128191844305265555887022812284005463780616068" }, { "input": "718130341896330596635811874410345440628950330.500000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "718130341896330596635811874410345440628950331" }, { "input": "927925904158088313481229162503626281882161630091489367140850985555900173018122871746924067186432044676083646964286435457446768031295712712803570690846298544912543439221596866052681116386179629036945370280722.500000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "927925904158088313481229162503626281882161630091489367140850985555900173018122871746924067186432044676083646964286435457446768031295712712803570690846298544912543439221596866052681116386179629036945370280723" }, { "input": "68289614863244584294178637364598054554769889.500000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "GOTO Vasilisa." }, { "input": "7536521504744364134984603189602839063535643888645969434165019366202558753840519.4999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999", "output": "GOTO Vasilisa." }, { "input": "646188694587964249318078225173.5000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "646188694587964249318078225174" }, { "input": "7017472758334494297677068672222822550374695787171163207025095950296957261530.50", "output": "7017472758334494297677068672222822550374695787171163207025095950296957261531" }, { "input": "259085737066615534998640212505663524594409165063310128108448186246980628179842202905722595400477937071746695941939306735605849342959111887834258250883469840846714848774368.50000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "259085737066615534998640212505663524594409165063310128108448186246980628179842202905722595400477937071746695941939306735605849342959111887834258250883469840846714848774369" }, { "input": "682500858233333594535201113441004740771119672961581796618069185960107115823662126812159957094407454522028503739299.5000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "GOTO Vasilisa." }, { "input": "41203422675619090661099806687619.49999999999999999999999999999999999999999999999999999999999999999999999999999999999999999", "output": "GOTO Vasilisa." } ]
1,620,581,693
2,147,483,647
PyPy 3
OK
TESTS
150
248
20,172,800
n = input().split(".") if n[0][-1] != '9' and int(n[1][0]) < 5: print(n[0]) elif n[0][-1] != '9' and int(n[1][0]) >= 5: print(int(n[0]) + 1) else : print("GOTO Vasilisa.")
Title: Help Far Away Kingdom Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: In a far away kingdom lived the King, the Prince, the Shoemaker, the Dressmaker and many other citizens. They lived happily until great trouble came into the Kingdom. The ACMers settled there. Most damage those strange creatures inflicted upon the kingdom was that they loved high precision numbers. As a result, the Kingdom healers had already had three appointments with the merchants who were asked to sell, say, exactly 0.273549107 beer barrels. To deal with the problem somehow, the King issued an order obliging rounding up all numbers to the closest integer to simplify calculations. Specifically, the order went like this: - If a number's integer part does not end with digit 9 and its fractional part is strictly less than 0.5, then the rounded up number coincides with the number’s integer part. - If a number's integer part does not end with digit 9 and its fractional part is not less than 0.5, the rounded up number is obtained if we add 1 to the last digit of the number’s integer part.- If the number’s integer part ends with digit 9, to round up the numbers one should go to Vasilisa the Wise. In the whole Kingdom she is the only one who can perform the tricky operation of carrying into the next position. Merchants found the algorithm very sophisticated and they asked you (the ACMers) to help them. Can you write a program that would perform the rounding according to the King’s order? Input Specification: The first line contains a single number to round up — the integer part (a non-empty set of decimal digits that do not start with 0 — with the exception of a case when the set consists of a single digit — in this case 0 can go first), then follows character «.» (a dot), and then follows the fractional part (any non-empty set of decimal digits). The number's length does not exceed 1000 characters, including the dot. There are no other characters in the input data. Output Specification: If the last number of the integer part is not equal to 9, print the rounded-up number without leading zeroes. Otherwise, print the message "GOTO Vasilisa." (without the quotes). Demo Input: ['0.0\n', '1.49\n', '1.50\n', '2.71828182845904523536\n', '3.14159265358979323846\n', '12345678901234567890.1\n', '123456789123456789.999\n'] Demo Output: ['0', '1', '2', '3', '3', '12345678901234567890', 'GOTO Vasilisa.'] Note: none
```python n = input().split(".") if n[0][-1] != '9' and int(n[1][0]) < 5: print(n[0]) elif n[0][-1] != '9' and int(n[1][0]) >= 5: print(int(n[0]) + 1) else : print("GOTO Vasilisa.") ```
3.900425