contestId
int64 0
1.01k
| index
stringclasses 40
values | name
stringlengths 2
54
| type
stringclasses 2
values | rating
int64 0
3.4k
| tags
listlengths 0
7
| title
stringclasses 393
values | time-limit
stringclasses 7
values | memory-limit
stringclasses 6
values | problem-description
stringlengths 0
2.97k
| input-specification
stringlengths 4
1.87k
| output-specification
stringlengths 4
1.12k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
3.5k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 1
value | testset
stringclasses 9
values | passedTestCount
int64 1
402
| timeConsumedMillis
int64 15
8.06k
| memoryConsumedBytes
int64 0
514M
| code
stringlengths 11
61.4k
| prompt
stringlengths 297
7.35k
| response
stringlengths 25
61.4k
| score
float64 2.82
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
254
|
A
|
Cards with Numbers
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms",
"sortings"
] | null | null |
Petya has got 2*n* cards, each card contains some integer. The numbers on the cards can be the same. Let's index all cards by consecutive integers from 1 to 2*n*. We'll denote the number that is written on a card with number *i*, as *a**i*. In order to play one entertaining game with his friends, Petya needs to split the cards into pairs so that each pair had equal numbers on the cards. Help Petya do that.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105). The second line contains the sequence of 2*n* positive integers *a*1,<=*a*2,<=...,<=*a*2*n* (1<=≤<=*a**i*<=≤<=5000) — the numbers that are written on the cards. The numbers on the line are separated by single spaces.
|
If it is impossible to divide the cards into pairs so that cards in each pair had the same numbers, print on a single line integer -1. But if the required partition exists, then print *n* pairs of integers, a pair per line — the indices of the cards that form the pairs.
Separate the numbers on the lines by spaces. You can print the pairs and the numbers in the pairs in any order. If there are multiple solutions, print any of them.
|
[
"3\n20 30 10 30 20 10\n",
"1\n1 2\n"
] |
[
"4 2\n1 5\n6 3\n",
"-1"
] |
none
| 500
|
[
{
"input": "3\n20 30 10 30 20 10",
"output": "4 2\n1 5\n6 3"
},
{
"input": "1\n1 2",
"output": "-1"
},
{
"input": "5\n2 2 2 2 2 1 2 2 1 2",
"output": "2 1\n3 4\n7 5\n6 9\n10 8"
},
{
"input": "5\n2 1 2 2 1 1 1 1 1 2",
"output": "3 1\n2 5\n7 6\n8 9\n10 4"
},
{
"input": "5\n1 2 2 2 1 2 2 1 2 1",
"output": "3 2\n1 5\n6 4\n7 9\n10 8"
},
{
"input": "5\n3 3 1 1 1 3 2 3 1 2",
"output": "2 1\n3 4\n8 6\n5 9\n10 7"
},
{
"input": "5\n1 1 3 1 3 3 3 1 1 1",
"output": "2 1\n3 5\n7 6\n4 8\n10 9"
},
{
"input": "5\n3 1 1 1 2 3 3 3 2 1",
"output": "3 2\n1 6\n8 7\n5 9\n10 4"
},
{
"input": "5\n3 3 2 2 3 3 1 3 1 3",
"output": "2 1\n3 4\n6 5\n7 9\n10 8"
},
{
"input": "5\n4 1 3 1 4 1 2 2 3 1",
"output": "4 2\n1 5\n8 7\n3 9\n10 6"
},
{
"input": "100\n8 6 7 8 7 9 1 7 3 3 5 8 7 8 5 4 8 4 8 1 2 8 3 7 8 7 6 5 7 9 6 10 7 6 7 8 6 8 9 5 1 5 6 1 4 8 4 8 7 2 6 2 6 6 2 8 2 8 7 1 5 4 4 6 4 9 7 5 1 8 1 3 9 2 3 2 4 7 6 10 5 3 4 10 8 9 6 7 2 7 10 1 8 10 4 1 1 1 2 7 5 4 9 10 6 8 3 1 10 9 9 6 1 5 8 6 6 3 3 4 10 10 8 9 7 10 9 3 7 6 3 2 10 8 5 8 5 5 5 10 8 5 7 6 10 7 7 9 10 10 9 9 3 6 5 6 8 1 9 8 2 4 8 8 6 8 10 2 3 5 2 6 8 4 8 6 4 5 10 8 1 10 5 2 5 6 8 2 6 8 1 3 4 5 7 5 6 9 2 8",
"output": "4 1\n3 5\n10 9\n8 13\n14 12\n11 15\n18 16\n17 19\n20 7\n22 25\n26 24\n2 27\n30 6\n29 33\n34 31\n36 38\n40 28\n37 43\n44 41\n45 47\n48 46\n35 49\n50 21\n51 53\n55 52\n56 58\n61 42\n62 63\n64 54\n39 66\n67 59\n60 69\n72 23\n57 74\n77 65\n32 80\n81 68\n75 82\n85 70\n73 86\n87 79\n78 88\n89 76\n84 91\n92 71\n83 95\n97 96\n90 100\n104 94\n93 106\n108 98\n103 110\n112 105\n101 114\n117 116\n107 118\n120 102\n109 121\n123 115\n111 124\n126 122\n119 128\n129 125\n99 132\n136 134\n135 137\n139 138\n133 140\n144 130..."
},
{
"input": "100\n7 3 8 8 1 9 6 6 3 3 8 2 7 9 9 10 2 10 4 4 9 3 6 5 2 6 3 6 3 5 2 3 8 2 5 10 3 9 7 2 1 6 7 4 8 3 9 10 9 4 3 3 7 1 4 2 2 5 6 6 1 7 9 1 8 1 2 2 5 9 7 7 6 4 6 10 1 1 8 1 5 6 4 9 5 4 4 10 6 4 5 1 9 1 7 8 6 10 3 2 4 7 10 4 8 10 6 7 8 4 1 3 8 3 2 1 9 4 2 4 3 1 6 8 6 2 2 5 6 8 6 10 1 6 4 2 7 3 6 10 6 5 6 6 3 9 4 6 4 1 5 4 4 2 8 4 10 3 7 6 6 10 2 5 5 6 1 6 1 9 9 1 10 5 10 1 1 5 7 5 2 1 4 2 3 3 3 5 1 8 10 3 3 5 9 6 3 6 8 1",
"output": "4 3\n7 8\n9 2\n1 13\n14 6\n12 17\n18 16\n19 20\n21 15\n10 22\n26 23\n27 29\n30 24\n25 31\n33 11\n32 37\n40 34\n5 41\n42 28\n39 43\n47 38\n36 48\n50 44\n46 51\n57 56\n35 58\n60 59\n54 61\n62 53\n49 63\n65 45\n64 66\n68 67\n71 72\n74 55\n73 75\n78 77\n69 81\n84 70\n83 86\n88 76\n82 89\n90 87\n85 91\n92 80\n79 96\n99 52\n95 102\n103 98\n101 104\n107 97\n105 109\n111 94\n112 114\n115 100\n93 117\n118 110\n116 122\n124 113\n123 125\n126 119\n129 131\n132 106\n120 135\n136 127\n108 137\n138 121\n134 139\n142 128..."
},
{
"input": "100\n6 3 6 8 8 4 3 7 10 3 1 3 9 5 10 10 6 7 6 6 2 3 8 8 7 6 4 9 6 7 4 4 10 4 7 3 2 7 10 8 6 7 9 1 3 5 3 7 9 1 1 7 1 1 7 7 8 3 2 7 4 8 7 8 10 3 1 7 2 7 9 8 8 8 5 2 8 1 2 7 8 7 8 8 5 10 10 4 9 10 8 7 8 8 7 7 3 6 4 3 4 8 10 8 6 3 7 1 8 6 3 3 7 10 3 9 3 5 10 9 9 2 8 7 2 3 2 1 10 9 6 2 8 7 2 2 5 3 10 6 7 2 1 1 5 10 7 5 4 9 7 7 8 1 1 3 3 7 10 5 9 8 6 8 2 2 1 7 8 9 6 2 2 6 2 9 10 2 10 9 6 3 3 10 6 5 3 6 6 3 6 10 8 7 4 8 6 3 4 7",
"output": "-1"
},
{
"input": "1\n2 2",
"output": "2 1"
},
{
"input": "2\n1 2 4 7",
"output": "-1"
}
] | 1,607,714,262
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 35
| 982
| 47,104,000
|
import sys
sys.stdin = open('input.txt','r')
sys.stdout = open('output.txt','w')
n = int(input())
a = list(map(int, input().split()))
chk = True
un = set(a)
elem = {}
for i in un:
elem[i] = []
out = []
for i in range(2*n):
elem[a[i]].append(i)
for i in elem:
if len(elem[i]) % 2:
chk = False
break
else:
j = 0
while(j < len(elem[i])):
out.append([elem[i][j], elem[i][j+1]])
j += 2
if chk:
for i in out:
print(i[0]+1, i[1]+1)
else:
print(-1)
|
Title: Cards with Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya has got 2*n* cards, each card contains some integer. The numbers on the cards can be the same. Let's index all cards by consecutive integers from 1 to 2*n*. We'll denote the number that is written on a card with number *i*, as *a**i*. In order to play one entertaining game with his friends, Petya needs to split the cards into pairs so that each pair had equal numbers on the cards. Help Petya do that.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105). The second line contains the sequence of 2*n* positive integers *a*1,<=*a*2,<=...,<=*a*2*n* (1<=≤<=*a**i*<=≤<=5000) — the numbers that are written on the cards. The numbers on the line are separated by single spaces.
Output Specification:
If it is impossible to divide the cards into pairs so that cards in each pair had the same numbers, print on a single line integer -1. But if the required partition exists, then print *n* pairs of integers, a pair per line — the indices of the cards that form the pairs.
Separate the numbers on the lines by spaces. You can print the pairs and the numbers in the pairs in any order. If there are multiple solutions, print any of them.
Demo Input:
['3\n20 30 10 30 20 10\n', '1\n1 2\n']
Demo Output:
['4 2\n1 5\n6 3\n', '-1']
Note:
none
|
```python
import sys
sys.stdin = open('input.txt','r')
sys.stdout = open('output.txt','w')
n = int(input())
a = list(map(int, input().split()))
chk = True
un = set(a)
elem = {}
for i in un:
elem[i] = []
out = []
for i in range(2*n):
elem[a[i]].append(i)
for i in elem:
if len(elem[i]) % 2:
chk = False
break
else:
j = 0
while(j < len(elem[i])):
out.append([elem[i][j], elem[i][j+1]])
j += 2
if chk:
for i in out:
print(i[0]+1, i[1]+1)
else:
print(-1)
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Today on a lecture about strings Gerald learned a new definition of string equivalency. Two strings *a* and *b* of equal length are called equivalent in one of the two cases:
1. They are equal. 1. If we split string *a* into two halves of the same size *a*1 and *a*2, and string *b* into two halves of the same size *b*1 and *b*2, then one of the following is correct: *a*1 is equivalent to *b*1, and *a*2 is equivalent to *b*2 1. *a*1 is equivalent to *b*2, and *a*2 is equivalent to *b*1
As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent.
Gerald has already completed this home task. Now it's your turn!
|
The first two lines of the input contain two strings given by the teacher. Each of them has the length from 1 to 200<=000 and consists of lowercase English letters. The strings have the same length.
|
Print "YES" (without the quotes), if these two strings are equivalent, and "NO" (without the quotes) otherwise.
|
[
"aaba\nabaa\n",
"aabb\nabab\n"
] |
[
"YES\n",
"NO\n"
] |
In the first sample you should split the first string into strings "aa" and "ba", the second one — into strings "ab" and "aa". "aa" is equivalent to "aa"; "ab" is equivalent to "ba" as "ab" = "a" + "b", "ba" = "b" + "a".
In the second sample the first string can be splitted into strings "aa" and "bb", that are equivalent only to themselves. That's why string "aabb" is equivalent only to itself and to string "bbaa".
| 0
|
[
{
"input": "aaba\nabaa",
"output": "YES"
},
{
"input": "aabb\nabab",
"output": "NO"
},
{
"input": "a\na",
"output": "YES"
},
{
"input": "a\nb",
"output": "NO"
},
{
"input": "ab\nab",
"output": "YES"
},
{
"input": "ab\nba",
"output": "YES"
},
{
"input": "ab\nbb",
"output": "NO"
},
{
"input": "zzaa\naazz",
"output": "YES"
},
{
"input": "azza\nzaaz",
"output": "YES"
},
{
"input": "abc\nabc",
"output": "YES"
},
{
"input": "abc\nacb",
"output": "NO"
},
{
"input": "azzz\nzzaz",
"output": "YES"
},
{
"input": "abcd\ndcab",
"output": "YES"
},
{
"input": "abcd\ncdab",
"output": "YES"
},
{
"input": "abcd\ndcba",
"output": "YES"
},
{
"input": "abcd\nacbd",
"output": "NO"
},
{
"input": "oloaxgddgujq\noloaxgujqddg",
"output": "YES"
},
{
"input": "uwzwdxfmosmqatyv\ndxfmzwwusomqvyta",
"output": "YES"
},
{
"input": "hagnzomowtledfdotnll\nledfdotnllomowthagnz",
"output": "YES"
},
{
"input": "snyaydaeobufdg\nsnyaydaeobufdg",
"output": "YES"
},
{
"input": "baaaaa\nabaaaa",
"output": "NO"
},
{
"input": "hhiisug\nmzdjwju",
"output": "NO"
},
{
"input": "bbbabbabaaab\naaaabbabbbbb",
"output": "NO"
},
{
"input": "bbaaab\naababb",
"output": "NO"
},
{
"input": "aabbaaaa\naaaaabab",
"output": "NO"
},
{
"input": "aab\naba",
"output": "NO"
},
{
"input": "abcddd\nbacddd",
"output": "NO"
},
{
"input": "qgiufelsfhanx\naaaaaaaaaaaaa",
"output": "NO"
},
{
"input": "aabaababaaba\naababaaababa",
"output": "NO"
},
{
"input": "nocdqzdriyyil\naaaaaaaaaaaaa",
"output": "NO"
},
{
"input": "zdmctxl\nkojqhgw",
"output": "NO"
},
{
"input": "yhwepqwyhwepqwyhwepqweahnqtueahnqtueahnqtuyhwepqwyhwepqwyhwepqwyhwepqweahnqtueahnqtuyhwepqweahnqtueahnqtueahnqtueahnqtueahnqtueahnqtu\neahnqtueahnqtueahnqtuyhwepqweahnqtuyhwepqwyhwepqweahnqtuyhwepqweahnqtuyhwepqweahnqtueahnqtuyhwepqweahnqtueahnqtuyhwepqwyhwepqwyhwepqw",
"output": "NO"
},
{
"input": "abc\nbac",
"output": "NO"
},
{
"input": "ottceez\npcstdvz",
"output": "NO"
}
] | 1,619,402,308
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 104
| 280
| 1,433,600
|
def check(s):
if len(s) % 2 == 1: return s
m = int(len(s)/2)
l = check(s[:m])
r = check(s[m:])
if (l < r):
return (l + r)
else:
return (r + l)
a = input()
b = input()
if (check(a) == check(b)):
print("YES")
else:
print("NO")
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today on a lecture about strings Gerald learned a new definition of string equivalency. Two strings *a* and *b* of equal length are called equivalent in one of the two cases:
1. They are equal. 1. If we split string *a* into two halves of the same size *a*1 and *a*2, and string *b* into two halves of the same size *b*1 and *b*2, then one of the following is correct: *a*1 is equivalent to *b*1, and *a*2 is equivalent to *b*2 1. *a*1 is equivalent to *b*2, and *a*2 is equivalent to *b*1
As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent.
Gerald has already completed this home task. Now it's your turn!
Input Specification:
The first two lines of the input contain two strings given by the teacher. Each of them has the length from 1 to 200<=000 and consists of lowercase English letters. The strings have the same length.
Output Specification:
Print "YES" (without the quotes), if these two strings are equivalent, and "NO" (without the quotes) otherwise.
Demo Input:
['aaba\nabaa\n', 'aabb\nabab\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample you should split the first string into strings "aa" and "ba", the second one — into strings "ab" and "aa". "aa" is equivalent to "aa"; "ab" is equivalent to "ba" as "ab" = "a" + "b", "ba" = "b" + "a".
In the second sample the first string can be splitted into strings "aa" and "bb", that are equivalent only to themselves. That's why string "aabb" is equivalent only to itself and to string "bbaa".
|
```python
def check(s):
if len(s) % 2 == 1: return s
m = int(len(s)/2)
l = check(s[:m])
r = check(s[m:])
if (l < r):
return (l + r)
else:
return (r + l)
a = input()
b = input()
if (check(a) == check(b)):
print("YES")
else:
print("NO")
```
| 3
|
|
990
|
B
|
Micro-World
|
PROGRAMMING
| 1,200
|
[
"greedy",
"sortings"
] | null | null |
You have a Petri dish with bacteria and you are preparing to dive into the harsh micro-world. But, unfortunately, you don't have any microscope nearby, so you can't watch them.
You know that you have $n$ bacteria in the Petri dish and size of the $i$-th bacteria is $a_i$. Also you know intergalactic positive integer constant $K$.
The $i$-th bacteria can swallow the $j$-th bacteria if and only if $a_i > a_j$ and $a_i \le a_j + K$. The $j$-th bacteria disappear, but the $i$-th bacteria doesn't change its size. The bacteria can perform multiple swallows. On each swallow operation any bacteria $i$ can swallow any bacteria $j$ if $a_i > a_j$ and $a_i \le a_j + K$. The swallow operations go one after another.
For example, the sequence of bacteria sizes $a=[101, 53, 42, 102, 101, 55, 54]$ and $K=1$. The one of possible sequences of swallows is: $[101, 53, 42, 102, \underline{101}, 55, 54]$ $\to$ $[101, \underline{53}, 42, 102, 55, 54]$ $\to$ $[\underline{101}, 42, 102, 55, 54]$ $\to$ $[42, 102, 55, \underline{54}]$ $\to$ $[42, 102, 55]$. In total there are $3$ bacteria remained in the Petri dish.
Since you don't have a microscope, you can only guess, what the minimal possible number of bacteria can remain in your Petri dish when you finally will find any microscope.
|
The first line contains two space separated positive integers $n$ and $K$ ($1 \le n \le 2 \cdot 10^5$, $1 \le K \le 10^6$) — number of bacteria and intergalactic constant $K$.
The second line contains $n$ space separated integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10^6$) — sizes of bacteria you have.
|
Print the only integer — minimal possible number of bacteria can remain.
|
[
"7 1\n101 53 42 102 101 55 54\n",
"6 5\n20 15 10 15 20 25\n",
"7 1000000\n1 1 1 1 1 1 1\n"
] |
[
"3\n",
"1\n",
"7\n"
] |
The first example is clarified in the problem statement.
In the second example an optimal possible sequence of swallows is: $[20, 15, 10, 15, \underline{20}, 25]$ $\to$ $[20, 15, 10, \underline{15}, 25]$ $\to$ $[20, 15, \underline{10}, 25]$ $\to$ $[20, \underline{15}, 25]$ $\to$ $[\underline{20}, 25]$ $\to$ $[25]$.
In the third example no bacteria can swallow any other bacteria.
| 0
|
[
{
"input": "7 1\n101 53 42 102 101 55 54",
"output": "3"
},
{
"input": "6 5\n20 15 10 15 20 25",
"output": "1"
},
{
"input": "7 1000000\n1 1 1 1 1 1 1",
"output": "7"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 4\n8",
"output": "1"
},
{
"input": "10 1\n1 2 3 5 6 8 10 11 9 4",
"output": "2"
},
{
"input": "9 2\n1 6 1 5 5 8 6 8 7",
"output": "4"
},
{
"input": "15 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "15"
},
{
"input": "2 1000000\n1 1000000",
"output": "1"
},
{
"input": "7 2\n1 5 5 8 9 8 8",
"output": "4"
},
{
"input": "10 1\n2 6 3 4 2 4 4 3 2 1",
"output": "4"
},
{
"input": "4 1\n2 2 1 1",
"output": "2"
},
{
"input": "10 1\n6 3 1 3 6 4 1 3 6 4",
"output": "7"
},
{
"input": "2 1\n1 1",
"output": "2"
},
{
"input": "2 1\n1 2",
"output": "1"
},
{
"input": "8 2\n3 13 9 8 3 13 9 14",
"output": "5"
},
{
"input": "8 1000000\n1 1 5 1000000 1000000 2 2 2",
"output": "2"
},
{
"input": "2 1\n999152 999153",
"output": "1"
}
] | 1,530,608,927
| 826
|
Python 3
|
OK
|
TESTS
| 36
| 467
| 14,336,000
|
n, K = map(int, input().split())
A = sorted(map(int, input().split()))
ans = []
for a in A:
while len(ans) and ans[-1] < a <= ans[-1] + K:
ans.pop()
ans += [a]
print(len(ans))
|
Title: Micro-World
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have a Petri dish with bacteria and you are preparing to dive into the harsh micro-world. But, unfortunately, you don't have any microscope nearby, so you can't watch them.
You know that you have $n$ bacteria in the Petri dish and size of the $i$-th bacteria is $a_i$. Also you know intergalactic positive integer constant $K$.
The $i$-th bacteria can swallow the $j$-th bacteria if and only if $a_i > a_j$ and $a_i \le a_j + K$. The $j$-th bacteria disappear, but the $i$-th bacteria doesn't change its size. The bacteria can perform multiple swallows. On each swallow operation any bacteria $i$ can swallow any bacteria $j$ if $a_i > a_j$ and $a_i \le a_j + K$. The swallow operations go one after another.
For example, the sequence of bacteria sizes $a=[101, 53, 42, 102, 101, 55, 54]$ and $K=1$. The one of possible sequences of swallows is: $[101, 53, 42, 102, \underline{101}, 55, 54]$ $\to$ $[101, \underline{53}, 42, 102, 55, 54]$ $\to$ $[\underline{101}, 42, 102, 55, 54]$ $\to$ $[42, 102, 55, \underline{54}]$ $\to$ $[42, 102, 55]$. In total there are $3$ bacteria remained in the Petri dish.
Since you don't have a microscope, you can only guess, what the minimal possible number of bacteria can remain in your Petri dish when you finally will find any microscope.
Input Specification:
The first line contains two space separated positive integers $n$ and $K$ ($1 \le n \le 2 \cdot 10^5$, $1 \le K \le 10^6$) — number of bacteria and intergalactic constant $K$.
The second line contains $n$ space separated integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10^6$) — sizes of bacteria you have.
Output Specification:
Print the only integer — minimal possible number of bacteria can remain.
Demo Input:
['7 1\n101 53 42 102 101 55 54\n', '6 5\n20 15 10 15 20 25\n', '7 1000000\n1 1 1 1 1 1 1\n']
Demo Output:
['3\n', '1\n', '7\n']
Note:
The first example is clarified in the problem statement.
In the second example an optimal possible sequence of swallows is: $[20, 15, 10, 15, \underline{20}, 25]$ $\to$ $[20, 15, 10, \underline{15}, 25]$ $\to$ $[20, 15, \underline{10}, 25]$ $\to$ $[20, \underline{15}, 25]$ $\to$ $[\underline{20}, 25]$ $\to$ $[25]$.
In the third example no bacteria can swallow any other bacteria.
|
```python
n, K = map(int, input().split())
A = sorted(map(int, input().split()))
ans = []
for a in A:
while len(ans) and ans[-1] < a <= ans[-1] + K:
ans.pop()
ans += [a]
print(len(ans))
```
| 3
|
|
817
|
A
|
Treasure Hunt
|
PROGRAMMING
| 1,200
|
[
"implementation",
"math",
"number theory"
] | null | null |
Captain Bill the Hummingbird and his crew recieved an interesting challenge offer. Some stranger gave them a map, potion of teleportation and said that only this potion might help them to reach the treasure.
Bottle with potion has two values *x* and *y* written on it. These values define four moves which can be performed using the potion:
- - - -
Map shows that the position of Captain Bill the Hummingbird is (*x*1,<=*y*1) and the position of the treasure is (*x*2,<=*y*2).
You task is to tell Captain Bill the Hummingbird whether he should accept this challenge or decline. If it is possible for Captain to reach the treasure using the potion then output "YES", otherwise "NO" (without quotes).
The potion can be used infinite amount of times.
|
The first line contains four integer numbers *x*1,<=*y*1,<=*x*2,<=*y*2 (<=-<=105<=≤<=*x*1,<=*y*1,<=*x*2,<=*y*2<=≤<=105) — positions of Captain Bill the Hummingbird and treasure respectively.
The second line contains two integer numbers *x*,<=*y* (1<=≤<=*x*,<=*y*<=≤<=105) — values on the potion bottle.
|
Print "YES" if it is possible for Captain to reach the treasure using the potion, otherwise print "NO" (without quotes).
|
[
"0 0 0 6\n2 3\n",
"1 1 3 6\n1 5\n"
] |
[
"YES\n",
"NO\n"
] |
In the first example there exists such sequence of moves:
1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7c939890fb4ed35688177327dac981bfa9216c00.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the first type of move 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/afbfa42fbac4e0641e7466e3aac74cbbb08ed597.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the third type of move
| 0
|
[
{
"input": "0 0 0 6\n2 3",
"output": "YES"
},
{
"input": "1 1 3 6\n1 5",
"output": "NO"
},
{
"input": "5 4 6 -10\n1 1",
"output": "NO"
},
{
"input": "6 -3 -7 -7\n1 2",
"output": "NO"
},
{
"input": "2 -5 -8 8\n2 1",
"output": "YES"
},
{
"input": "70 -81 -17 80\n87 23",
"output": "YES"
},
{
"input": "41 366 218 -240\n3456 1234",
"output": "NO"
},
{
"input": "-61972 -39646 -42371 -24854\n573 238",
"output": "NO"
},
{
"input": "-84870 -42042 94570 98028\n8972 23345",
"output": "YES"
},
{
"input": "-58533 -50999 -1007 -59169\n8972 23345",
"output": "NO"
},
{
"input": "-100000 -100000 100000 100000\n100000 100000",
"output": "YES"
},
{
"input": "-100000 -100000 100000 100000\n1 1",
"output": "YES"
},
{
"input": "5 2 5 3\n1 1",
"output": "NO"
},
{
"input": "5 5 5 5\n5 5",
"output": "YES"
},
{
"input": "0 0 1000 1000\n1 1",
"output": "YES"
},
{
"input": "0 0 0 1\n1 1",
"output": "NO"
},
{
"input": "1 1 4 4\n2 2",
"output": "NO"
},
{
"input": "100000 100000 99999 99999\n100000 100000",
"output": "NO"
},
{
"input": "1 1 1 6\n1 5",
"output": "NO"
},
{
"input": "2 9 4 0\n2 3",
"output": "YES"
},
{
"input": "0 0 0 9\n2 3",
"output": "NO"
},
{
"input": "14 88 14 88\n100 500",
"output": "YES"
},
{
"input": "-1 0 3 0\n4 4",
"output": "NO"
},
{
"input": "0 0 8 9\n2 3",
"output": "NO"
},
{
"input": "-2 5 7 -6\n1 1",
"output": "YES"
},
{
"input": "3 7 -8 8\n2 2",
"output": "NO"
},
{
"input": "-4 -8 -6 -1\n1 3",
"output": "NO"
},
{
"input": "0 8 6 2\n1 1",
"output": "YES"
},
{
"input": "-5 -2 -8 -2\n1 1",
"output": "NO"
},
{
"input": "1 4 -5 0\n1 1",
"output": "YES"
},
{
"input": "8 -4 4 -7\n1 2",
"output": "NO"
},
{
"input": "5 2 2 4\n2 2",
"output": "NO"
},
{
"input": "2 0 -4 6\n1 2",
"output": "NO"
},
{
"input": "-2 6 -5 -4\n1 2",
"output": "YES"
},
{
"input": "-6 5 10 6\n2 4",
"output": "NO"
},
{
"input": "3 -7 1 -8\n1 2",
"output": "NO"
},
{
"input": "4 1 4 -4\n9 4",
"output": "NO"
},
{
"input": "9 -3 -9 -3\n2 2",
"output": "NO"
},
{
"input": "-6 -6 -10 -5\n6 7",
"output": "NO"
},
{
"input": "-5 -2 2 2\n1 7",
"output": "NO"
},
{
"input": "9 0 8 1\n7 10",
"output": "NO"
},
{
"input": "-1 6 -7 -6\n6 4",
"output": "YES"
},
{
"input": "2 2 -3 -3\n3 1",
"output": "NO"
},
{
"input": "2 -6 7 2\n2 1",
"output": "NO"
},
{
"input": "-6 2 -7 -7\n1 2",
"output": "NO"
},
{
"input": "-5 -5 -1 -5\n2 2",
"output": "YES"
},
{
"input": "0 5 3 -6\n2 2",
"output": "NO"
},
{
"input": "0 -6 2 -1\n1 1",
"output": "NO"
},
{
"input": "-6 6 -5 -4\n1 2",
"output": "YES"
},
{
"input": "7 -7 1 -7\n2 2",
"output": "NO"
},
{
"input": "99966 -99952 -99966 99923\n1 1",
"output": "NO"
},
{
"input": "99921 99980 -99956 -99907\n3 4",
"output": "NO"
},
{
"input": "100000 100000 -100000 -100000\n1 1",
"output": "YES"
},
{
"input": "1 0 2 0\n5 1",
"output": "NO"
},
{
"input": "-3 0 -8 0\n7 2",
"output": "NO"
},
{
"input": "-9 4 -5 -1\n8 2",
"output": "NO"
},
{
"input": "-99999 -100000 100000 100000\n1 1",
"output": "NO"
},
{
"input": "0 0 -100 -100\n2 2",
"output": "YES"
},
{
"input": "9 -5 -3 -2\n1 4",
"output": "NO"
},
{
"input": "1 -10 -10 5\n7 5",
"output": "NO"
},
{
"input": "6 -9 -1 -9\n1 9",
"output": "NO"
}
] | 1,689,838,097
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 61
| 78
| 0
|
x1,y1,x2,y2=map(int,input().split())
x,y=map(int,input().split())
if (abs(x1-x2)%x==0 and abs(y1-y2)%y==0) and (abs(x1-x2)/x%2 == abs(y1-y2)/y%2):
print("YES")
else:
print("NO")
|
Title: Treasure Hunt
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Captain Bill the Hummingbird and his crew recieved an interesting challenge offer. Some stranger gave them a map, potion of teleportation and said that only this potion might help them to reach the treasure.
Bottle with potion has two values *x* and *y* written on it. These values define four moves which can be performed using the potion:
- - - -
Map shows that the position of Captain Bill the Hummingbird is (*x*1,<=*y*1) and the position of the treasure is (*x*2,<=*y*2).
You task is to tell Captain Bill the Hummingbird whether he should accept this challenge or decline. If it is possible for Captain to reach the treasure using the potion then output "YES", otherwise "NO" (without quotes).
The potion can be used infinite amount of times.
Input Specification:
The first line contains four integer numbers *x*1,<=*y*1,<=*x*2,<=*y*2 (<=-<=105<=≤<=*x*1,<=*y*1,<=*x*2,<=*y*2<=≤<=105) — positions of Captain Bill the Hummingbird and treasure respectively.
The second line contains two integer numbers *x*,<=*y* (1<=≤<=*x*,<=*y*<=≤<=105) — values on the potion bottle.
Output Specification:
Print "YES" if it is possible for Captain to reach the treasure using the potion, otherwise print "NO" (without quotes).
Demo Input:
['0 0 0 6\n2 3\n', '1 1 3 6\n1 5\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first example there exists such sequence of moves:
1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7c939890fb4ed35688177327dac981bfa9216c00.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the first type of move 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/afbfa42fbac4e0641e7466e3aac74cbbb08ed597.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the third type of move
|
```python
x1,y1,x2,y2=map(int,input().split())
x,y=map(int,input().split())
if (abs(x1-x2)%x==0 and abs(y1-y2)%y==0) and (abs(x1-x2)/x%2 == abs(y1-y2)/y%2):
print("YES")
else:
print("NO")
```
| 3
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,566,069,849
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 109
| 0
|
str = input()
b = 'hello'
i = int(0)
for x in str:
if x == b[i]:
i+=1;
if i ==5:
break
if i == 5:
print("YES")
else:
print("NO")
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
str = input()
b = 'hello'
i = int(0)
for x in str:
if x == b[i]:
i+=1;
if i ==5:
break
if i == 5:
print("YES")
else:
print("NO")
```
| 3.9455
|
651
|
A
|
Joysticks
|
PROGRAMMING
| 1,100
|
[
"dp",
"greedy",
"implementation",
"math"
] | null | null |
Friends are going to play console. They have two joysticks and only one charger for them. Initially first joystick is charged at *a*1 percent and second one is charged at *a*2 percent. You can connect charger to a joystick only at the beginning of each minute. In one minute joystick either discharges by 2 percent (if not connected to a charger) or charges by 1 percent (if connected to a charger).
Game continues while both joysticks have a positive charge. Hence, if at the beginning of minute some joystick is charged by 1 percent, it has to be connected to a charger, otherwise the game stops. If some joystick completely discharges (its charge turns to 0), the game also stops.
Determine the maximum number of minutes that game can last. It is prohibited to pause the game, i. e. at each moment both joysticks should be enabled. It is allowed for joystick to be charged by more than 100 percent.
|
The first line of the input contains two positive integers *a*1 and *a*2 (1<=≤<=*a*1,<=*a*2<=≤<=100), the initial charge level of first and second joystick respectively.
|
Output the only integer, the maximum number of minutes that the game can last. Game continues until some joystick is discharged.
|
[
"3 5\n",
"4 4\n"
] |
[
"6\n",
"5\n"
] |
In the first sample game lasts for 6 minute by using the following algorithm:
- at the beginning of the first minute connect first joystick to the charger, by the end of this minute first joystick is at 4%, second is at 3%; - continue the game without changing charger, by the end of the second minute the first joystick is at 5%, second is at 1%; - at the beginning of the third minute connect second joystick to the charger, after this minute the first joystick is at 3%, the second one is at 2%; - continue the game without changing charger, by the end of the fourth minute first joystick is at 1%, second one is at 3%; - at the beginning of the fifth minute connect first joystick to the charger, after this minute the first joystick is at 2%, the second one is at 1%; - at the beginning of the sixth minute connect second joystick to the charger, after this minute the first joystick is at 0%, the second one is at 2%.
After that the first joystick is completely discharged and the game is stopped.
| 500
|
[
{
"input": "3 5",
"output": "6"
},
{
"input": "4 4",
"output": "5"
},
{
"input": "100 100",
"output": "197"
},
{
"input": "1 100",
"output": "98"
},
{
"input": "100 1",
"output": "98"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "8 8",
"output": "13"
},
{
"input": "7 2",
"output": "7"
},
{
"input": "24 15",
"output": "36"
},
{
"input": "19 30",
"output": "47"
},
{
"input": "15 31",
"output": "44"
},
{
"input": "14 15",
"output": "27"
},
{
"input": "58 33",
"output": "89"
},
{
"input": "15 25",
"output": "38"
},
{
"input": "59 45",
"output": "102"
},
{
"input": "3 73",
"output": "74"
},
{
"input": "48 1",
"output": "47"
},
{
"input": "100 25",
"output": "122"
},
{
"input": "40 49",
"output": "86"
},
{
"input": "85 73",
"output": "155"
},
{
"input": "29 1",
"output": "28"
},
{
"input": "74 25",
"output": "97"
},
{
"input": "24 57",
"output": "78"
},
{
"input": "23 12",
"output": "33"
},
{
"input": "2 99",
"output": "99"
},
{
"input": "98 2",
"output": "97"
},
{
"input": "2 97",
"output": "97"
},
{
"input": "30 54",
"output": "81"
},
{
"input": "32 53",
"output": "82"
},
{
"input": "32 54",
"output": "84"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "2 1",
"output": "1"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "1 3",
"output": "2"
},
{
"input": "3 1",
"output": "2"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "3 2",
"output": "3"
}
] | 1,607,430,528
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 39
| 155
| 0
|
def solve(a1, a2):
if a1 == 1 and a2 == 1:
return 0
ans = 0
while a1 > 0 and a2 > 0:
ans += 1
if a1 <= a2:
a1 += 1
a2 -= 2
else:
a1 -= 2
a2 += 1
return ans
a1, a2 = [int(s) for s in input().split()]
print(solve(a1, a2))
|
Title: Joysticks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Friends are going to play console. They have two joysticks and only one charger for them. Initially first joystick is charged at *a*1 percent and second one is charged at *a*2 percent. You can connect charger to a joystick only at the beginning of each minute. In one minute joystick either discharges by 2 percent (if not connected to a charger) or charges by 1 percent (if connected to a charger).
Game continues while both joysticks have a positive charge. Hence, if at the beginning of minute some joystick is charged by 1 percent, it has to be connected to a charger, otherwise the game stops. If some joystick completely discharges (its charge turns to 0), the game also stops.
Determine the maximum number of minutes that game can last. It is prohibited to pause the game, i. e. at each moment both joysticks should be enabled. It is allowed for joystick to be charged by more than 100 percent.
Input Specification:
The first line of the input contains two positive integers *a*1 and *a*2 (1<=≤<=*a*1,<=*a*2<=≤<=100), the initial charge level of first and second joystick respectively.
Output Specification:
Output the only integer, the maximum number of minutes that the game can last. Game continues until some joystick is discharged.
Demo Input:
['3 5\n', '4 4\n']
Demo Output:
['6\n', '5\n']
Note:
In the first sample game lasts for 6 minute by using the following algorithm:
- at the beginning of the first minute connect first joystick to the charger, by the end of this minute first joystick is at 4%, second is at 3%; - continue the game without changing charger, by the end of the second minute the first joystick is at 5%, second is at 1%; - at the beginning of the third minute connect second joystick to the charger, after this minute the first joystick is at 3%, the second one is at 2%; - continue the game without changing charger, by the end of the fourth minute first joystick is at 1%, second one is at 3%; - at the beginning of the fifth minute connect first joystick to the charger, after this minute the first joystick is at 2%, the second one is at 1%; - at the beginning of the sixth minute connect second joystick to the charger, after this minute the first joystick is at 0%, the second one is at 2%.
After that the first joystick is completely discharged and the game is stopped.
|
```python
def solve(a1, a2):
if a1 == 1 and a2 == 1:
return 0
ans = 0
while a1 > 0 and a2 > 0:
ans += 1
if a1 <= a2:
a1 += 1
a2 -= 2
else:
a1 -= 2
a2 += 1
return ans
a1, a2 = [int(s) for s in input().split()]
print(solve(a1, a2))
```
| 3
|
|
245
|
B
|
Internet Address
|
PROGRAMMING
| 1,100
|
[
"implementation",
"strings"
] | null | null |
Vasya is an active Internet user. One day he came across an Internet resource he liked, so he wrote its address in the notebook. We know that the address of the written resource has format:
where:
- <protocol> can equal either "http" (without the quotes) or "ftp" (without the quotes), - <domain> is a non-empty string, consisting of lowercase English letters, - the /<context> part may not be present. If it is present, then <context> is a non-empty string, consisting of lowercase English letters.
If string <context> isn't present in the address, then the additional character "/" isn't written. Thus, the address has either two characters "/" (the ones that go before the domain), or three (an extra one in front of the context).
When the boy came home, he found out that the address he wrote in his notebook had no punctuation marks. Vasya must have been in a lot of hurry and didn't write characters ":", "/", ".".
Help Vasya to restore the possible address of the recorded Internet resource.
|
The first line contains a non-empty string that Vasya wrote out in his notebook. This line consists of lowercase English letters only.
It is guaranteed that the given string contains at most 50 letters. It is guaranteed that the given string can be obtained from some correct Internet resource address, described above.
|
Print a single line — the address of the Internet resource that Vasya liked. If there are several addresses that meet the problem limitations, you are allowed to print any of them.
|
[
"httpsunrux\n",
"ftphttprururu\n"
] |
[
"http://sun.ru/x\n",
"ftp://http.ru/ruru\n"
] |
In the second sample there are two more possible answers: "ftp://httpruru.ru" and "ftp://httpru.ru/ru".
| 0
|
[
{
"input": "httpsunrux",
"output": "http://sun.ru/x"
},
{
"input": "ftphttprururu",
"output": "ftp://http.ru/ruru"
},
{
"input": "httpuururrururruruurururrrrrurrurrurruruuruuu",
"output": "http://uu.ru/rrururruruurururrrrrurrurrurruruuruuu"
},
{
"input": "httpabuaruauabbaruru",
"output": "http://abua.ru/auabbaruru"
},
{
"input": "httpuurrruurruuruuruuurrrurururuurruuuuuuruurr",
"output": "http://uurr.ru/urruuruuruuurrrurururuurruuuuuuruurr"
},
{
"input": "httpruhhphhhpuhruruhhpruhhphruhhru",
"output": "http://ruhhphhhpuh.ru/ruhhpruhhphruhhru"
},
{
"input": "httpftprftprutprururftruruftptp",
"output": "http://ftprftp.ru/tprururftruruftptp"
},
{
"input": "httpfttpftpfttftpftpftppfrurururu",
"output": "http://fttpftpfttftpftpftppf.ru/rururu"
},
{
"input": "httpruhttttpruhttprupruhttpruhtturuhttphtruuru",
"output": "http://ruhttttp.ru/httprupruhttpruhtturuhttphtruuru"
},
{
"input": "httpsjkazaaghasjkasjkabruru",
"output": "http://sjkazaaghasjkasjkab.ru/ru"
},
{
"input": "httpftphttptphttphrururuhpftphtpftphtpftphtptpft",
"output": "http://ftphttptphttph.ru/ruruhpftphtpftphtpftphtptpft"
},
{
"input": "httpppppru",
"output": "http://pppp.ru"
},
{
"input": "ftprrurururrurururuurrururruuru",
"output": "ftp://r.ru/rururrurururuurrururruuru"
},
{
"input": "ftpabaruru",
"output": "ftp://aba.ru/ru"
},
{
"input": "ftpruurruurururururuuruuur",
"output": "ftp://ruur.ru/urururururuuruuur"
},
{
"input": "ftphhphruhhpruhhpuhhpuruhhphruhhruhhpuhhru",
"output": "ftp://hhph.ru/hhpruhhpuhhpuruhhphruhhruhhpuhhru"
},
{
"input": "ftparua",
"output": "ftp://a.ru/a"
},
{
"input": "httpzru",
"output": "http://z.ru"
},
{
"input": "httprrur",
"output": "http://r.ru/r"
},
{
"input": "ftprru",
"output": "ftp://r.ru"
}
] | 1,631,218,334
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 20
| 186
| 20,172,800
|
import math
def main_function():
s = list(input())
first_separator = "://"
second = "."
last = "/"
is_f_found = False
if s[0] == "f":
is_f_found = True
if is_f_found:
s.insert(3, first_separator)
else:
s.insert(4, first_separator)
for i in range(len(s) - 1):
j = len(s) - 1 - i
if s[j] == "u" and s[j - 1] == "r":
if j != len(s) - 1:
s.insert(j + 1, last)
s.insert(j - 1, second)
break
for i in s:
print(i, end="")
main_function()
|
Title: Internet Address
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya is an active Internet user. One day he came across an Internet resource he liked, so he wrote its address in the notebook. We know that the address of the written resource has format:
where:
- <protocol> can equal either "http" (without the quotes) or "ftp" (without the quotes), - <domain> is a non-empty string, consisting of lowercase English letters, - the /<context> part may not be present. If it is present, then <context> is a non-empty string, consisting of lowercase English letters.
If string <context> isn't present in the address, then the additional character "/" isn't written. Thus, the address has either two characters "/" (the ones that go before the domain), or three (an extra one in front of the context).
When the boy came home, he found out that the address he wrote in his notebook had no punctuation marks. Vasya must have been in a lot of hurry and didn't write characters ":", "/", ".".
Help Vasya to restore the possible address of the recorded Internet resource.
Input Specification:
The first line contains a non-empty string that Vasya wrote out in his notebook. This line consists of lowercase English letters only.
It is guaranteed that the given string contains at most 50 letters. It is guaranteed that the given string can be obtained from some correct Internet resource address, described above.
Output Specification:
Print a single line — the address of the Internet resource that Vasya liked. If there are several addresses that meet the problem limitations, you are allowed to print any of them.
Demo Input:
['httpsunrux\n', 'ftphttprururu\n']
Demo Output:
['http://sun.ru/x\n', 'ftp://http.ru/ruru\n']
Note:
In the second sample there are two more possible answers: "ftp://httpruru.ru" and "ftp://httpru.ru/ru".
|
```python
import math
def main_function():
s = list(input())
first_separator = "://"
second = "."
last = "/"
is_f_found = False
if s[0] == "f":
is_f_found = True
if is_f_found:
s.insert(3, first_separator)
else:
s.insert(4, first_separator)
for i in range(len(s) - 1):
j = len(s) - 1 - i
if s[j] == "u" and s[j - 1] == "r":
if j != len(s) - 1:
s.insert(j + 1, last)
s.insert(j - 1, second)
break
for i in s:
print(i, end="")
main_function()
```
| 3
|
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,582,734,097
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 81
| 248
| 307,200
|
n = int(input())
x, y, z = 0, 0, 0
for i in range(n):
c = list(map(int, input().split()))
x += c[0]
y += c[1]
z += c[2]
print("YES" if abs(x) + abs(y) + abs(z) == 0 else "NO")
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
n = int(input())
x, y, z = 0, 0, 0
for i in range(n):
c = list(map(int, input().split()))
x += c[0]
y += c[1]
z += c[2]
print("YES" if abs(x) + abs(y) + abs(z) == 0 else "NO")
```
| 3.937428
|
490
|
A
|
Team Olympiad
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
The School №0 of the capital of Berland has *n* children studying in it. All the children in this school are gifted: some of them are good at programming, some are good at maths, others are good at PE (Physical Education). Hence, for each child we know value *t**i*:
- *t**i*<==<=1, if the *i*-th child is good at programming, - *t**i*<==<=2, if the *i*-th child is good at maths, - *t**i*<==<=3, if the *i*-th child is good at PE
Each child happens to be good at exactly one of these three subjects.
The Team Scientific Decathlon Olympias requires teams of three students. The school teachers decided that the teams will be composed of three children that are good at different subjects. That is, each team must have one mathematician, one programmer and one sportsman. Of course, each child can be a member of no more than one team.
What is the maximum number of teams that the school will be able to present at the Olympiad? How should the teams be formed for that?
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=5000) — the number of children in the school. The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=3), where *t**i* describes the skill of the *i*-th child.
|
In the first line output integer *w* — the largest possible number of teams.
Then print *w* lines, containing three numbers in each line. Each triple represents the indexes of the children forming the team. You can print both the teams, and the numbers in the triplets in any order. The children are numbered from 1 to *n* in the order of their appearance in the input. Each child must participate in no more than one team. If there are several solutions, print any of them.
If no teams can be compiled, print the only line with value *w* equal to 0.
|
[
"7\n1 3 1 3 2 1 2\n",
"4\n2 1 1 2\n"
] |
[
"2\n3 5 2\n6 7 4\n",
"0\n"
] |
none
| 500
|
[
{
"input": "7\n1 3 1 3 2 1 2",
"output": "2\n3 5 2\n6 7 4"
},
{
"input": "4\n2 1 1 2",
"output": "0"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "2\n3 1",
"output": "0"
},
{
"input": "3\n2 1 2",
"output": "0"
},
{
"input": "3\n1 2 3",
"output": "1\n1 2 3"
},
{
"input": "12\n3 3 3 3 3 3 3 3 1 3 3 2",
"output": "1\n9 12 2"
},
{
"input": "60\n3 3 1 2 2 1 3 1 1 1 3 2 2 2 3 3 1 3 2 3 2 2 1 3 3 2 3 1 2 2 2 1 3 2 1 1 3 3 1 1 1 3 1 2 1 1 3 3 3 2 3 2 3 2 2 2 1 1 1 2",
"output": "20\n6 60 1\n17 44 20\n3 5 33\n36 21 42\n59 14 2\n58 26 49\n9 29 48\n23 19 24\n10 30 37\n41 54 15\n45 31 27\n57 55 38\n39 12 25\n35 34 11\n32 52 7\n8 50 18\n43 4 53\n46 56 51\n40 22 16\n28 13 47"
},
{
"input": "12\n3 1 1 1 1 1 1 2 1 1 1 1",
"output": "1\n3 8 1"
},
{
"input": "22\n2 2 2 2 2 2 2 2 2 2 3 2 2 2 2 2 2 1 2 2 2 2",
"output": "1\n18 2 11"
},
{
"input": "138\n2 3 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 3 2 2 2 1 2 3 2 2 2 3 1 3 2 3 2 3 2 2 2 2 3 2 2 2 2 2 1 2 2 3 2 2 3 2 1 2 2 2 2 2 3 1 2 2 2 2 2 3 2 2 3 2 2 2 2 2 1 1 2 3 2 2 2 2 3 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 3 2 3 2 2 2 1 2 2 2 1 2 2 2 2 1 2 2 2 2 1 3",
"output": "18\n13 91 84\n34 90 48\n11 39 77\n78 129 50\n137 68 119\n132 122 138\n19 12 96\n40 7 2\n22 88 69\n107 73 46\n115 15 52\n127 106 87\n93 92 66\n71 112 117\n63 124 42\n17 70 101\n109 121 57\n123 25 36"
},
{
"input": "203\n2 2 1 2 1 2 2 2 1 2 2 1 1 3 1 2 1 2 1 1 2 3 1 1 2 3 3 2 2 2 1 2 1 1 1 1 1 3 1 1 2 1 1 2 2 2 1 2 2 2 1 2 3 2 1 1 2 2 1 2 1 2 2 1 1 2 2 2 1 1 2 2 1 2 1 2 2 3 2 1 2 1 1 1 1 1 1 1 1 1 1 2 2 1 1 2 2 2 2 1 1 1 1 1 1 1 2 2 2 2 2 1 1 1 2 2 2 1 2 2 1 3 2 1 1 1 2 1 1 2 1 1 2 2 2 1 1 2 2 2 1 2 1 3 2 1 2 2 2 1 1 1 2 2 2 1 2 1 1 2 2 2 2 2 1 1 2 1 2 2 1 1 1 1 1 1 2 2 3 1 1 2 3 1 1 1 1 1 1 2 2 1 1 1 2 2 3 2 1 3 1 1 1",
"output": "13\n188 72 14\n137 4 197\n158 76 122\n152 142 26\n104 119 179\n40 63 38\n12 1 78\n17 30 27\n189 60 53\n166 190 144\n129 7 183\n83 41 22\n121 81 200"
},
{
"input": "220\n1 1 3 1 3 1 1 3 1 3 3 3 3 1 3 3 1 3 3 3 3 3 1 1 1 3 1 1 1 3 2 3 3 3 1 1 3 3 1 1 3 3 3 3 1 3 3 1 1 1 2 3 1 1 1 2 3 3 3 2 3 1 1 3 1 1 1 3 2 1 3 2 3 1 1 3 3 3 1 3 1 1 1 3 3 2 1 3 2 1 1 3 3 1 1 1 2 1 1 3 2 1 2 1 1 1 3 1 3 3 1 2 3 3 3 3 1 3 1 1 1 1 2 3 1 1 1 1 1 1 3 2 3 1 3 1 3 1 1 3 1 3 1 3 1 3 1 3 3 2 3 1 3 3 1 3 3 3 3 1 1 3 3 3 3 1 1 3 3 3 2 1 1 1 3 3 1 3 3 3 1 1 1 3 1 3 3 1 1 1 2 3 1 1 3 1 1 1 1 2 3 1 1 2 3 3 1 3 1 3 3 3 3 1 3 2 3 1 1 3",
"output": "20\n198 89 20\n141 56 131\n166 204 19\n160 132 142\n111 112 195\n45 216 92\n6 31 109\n14 150 170\n199 60 18\n173 123 140\n134 69 156\n82 191 85\n126 200 80\n24 97 46\n62 86 149\n214 101 26\n79 171 78\n125 72 118\n172 103 162\n219 51 64"
},
{
"input": "61\n2 3 1 3 2 2 2 3 1 3 2 3 1 2 1 1 2 2 2 2 3 2 3 1 2 1 3 1 3 2 1 1 3 2 1 3 3 3 1 3 3 1 1 3 1 3 2 2 1 2 2 2 1 3 2 3 1 3 3 1 1",
"output": "20\n9 55 2\n24 34 27\n3 5 37\n35 17 41\n61 11 4\n60 19 54\n15 20 59\n26 14 29\n16 22 38\n43 50 12\n49 25 36\n57 51 40\n39 6 33\n32 30 10\n31 48 8\n13 47 23\n45 1 58\n53 52 56\n42 18 21\n28 7 44"
},
{
"input": "5\n1 2 2 3 3",
"output": "1\n1 3 4"
}
] | 1,686,398,578
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 41
| 108
| 5,529,600
|
a = int(input())
q = list(map(int, input().split()))
t = min(q.count(1), q.count(2), q.count(3))
print (t)
for i in range(t):
print (q.index(1) + 1, q.index(2) + 1, q.index(3) + 1)
q[q.index(1)], q[q.index(2)], q[q.index(3)] = 4, 4, 4
|
Title: Team Olympiad
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The School №0 of the capital of Berland has *n* children studying in it. All the children in this school are gifted: some of them are good at programming, some are good at maths, others are good at PE (Physical Education). Hence, for each child we know value *t**i*:
- *t**i*<==<=1, if the *i*-th child is good at programming, - *t**i*<==<=2, if the *i*-th child is good at maths, - *t**i*<==<=3, if the *i*-th child is good at PE
Each child happens to be good at exactly one of these three subjects.
The Team Scientific Decathlon Olympias requires teams of three students. The school teachers decided that the teams will be composed of three children that are good at different subjects. That is, each team must have one mathematician, one programmer and one sportsman. Of course, each child can be a member of no more than one team.
What is the maximum number of teams that the school will be able to present at the Olympiad? How should the teams be formed for that?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=5000) — the number of children in the school. The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=3), where *t**i* describes the skill of the *i*-th child.
Output Specification:
In the first line output integer *w* — the largest possible number of teams.
Then print *w* lines, containing three numbers in each line. Each triple represents the indexes of the children forming the team. You can print both the teams, and the numbers in the triplets in any order. The children are numbered from 1 to *n* in the order of their appearance in the input. Each child must participate in no more than one team. If there are several solutions, print any of them.
If no teams can be compiled, print the only line with value *w* equal to 0.
Demo Input:
['7\n1 3 1 3 2 1 2\n', '4\n2 1 1 2\n']
Demo Output:
['2\n3 5 2\n6 7 4\n', '0\n']
Note:
none
|
```python
a = int(input())
q = list(map(int, input().split()))
t = min(q.count(1), q.count(2), q.count(3))
print (t)
for i in range(t):
print (q.index(1) + 1, q.index(2) + 1, q.index(3) + 1)
q[q.index(1)], q[q.index(2)], q[q.index(3)] = 4, 4, 4
```
| 3
|
|
472
|
A
|
Design Tutorial: Learn from Math
|
PROGRAMMING
| 800
|
[
"math",
"number theory"
] | null | null |
One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that.
For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem.
You are given an integer *n* no less than 12, express it as a sum of two composite numbers.
|
The only line contains an integer *n* (12<=≤<=*n*<=≤<=106).
|
Output two composite integers *x* and *y* (1<=<<=*x*,<=*y*<=<<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them.
|
[
"12\n",
"15\n",
"23\n",
"1000000\n"
] |
[
"4 8\n",
"6 9\n",
"8 15\n",
"500000 500000\n"
] |
In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well.
In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number.
| 500
|
[
{
"input": "12",
"output": "4 8"
},
{
"input": "15",
"output": "6 9"
},
{
"input": "23",
"output": "8 15"
},
{
"input": "1000000",
"output": "500000 500000"
},
{
"input": "63874",
"output": "4 63870"
},
{
"input": "14568",
"output": "4 14564"
},
{
"input": "192",
"output": "4 188"
},
{
"input": "86",
"output": "4 82"
},
{
"input": "46220",
"output": "4 46216"
},
{
"input": "57114",
"output": "4 57110"
},
{
"input": "869",
"output": "4 865"
},
{
"input": "738457",
"output": "4 738453"
},
{
"input": "58113",
"output": "6 58107"
},
{
"input": "4864",
"output": "4 4860"
},
{
"input": "15",
"output": "6 9"
},
{
"input": "74752",
"output": "4 74748"
},
{
"input": "6073",
"output": "4 6069"
},
{
"input": "1289",
"output": "4 1285"
},
{
"input": "20",
"output": "4 16"
},
{
"input": "58134",
"output": "4 58130"
},
{
"input": "57756",
"output": "4 57752"
},
{
"input": "765",
"output": "6 759"
},
{
"input": "59",
"output": "4 55"
},
{
"input": "991666",
"output": "4 991662"
},
{
"input": "70761",
"output": "4 70757"
},
{
"input": "13",
"output": "4 9"
},
{
"input": "999999",
"output": "4 999995"
},
{
"input": "17",
"output": "8 9"
},
{
"input": "21",
"output": "6 15"
},
{
"input": "19",
"output": "4 15"
},
{
"input": "100007",
"output": "6 100001"
},
{
"input": "999987",
"output": "6 999981"
},
{
"input": "22",
"output": "4 18"
}
] | 1,696,870,103
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 33
| 62
| 1,331,200
|
n = int(input())
i =2
def composite(n):
flag = 1
for i in range(2,n):
if n%i==0:
flag = 0
return True
break
while i<n:
if (composite(i)==True) and (composite(n-i)==True):
print(f'{i} {n-i}')
break
else:
i = i+1
|
Title: Design Tutorial: Learn from Math
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that.
For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem.
You are given an integer *n* no less than 12, express it as a sum of two composite numbers.
Input Specification:
The only line contains an integer *n* (12<=≤<=*n*<=≤<=106).
Output Specification:
Output two composite integers *x* and *y* (1<=<<=*x*,<=*y*<=<<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them.
Demo Input:
['12\n', '15\n', '23\n', '1000000\n']
Demo Output:
['4 8\n', '6 9\n', '8 15\n', '500000 500000\n']
Note:
In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well.
In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number.
|
```python
n = int(input())
i =2
def composite(n):
flag = 1
for i in range(2,n):
if n%i==0:
flag = 0
return True
break
while i<n:
if (composite(i)==True) and (composite(n-i)==True):
print(f'{i} {n-i}')
break
else:
i = i+1
```
| 3
|
|
265
|
A
|
Colorful Stones (Simplified Edition)
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
|
The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
|
Print the final 1-based position of Liss in a single line.
|
[
"RGB\nRRR\n",
"RRRBGBRBBB\nBBBRR\n",
"BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n"
] |
[
"2\n",
"3\n",
"15\n"
] |
none
| 500
|
[
{
"input": "RGB\nRRR",
"output": "2"
},
{
"input": "RRRBGBRBBB\nBBBRR",
"output": "3"
},
{
"input": "BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB",
"output": "15"
},
{
"input": "G\nRRBBRBRRBR",
"output": "1"
},
{
"input": "RRRRRBRRBRRGRBGGRRRGRBBRBBBBBRGRBGBRRGBBBRBBGBRGBB\nB",
"output": "1"
},
{
"input": "RRGGBRGRBG\nBRRGGBBGGR",
"output": "7"
},
{
"input": "BBRRGBGGRGBRGBRBRBGR\nGGGRBGGGBRRRRGRBGBGRGRRBGRBGBG",
"output": "15"
},
{
"input": "GBRRBGBGBBBBRRRGBGRRRGBGBBBRGR\nRRGBRRGRBBBBBBGRRBBR",
"output": "8"
},
{
"input": "BRGRRGRGRRGBBGBBBRRBBRRBGBBGRGBBGGRGBRBGGGRRRBGGBB\nRGBBGRRBBBRRGRRBRBBRGBBGGGRGBGRRRRBRBGGBRBGGGRGBRR",
"output": "16"
},
{
"input": "GGRGGBRRGRGBRRGGRBBGGRRGBBBGBBBGGRBGGBRBBRGBRRRBRG\nGGRGRRRRRRRRRGBBBBRGBRGRGRRGBBRGGBRBBRBGBRGRRRRGGR",
"output": "18"
},
{
"input": "RBBRBGBBGGGBRRBGBRGRRGGRBBBBGRBGGBRRBGBBRBRGBBGGGG\nBRRGRBGRBGBRGBRBGGBBBGBBRGRBGRGRBGRBGGRRBGBRGRRBBG",
"output": "23"
},
{
"input": "RRGGRRBRGRGBRGBRGBBRGGGBRBGBRGBRGGBRBRGBGRRBBGGRBR\nBRGRBBBGRBGRRGGRRRRRRRRGGGGGGGGBGGGGGGGRGRBBRGRGBR",
"output": "14"
},
{
"input": "RBRBRRRRRGGR\nBBBBRRGGBGRBRGBBRGGGRGGBRRBRBRBGGG",
"output": "12"
},
{
"input": "GGRGGGBRGRGRBBRGGGRBGRRR\nGBBBBGBGBGBBBRGGRGGBGRRGRRRGBGB",
"output": "12"
},
{
"input": "RGRBGBRBBGBRRGGGBBGBRRBGRGBBBBBGRRRGGRBB\nBGR",
"output": "2"
},
{
"input": "R\nB",
"output": "1"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "50"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
},
{
"input": "R\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
}
] | 1,696,595,592
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 19
| 92
| 0
|
string = input()
movement = input()
string_index = 0
i = 0
while i <= len(movement)-1:
if movement[i] == string[string_index]:
string_index += 1
i+=1
else:
i+=1
print(string_index+1)
|
Title: Colorful Stones (Simplified Edition)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
Input Specification:
The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
Output Specification:
Print the final 1-based position of Liss in a single line.
Demo Input:
['RGB\nRRR\n', 'RRRBGBRBBB\nBBBRR\n', 'BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n']
Demo Output:
['2\n', '3\n', '15\n']
Note:
none
|
```python
string = input()
movement = input()
string_index = 0
i = 0
while i <= len(movement)-1:
if movement[i] == string[string_index]:
string_index += 1
i+=1
else:
i+=1
print(string_index+1)
```
| 3
|
|
43
|
A
|
Football
|
PROGRAMMING
| 1,000
|
[
"strings"
] |
A. Football
|
2
|
256
|
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
|
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
|
[
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] |
[
"ABC\n",
"A\n"
] |
none
| 500
|
[
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,688,979,320
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 92
| 307,200
|
from collections import Counter
n = int(input())
goals = []
for _ in range(n):
team = input().strip()
goals.append(team)
goal_counts = Counter(goals)
winning_team = max(goal_counts, key=goal_counts.get)
print(winning_team)
|
Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none
|
```python
from collections import Counter
n = int(input())
goals = []
for _ in range(n):
team = input().strip()
goals.append(team)
goal_counts = Counter(goals)
winning_team = max(goal_counts, key=goal_counts.get)
print(winning_team)
```
| 3.976428
|
672
|
B
|
Different is Good
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms",
"implementation",
"strings"
] | null | null |
A wise man told Kerem "Different is good" once, so Kerem wants all things in his life to be different.
Kerem recently got a string *s* consisting of lowercase English letters. Since Kerem likes it when things are different, he wants all substrings of his string *s* to be distinct. Substring is a string formed by some number of consecutive characters of the string. For example, string "aba" has substrings "" (empty substring), "a", "b", "a", "ab", "ba", "aba".
If string *s* has at least two equal substrings then Kerem will change characters at some positions to some other lowercase English letters. Changing characters is a very tiring job, so Kerem want to perform as few changes as possible.
Your task is to find the minimum number of changes needed to make all the substrings of the given string distinct, or determine that it is impossible.
|
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100<=000) — the length of the string *s*.
The second line contains the string *s* of length *n* consisting of only lowercase English letters.
|
If it's impossible to change the string *s* such that all its substring are distinct print -1. Otherwise print the minimum required number of changes.
|
[
"2\naa\n",
"4\nkoko\n",
"5\nmurat\n"
] |
[
"1\n",
"2\n",
"0\n"
] |
In the first sample one of the possible solutions is to change the first character to 'b'.
In the second sample, one may change the first character to 'a' and second character to 'b', so the string becomes "abko".
| 1,000
|
[
{
"input": "2\naa",
"output": "1"
},
{
"input": "4\nkoko",
"output": "2"
},
{
"input": "5\nmurat",
"output": "0"
},
{
"input": "6\nacbead",
"output": "1"
},
{
"input": "7\ncdaadad",
"output": "4"
},
{
"input": "25\npeoaicnbisdocqofsqdpgobpn",
"output": "12"
},
{
"input": "25\ntcqpchnqskqjacruoaqilgebu",
"output": "7"
},
{
"input": "13\naebaecedabbee",
"output": "8"
},
{
"input": "27\naaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "-1"
},
{
"input": "10\nbababbdaee",
"output": "6"
},
{
"input": "11\ndbadcdbdbca",
"output": "7"
},
{
"input": "12\nacceaabddaaa",
"output": "7"
},
{
"input": "13\nabddfbfaeecfa",
"output": "7"
},
{
"input": "14\neeceecacdbcbbb",
"output": "9"
},
{
"input": "15\ndcbceaaggabaheb",
"output": "8"
},
{
"input": "16\nhgiegfbadgcicbhd",
"output": "7"
},
{
"input": "17\nabhfibbdddfghgfdi",
"output": "10"
},
{
"input": "26\nbbbbbabbaababaaabaaababbaa",
"output": "24"
},
{
"input": "26\nahnxdnbfbcrirerssyzydihuee",
"output": "11"
},
{
"input": "26\nhwqeqhkpxwulbsiwmnlfyhgknc",
"output": "8"
},
{
"input": "26\nrvxmulriorilidecqwmfaemifj",
"output": "10"
},
{
"input": "26\naowpmreooavnmamogdoopuisge",
"output": "12"
},
{
"input": "26\ninimevtuefhvuefirdehmmfudh",
"output": "15"
},
{
"input": "26\naaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "25"
},
{
"input": "27\nqdcfjtblgglnilgassirrjekcjt",
"output": "-1"
},
{
"input": "27\nabcdefghijklmnopqrstuvwxyza",
"output": "-1"
},
{
"input": "26\nqwertyuiopasdfghjklzxcvbnm",
"output": "0"
},
{
"input": "5\nzzzzz",
"output": "4"
},
{
"input": "27\naaaaaaaaaaaaaaaaabaaaaaaaaa",
"output": "-1"
},
{
"input": "1\nq",
"output": "0"
},
{
"input": "27\nqwertyuioplkjhgfdsazxcvbnmm",
"output": "-1"
},
{
"input": "9\nxxxyyyzzz",
"output": "6"
},
{
"input": "45\naaabbbcccdddeeefffgghhiijjkkkkkkkkkkkkkkkkkkk",
"output": "-1"
},
{
"input": "27\nqwertyuiopasdfghjklzxcvbnmm",
"output": "-1"
},
{
"input": "26\nabcdefghijklmnopqrstuvwxyz",
"output": "0"
},
{
"input": "26\nabcdefghijklmnopqrstuvwxya",
"output": "1"
},
{
"input": "27\nabcdefghijklmnopqrstuvwxyzz",
"output": "-1"
},
{
"input": "26\naaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "25"
},
{
"input": "26\nqwertyuioplkjhgfdsazxcvbnm",
"output": "0"
},
{
"input": "10\nzzzzzzzzzz",
"output": "9"
},
{
"input": "1\na",
"output": "0"
},
{
"input": "30\nabcdefghtyabcdefghtyabcdefghty",
"output": "-1"
}
] | 1,531,837,609
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 47
| 109
| 0
|
n = int(input())
if n > 26:
print(-1)
exit(0)
print(n - len(set(input())))
|
Title: Different is Good
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A wise man told Kerem "Different is good" once, so Kerem wants all things in his life to be different.
Kerem recently got a string *s* consisting of lowercase English letters. Since Kerem likes it when things are different, he wants all substrings of his string *s* to be distinct. Substring is a string formed by some number of consecutive characters of the string. For example, string "aba" has substrings "" (empty substring), "a", "b", "a", "ab", "ba", "aba".
If string *s* has at least two equal substrings then Kerem will change characters at some positions to some other lowercase English letters. Changing characters is a very tiring job, so Kerem want to perform as few changes as possible.
Your task is to find the minimum number of changes needed to make all the substrings of the given string distinct, or determine that it is impossible.
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100<=000) — the length of the string *s*.
The second line contains the string *s* of length *n* consisting of only lowercase English letters.
Output Specification:
If it's impossible to change the string *s* such that all its substring are distinct print -1. Otherwise print the minimum required number of changes.
Demo Input:
['2\naa\n', '4\nkoko\n', '5\nmurat\n']
Demo Output:
['1\n', '2\n', '0\n']
Note:
In the first sample one of the possible solutions is to change the first character to 'b'.
In the second sample, one may change the first character to 'a' and second character to 'b', so the string becomes "abko".
|
```python
n = int(input())
if n > 26:
print(-1)
exit(0)
print(n - len(set(input())))
```
| 3
|
|
330
|
A
|
Cakeminator
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat.
|
The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry.
|
Output the maximum number of cake cells that the cakeminator can eat.
|
[
"3 4\nS...\n....\n..S.\n"
] |
[
"8\n"
] |
For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats).
| 500
|
[
{
"input": "3 4\nS...\n....\n..S.",
"output": "8"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "2 2\nSS\nSS",
"output": "0"
},
{
"input": "7 3\nS..\nS..\nS..\nS..\nS..\nS..\nS..",
"output": "14"
},
{
"input": "3 5\n..S..\nSSSSS\n..S..",
"output": "0"
},
{
"input": "10 10\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS",
"output": "0"
},
{
"input": "10 10\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS",
"output": "30"
},
{
"input": "10 10\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..",
"output": "80"
},
{
"input": "9 5\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS",
"output": "0"
},
{
"input": "9 9\n...S.....\nS.S.....S\n.S....S..\n.S.....SS\n.........\n..S.S..S.\n.SS......\n....S....\n..S...S..",
"output": "17"
},
{
"input": "5 6\nSSSSSS\nSSSSSS\nSSSSSS\nSS.S..\nS.S.SS",
"output": "0"
},
{
"input": "9 8\n........\n.......S\n........\nS.......\n........\n........\nS.......\n........\n.......S",
"output": "64"
},
{
"input": "9 7\n......S\n......S\nS.S.S..\n.......\n.......\n.S.....\n.S....S\n..S....\n.S....S",
"output": "28"
},
{
"input": "10 10\n.....S....\n....SS..S.\n.S...S....\n........SS\n.S.......S\nSS..S.....\n.SS.....SS\nS..S......\n.......SSS\nSSSSS....S",
"output": "10"
},
{
"input": "6 7\n..S.SS.\n......S\n....S.S\nSS..S..\nS..SS.S\n.....S.",
"output": "0"
},
{
"input": "10 6\n.SSSSS\nSSS.SS\nSSSSSS\nS.SSSS\nSSSSS.\nS.SSSS\nSS.SSS\n.SSS.S\n.SSS..\nSS..SS",
"output": "0"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "4 3\n.S.\nS.S\n.S.\nS.S",
"output": "0"
},
{
"input": "2 3\n...\nSSS",
"output": "3"
},
{
"input": "2 4\nS.SS\nS.SS",
"output": "2"
},
{
"input": "2 2\n..\n.S",
"output": "3"
},
{
"input": "3 2\n.S\n.S\nSS",
"output": "0"
},
{
"input": "2 4\nSS.S\n..S.",
"output": "0"
},
{
"input": "2 3\n...\nS..",
"output": "5"
}
] | 1,625,641,618
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 42
| 218
| 0
|
n, m = [int(x) for x in input().split(' ')]
forbidden_rows = []
forbidden_columns = []
matrix = []
for i in range(n):
matrix.append([False] * m)
for i in range(n):
row = input()
for j in range(m):
c = row[j]
if c == 'S':
forbidden_rows.append(i)
forbidden_columns.append(j)
cnt = 0
for i in range(n):
if i not in forbidden_rows:
for j in range(m):
if not matrix[i][j]:
cnt += 1
matrix[i][j] = True
for j in range(m):
if j not in forbidden_columns:
for i in range(n):
if not matrix[i][j]:
cnt += 1
matrix[i][j] = True
print(cnt)
|
Title: Cakeminator
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat.
Input Specification:
The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry.
Output Specification:
Output the maximum number of cake cells that the cakeminator can eat.
Demo Input:
['3 4\nS...\n....\n..S.\n']
Demo Output:
['8\n']
Note:
For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats).
|
```python
n, m = [int(x) for x in input().split(' ')]
forbidden_rows = []
forbidden_columns = []
matrix = []
for i in range(n):
matrix.append([False] * m)
for i in range(n):
row = input()
for j in range(m):
c = row[j]
if c == 'S':
forbidden_rows.append(i)
forbidden_columns.append(j)
cnt = 0
for i in range(n):
if i not in forbidden_rows:
for j in range(m):
if not matrix[i][j]:
cnt += 1
matrix[i][j] = True
for j in range(m):
if j not in forbidden_columns:
for i in range(n):
if not matrix[i][j]:
cnt += 1
matrix[i][j] = True
print(cnt)
```
| 3
|
|
869
|
C
|
The Intriguing Obsession
|
PROGRAMMING
| 1,800
|
[
"combinatorics",
"dp",
"math"
] | null | null |
— This is not playing but duty as allies of justice, Nii-chan!
— Not allies but justice itself, Onii-chan!
With hands joined, go everywhere at a speed faster than our thoughts! This time, the Fire Sisters — Karen and Tsukihi — is heading for somewhere they've never reached — water-surrounded islands!
There are three clusters of islands, conveniently coloured red, blue and purple. The clusters consist of *a*, *b* and *c* distinct islands respectively.
Bridges have been built between some (possibly all or none) of the islands. A bridge bidirectionally connects two different islands and has length 1. For any two islands of the same colour, either they shouldn't be reached from each other through bridges, or the shortest distance between them is at least 3, apparently in order to prevent oddities from spreading quickly inside a cluster.
The Fire Sisters are ready for the unknown, but they'd also like to test your courage. And you're here to figure out the number of different ways to build all bridges under the constraints, and give the answer modulo 998<=244<=353. Two ways are considered different if a pair of islands exist, such that there's a bridge between them in one of them, but not in the other.
|
The first and only line of input contains three space-separated integers *a*, *b* and *c* (1<=≤<=*a*,<=*b*,<=*c*<=≤<=5<=000) — the number of islands in the red, blue and purple clusters, respectively.
|
Output one line containing an integer — the number of different ways to build bridges, modulo 998<=244<=353.
|
[
"1 1 1\n",
"1 2 2\n",
"1 3 5\n",
"6 2 9\n"
] |
[
"8\n",
"63\n",
"3264\n",
"813023575\n"
] |
In the first example, there are 3 bridges that can possibly be built, and no setup of bridges violates the restrictions. Thus the answer is 2<sup class="upper-index">3</sup> = 8.
In the second example, the upper two structures in the figure below are instances of valid ones, while the lower two are invalid due to the blue and purple clusters, respectively.
| 1,500
|
[
{
"input": "1 1 1",
"output": "8"
},
{
"input": "1 2 2",
"output": "63"
},
{
"input": "1 3 5",
"output": "3264"
},
{
"input": "6 2 9",
"output": "813023575"
},
{
"input": "7 3 7",
"output": "807577560"
},
{
"input": "135 14 39",
"output": "414849507"
},
{
"input": "5000 5000 5000",
"output": "986778560"
},
{
"input": "2 1 1",
"output": "18"
},
{
"input": "1 1 3",
"output": "32"
},
{
"input": "1 2 3",
"output": "156"
},
{
"input": "4 1 2",
"output": "315"
},
{
"input": "5 9 4",
"output": "661093467"
},
{
"input": "4 2 5",
"output": "326151"
},
{
"input": "9 4 10",
"output": "391175867"
},
{
"input": "16 8 29",
"output": "349763770"
},
{
"input": "17 46 45",
"output": "518654435"
},
{
"input": "28 47 1",
"output": "517406193"
},
{
"input": "94 87 10",
"output": "846321893"
},
{
"input": "84 29 61",
"output": "391253501"
},
{
"input": "179 856 377",
"output": "518957210"
},
{
"input": "1925 1009 273",
"output": "207866159"
},
{
"input": "1171 2989 2853",
"output": "234725427"
},
{
"input": "3238 2923 4661",
"output": "636587126"
},
{
"input": "1158 506 4676",
"output": "6109065"
},
{
"input": "4539 2805 2702",
"output": "356944655"
},
{
"input": "4756 775 3187",
"output": "56242066"
},
{
"input": "4998 4998 4998",
"output": "259368717"
},
{
"input": "4996 1 5000",
"output": "196902859"
},
{
"input": "2048 4096 1024",
"output": "445542375"
},
{
"input": "5000 1 1",
"output": "50020002"
}
] | 1,625,935,858
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 592
| 1,126,400
|
def calcop(a,b):
t=1
p=1
for i in range(0,min(a,b)):
p *= (a-i)*(b-i)
p //= i+1
t+=p
return t
a,b,c = map(int,input().split())
f = 998244353
ans = calcop(a,b)*calcop(b,c)*calcop(c,a)%f
print(ans)
|
Title: The Intriguing Obsession
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
— This is not playing but duty as allies of justice, Nii-chan!
— Not allies but justice itself, Onii-chan!
With hands joined, go everywhere at a speed faster than our thoughts! This time, the Fire Sisters — Karen and Tsukihi — is heading for somewhere they've never reached — water-surrounded islands!
There are three clusters of islands, conveniently coloured red, blue and purple. The clusters consist of *a*, *b* and *c* distinct islands respectively.
Bridges have been built between some (possibly all or none) of the islands. A bridge bidirectionally connects two different islands and has length 1. For any two islands of the same colour, either they shouldn't be reached from each other through bridges, or the shortest distance between them is at least 3, apparently in order to prevent oddities from spreading quickly inside a cluster.
The Fire Sisters are ready for the unknown, but they'd also like to test your courage. And you're here to figure out the number of different ways to build all bridges under the constraints, and give the answer modulo 998<=244<=353. Two ways are considered different if a pair of islands exist, such that there's a bridge between them in one of them, but not in the other.
Input Specification:
The first and only line of input contains three space-separated integers *a*, *b* and *c* (1<=≤<=*a*,<=*b*,<=*c*<=≤<=5<=000) — the number of islands in the red, blue and purple clusters, respectively.
Output Specification:
Output one line containing an integer — the number of different ways to build bridges, modulo 998<=244<=353.
Demo Input:
['1 1 1\n', '1 2 2\n', '1 3 5\n', '6 2 9\n']
Demo Output:
['8\n', '63\n', '3264\n', '813023575\n']
Note:
In the first example, there are 3 bridges that can possibly be built, and no setup of bridges violates the restrictions. Thus the answer is 2<sup class="upper-index">3</sup> = 8.
In the second example, the upper two structures in the figure below are instances of valid ones, while the lower two are invalid due to the blue and purple clusters, respectively.
|
```python
def calcop(a,b):
t=1
p=1
for i in range(0,min(a,b)):
p *= (a-i)*(b-i)
p //= i+1
t+=p
return t
a,b,c = map(int,input().split())
f = 998244353
ans = calcop(a,b)*calcop(b,c)*calcop(c,a)%f
print(ans)
```
| 3
|
|
43
|
A
|
Football
|
PROGRAMMING
| 1,000
|
[
"strings"
] |
A. Football
|
2
|
256
|
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
|
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
|
[
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] |
[
"ABC\n",
"A\n"
] |
none
| 500
|
[
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,634,752,105
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 92
| 4,505,600
|
n=int(input())
teams=[]
counters=[0]*n
while n:
team=input()
if team in teams:
counters[teams.index(team)]+=1
else:
teams.append(team)
n-=1
print(teams[counters.index(max(counters))])
|
Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none
|
```python
n=int(input())
teams=[]
counters=[0]*n
while n:
team=input()
if team in teams:
counters[teams.index(team)]+=1
else:
teams.append(team)
n-=1
print(teams[counters.index(max(counters))])
```
| 3.968608
|
155
|
A
|
I_love_\%username\%
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
|
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
|
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
|
[
"5\n100 50 200 150 200\n",
"10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n"
] |
[
"2\n",
"4\n"
] |
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing.
| 500
|
[
{
"input": "5\n100 50 200 150 200",
"output": "2"
},
{
"input": "10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242",
"output": "4"
},
{
"input": "1\n6",
"output": "0"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n100 36 53 7 81",
"output": "2"
},
{
"input": "5\n7 36 53 81 100",
"output": "4"
},
{
"input": "5\n100 81 53 36 7",
"output": "4"
},
{
"input": "10\n8 6 3 4 9 10 7 7 1 3",
"output": "5"
},
{
"input": "10\n1627 1675 1488 1390 1812 1137 1746 1324 1952 1862",
"output": "6"
},
{
"input": "10\n1 3 3 4 6 7 7 8 9 10",
"output": "7"
},
{
"input": "10\n1952 1862 1812 1746 1675 1627 1488 1390 1324 1137",
"output": "9"
},
{
"input": "25\n1448 4549 2310 2725 2091 3509 1565 2475 2232 3989 4231 779 2967 2702 608 3739 721 1552 2767 530 3114 665 1940 48 4198",
"output": "5"
},
{
"input": "33\n1097 1132 1091 1104 1049 1038 1023 1080 1104 1029 1035 1061 1049 1060 1088 1106 1105 1087 1063 1076 1054 1103 1047 1041 1028 1120 1126 1063 1117 1110 1044 1093 1101",
"output": "5"
},
{
"input": "34\n821 5536 2491 6074 7216 9885 764 1603 778 8736 8987 771 617 1587 8943 7922 439 7367 4115 8886 7878 6899 8811 5752 3184 3401 9760 9400 8995 4681 1323 6637 6554 6498",
"output": "7"
},
{
"input": "68\n6764 6877 6950 6768 6839 6755 6726 6778 6699 6805 6777 6985 6821 6801 6791 6805 6940 6761 6677 6999 6911 6699 6959 6933 6903 6843 6972 6717 6997 6756 6789 6668 6735 6852 6735 6880 6723 6834 6810 6694 6780 6679 6698 6857 6826 6896 6979 6968 6957 6988 6960 6700 6919 6892 6984 6685 6813 6678 6715 6857 6976 6902 6780 6686 6777 6686 6842 6679",
"output": "9"
},
{
"input": "60\n9000 9014 9034 9081 9131 9162 9174 9199 9202 9220 9221 9223 9229 9235 9251 9260 9268 9269 9270 9298 9307 9309 9313 9323 9386 9399 9407 9495 9497 9529 9531 9544 9614 9615 9627 9627 9643 9654 9656 9657 9685 9699 9701 9736 9745 9758 9799 9827 9843 9845 9854 9854 9885 9891 9896 9913 9942 9963 9986 9992",
"output": "57"
},
{
"input": "100\n7 61 12 52 41 16 34 99 30 44 48 89 31 54 21 1 48 52 61 15 35 87 21 76 64 92 44 81 16 93 84 92 32 15 68 76 53 39 26 4 11 26 7 4 99 99 61 65 55 85 65 67 47 39 2 74 63 49 98 87 5 94 22 30 25 42 31 84 49 23 89 60 16 26 92 27 9 57 75 61 94 35 83 47 99 100 63 24 91 88 79 10 15 45 22 64 3 11 89 83",
"output": "4"
},
{
"input": "100\n9999 9999 9999 9998 9998 9998 9997 9996 9996 9995 9993 9993 9991 9990 9989 9986 9984 9984 9983 9981 9981 9980 9980 9980 9979 9977 9977 9977 9977 9977 9976 9976 9975 9975 9973 9972 9972 9972 9972 9971 9969 9969 9969 9968 9967 9965 9962 9962 9962 9962 9960 9958 9958 9955 9954 9954 9954 9954 9950 9949 9949 9947 9943 9943 9940 9940 9939 9937 9937 9937 9936 9935 9932 9932 9931 9929 9927 9927 9926 9923 9919 9919 9918 9918 9918 9917 9917 9916 9916 9915 9914 9911 9910 9907 9907 9906 9905 9905 9904 9901",
"output": "57"
},
{
"input": "100\n158 159 157 156 155 154 160 153 161 152 162 163 151 164 150 165 149 148 147 166 146 167 145 144 143 142 168 141 169 170 140 139 138 137 171 136 135 134 172 173 174 133 175 132 177 178 131 179 180 130 129 181 128 127 182 126 183 125 124 184 123 122 121 120 119 118 117 185 186 187 188 189 116 190 115 191 192 193 114 113 112 111 110 109 108 194 195 107 106 105 196 197 104 198 199 103 102 200 101 100",
"output": "99"
},
{
"input": "2\n0 10000",
"output": "1"
},
{
"input": "2\n5 5",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n10 10",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
}
] | 1,688,639,113
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 216
| 0
|
n=int(input())
l=list(map(int,input().split()))
flag=0
b=2
for i in range(1,n):
b=2
for j in range(0,i):
if b!=0 and l[i]>l[j]:
b=1
elif b!=1 and l[i]<l[j]:
b=0
else:
b=2
break
if b==0 or b==1:
flag+=1
print(flag)
|
Title: I_love_\%username\%
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
Output Specification:
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
Demo Input:
['5\n100 50 200 150 200\n', '10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n']
Demo Output:
['2\n', '4\n']
Note:
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing.
|
```python
n=int(input())
l=list(map(int,input().split()))
flag=0
b=2
for i in range(1,n):
b=2
for j in range(0,i):
if b!=0 and l[i]>l[j]:
b=1
elif b!=1 and l[i]<l[j]:
b=0
else:
b=2
break
if b==0 or b==1:
flag+=1
print(flag)
```
| 3
|
|
415
|
A
|
Mashmokh and Lights
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Mashmokh works in a factory. At the end of each day he must turn off all of the lights.
The lights on the factory are indexed from 1 to *n*. There are *n* buttons in Mashmokh's room indexed from 1 to *n* as well. If Mashmokh pushes button with index *i*, then each light with index not less than *i* that is still turned on turns off.
Mashmokh is not very clever. So instead of pushing the first button he pushes some of the buttons randomly each night. He pushed *m* distinct buttons *b*1,<=*b*2,<=...,<=*b**m* (the buttons were pushed consecutively in the given order) this night. Now he wants to know for each light the index of the button that turned this light off. Please note that the index of button *b**i* is actually *b**i*, not *i*.
Please, help Mashmokh, print these indices.
|
The first line of the input contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), the number of the factory lights and the pushed buttons respectively. The next line contains *m* distinct space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*).
It is guaranteed that all lights will be turned off after pushing all buttons.
|
Output *n* space-separated integers where the *i*-th number is index of the button that turns the *i*-th light off.
|
[
"5 4\n4 3 1 2\n",
"5 5\n5 4 3 2 1\n"
] |
[
"1 1 3 4 4 \n",
"1 2 3 4 5 \n"
] |
In the first sample, after pressing button number 4, lights 4 and 5 are turned off and lights 1, 2 and 3 are still on. Then after pressing button number 3, light number 3 is turned off as well. Pressing button number 1 turns off lights number 1 and 2 as well so pressing button number 2 in the end has no effect. Thus button number 4 turned lights 4 and 5 off, button number 3 turned light 3 off and button number 1 turned light 1 and 2 off.
| 500
|
[
{
"input": "5 4\n4 3 1 2",
"output": "1 1 3 4 4 "
},
{
"input": "5 5\n5 4 3 2 1",
"output": "1 2 3 4 5 "
},
{
"input": "16 11\n8 5 12 10 14 2 6 3 15 9 1",
"output": "1 2 2 2 5 5 5 8 8 8 8 8 8 8 8 8 "
},
{
"input": "79 22\n76 32 48 28 33 44 58 59 1 51 77 13 15 64 49 72 74 21 61 12 60 57",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 28 28 28 28 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 76 76 76 76 "
},
{
"input": "25 19\n3 12 21 11 19 6 5 15 4 16 20 8 9 1 22 23 25 18 13",
"output": "1 1 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 "
},
{
"input": "48 8\n42 27 40 1 18 3 19 2",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 27 27 27 27 27 27 27 27 27 27 27 27 27 27 27 42 42 42 42 42 42 42 "
},
{
"input": "44 19\n13 20 7 10 9 14 43 17 18 39 21 42 37 1 33 8 35 4 6",
"output": "1 1 1 1 1 1 7 7 7 7 7 7 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 "
},
{
"input": "80 29\n79 51 28 73 65 39 10 1 59 29 7 70 64 3 35 17 24 71 74 2 6 49 66 80 13 18 60 15 12",
"output": "1 1 1 1 1 1 1 1 1 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 79 79 "
},
{
"input": "31 4\n8 18 30 1",
"output": "1 1 1 1 1 1 1 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 "
},
{
"input": "62 29\n61 55 35 13 51 56 23 6 8 26 27 40 48 11 18 12 19 50 54 14 24 21 32 17 43 33 1 2 3",
"output": "1 1 1 1 1 6 6 6 6 6 6 6 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 55 55 55 55 55 55 61 61 "
},
{
"input": "5 4\n2 3 4 1",
"output": "1 2 2 2 2 "
},
{
"input": "39 37\n2 5 17 24 19 33 35 16 20 3 1 34 10 36 15 37 14 8 28 21 13 31 30 29 7 25 32 12 6 27 22 4 11 39 18 9 26",
"output": "1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "100 100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "1 1\n1",
"output": "1 "
},
{
"input": "18 3\n18 1 11",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 18 "
},
{
"input": "67 20\n66 23 40 49 3 39 60 43 52 47 16 36 22 5 41 10 55 34 64 1",
"output": "1 1 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 66 66 "
},
{
"input": "92 52\n9 85 44 13 27 61 8 1 28 41 6 14 70 67 39 71 56 80 34 21 5 10 40 73 63 38 90 57 37 36 82 86 65 46 7 54 81 12 45 49 83 59 64 26 62 25 60 24 91 47 53 55",
"output": "1 1 1 1 1 1 1 8 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 "
},
{
"input": "66 36\n44 62 32 29 3 15 47 30 50 42 35 2 33 65 10 13 56 12 1 16 7 36 39 11 25 28 20 52 46 38 37 8 61 49 48 14",
"output": "1 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 29 29 29 32 32 32 32 32 32 32 32 32 32 32 32 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 "
},
{
"input": "32 8\n27 23 1 13 18 24 17 26",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 23 23 23 23 27 27 27 27 27 27 "
},
{
"input": "26 13\n1 14 13 2 4 24 21 22 16 3 10 12 6",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "31 20\n10 11 20 2 4 26 31 7 13 12 28 1 30 18 21 8 3 16 15 19",
"output": "1 2 2 2 2 2 2 2 2 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 "
},
{
"input": "86 25\n22 62 8 23 53 77 9 31 43 1 58 16 72 11 15 35 60 39 79 4 82 64 76 63 59",
"output": "1 1 1 1 1 1 1 8 8 8 8 8 8 8 8 8 8 8 8 8 8 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 "
},
{
"input": "62 54\n2 5 4 47 40 61 37 31 41 16 44 42 48 32 10 6 62 38 52 49 11 20 55 22 3 36 25 21 50 8 28 14 18 39 34 54 53 19 46 27 15 23 12 24 60 17 33 57 58 1 35 29 51 7",
"output": "1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "57 19\n43 45 37 40 42 55 16 33 47 32 34 35 9 41 1 6 8 15 5",
"output": "1 1 1 1 1 1 1 1 9 9 9 9 9 9 9 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 37 37 37 37 37 37 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 "
},
{
"input": "32 14\n4 7 13 1 25 22 9 27 6 28 30 2 14 21",
"output": "1 1 1 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 "
},
{
"input": "57 12\n8 53 51 38 1 6 16 33 13 46 28 35",
"output": "1 1 1 1 1 1 1 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 "
},
{
"input": "87 9\n57 34 78 1 52 67 56 6 54",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 "
},
{
"input": "88 42\n85 45 52 14 63 53 70 71 16 86 66 47 12 22 10 72 4 31 3 69 11 77 17 25 46 75 23 1 21 84 44 20 18 33 48 88 41 83 67 61 73 34",
"output": "1 1 3 4 4 4 4 4 4 10 10 12 12 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 85 85 85 85 "
},
{
"input": "27 25\n9 21 17 5 16 3 23 7 12 4 14 11 13 1 15 19 27 8 20 10 22 25 6 18 26",
"output": "1 1 3 3 5 5 5 5 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 "
},
{
"input": "89 28\n5 22 79 42 16 35 66 48 57 55 1 37 29 31 40 38 45 62 41 87 64 89 81 13 60 44 71 82",
"output": "1 1 1 1 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 "
},
{
"input": "17 4\n4 3 1 2",
"output": "1 1 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 "
}
] | 1,606,359,050
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 109
| 307,200
|
n,m = map(int, input().split())
arr = list(map(int, input().split()))
off = [-1] * n
lights = [1] * n
for i in arr:
index = i - 1
if(lights[index] == 1):
lights[index] = 0
off[index] = i
for j in range(index + 1, n):
if(lights[j] == 1):
lights[j] = 0
off[j] = i
off = [str(i) for i in off]
print(" ".join(off))
|
Title: Mashmokh and Lights
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mashmokh works in a factory. At the end of each day he must turn off all of the lights.
The lights on the factory are indexed from 1 to *n*. There are *n* buttons in Mashmokh's room indexed from 1 to *n* as well. If Mashmokh pushes button with index *i*, then each light with index not less than *i* that is still turned on turns off.
Mashmokh is not very clever. So instead of pushing the first button he pushes some of the buttons randomly each night. He pushed *m* distinct buttons *b*1,<=*b*2,<=...,<=*b**m* (the buttons were pushed consecutively in the given order) this night. Now he wants to know for each light the index of the button that turned this light off. Please note that the index of button *b**i* is actually *b**i*, not *i*.
Please, help Mashmokh, print these indices.
Input Specification:
The first line of the input contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), the number of the factory lights and the pushed buttons respectively. The next line contains *m* distinct space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*).
It is guaranteed that all lights will be turned off after pushing all buttons.
Output Specification:
Output *n* space-separated integers where the *i*-th number is index of the button that turns the *i*-th light off.
Demo Input:
['5 4\n4 3 1 2\n', '5 5\n5 4 3 2 1\n']
Demo Output:
['1 1 3 4 4 \n', '1 2 3 4 5 \n']
Note:
In the first sample, after pressing button number 4, lights 4 and 5 are turned off and lights 1, 2 and 3 are still on. Then after pressing button number 3, light number 3 is turned off as well. Pressing button number 1 turns off lights number 1 and 2 as well so pressing button number 2 in the end has no effect. Thus button number 4 turned lights 4 and 5 off, button number 3 turned light 3 off and button number 1 turned light 1 and 2 off.
|
```python
n,m = map(int, input().split())
arr = list(map(int, input().split()))
off = [-1] * n
lights = [1] * n
for i in arr:
index = i - 1
if(lights[index] == 1):
lights[index] = 0
off[index] = i
for j in range(index + 1, n):
if(lights[j] == 1):
lights[j] = 0
off[j] = i
off = [str(i) for i in off]
print(" ".join(off))
```
| 3
|
|
672
|
B
|
Different is Good
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms",
"implementation",
"strings"
] | null | null |
A wise man told Kerem "Different is good" once, so Kerem wants all things in his life to be different.
Kerem recently got a string *s* consisting of lowercase English letters. Since Kerem likes it when things are different, he wants all substrings of his string *s* to be distinct. Substring is a string formed by some number of consecutive characters of the string. For example, string "aba" has substrings "" (empty substring), "a", "b", "a", "ab", "ba", "aba".
If string *s* has at least two equal substrings then Kerem will change characters at some positions to some other lowercase English letters. Changing characters is a very tiring job, so Kerem want to perform as few changes as possible.
Your task is to find the minimum number of changes needed to make all the substrings of the given string distinct, or determine that it is impossible.
|
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100<=000) — the length of the string *s*.
The second line contains the string *s* of length *n* consisting of only lowercase English letters.
|
If it's impossible to change the string *s* such that all its substring are distinct print -1. Otherwise print the minimum required number of changes.
|
[
"2\naa\n",
"4\nkoko\n",
"5\nmurat\n"
] |
[
"1\n",
"2\n",
"0\n"
] |
In the first sample one of the possible solutions is to change the first character to 'b'.
In the second sample, one may change the first character to 'a' and second character to 'b', so the string becomes "abko".
| 1,000
|
[
{
"input": "2\naa",
"output": "1"
},
{
"input": "4\nkoko",
"output": "2"
},
{
"input": "5\nmurat",
"output": "0"
},
{
"input": "6\nacbead",
"output": "1"
},
{
"input": "7\ncdaadad",
"output": "4"
},
{
"input": "25\npeoaicnbisdocqofsqdpgobpn",
"output": "12"
},
{
"input": "25\ntcqpchnqskqjacruoaqilgebu",
"output": "7"
},
{
"input": "13\naebaecedabbee",
"output": "8"
},
{
"input": "27\naaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "-1"
},
{
"input": "10\nbababbdaee",
"output": "6"
},
{
"input": "11\ndbadcdbdbca",
"output": "7"
},
{
"input": "12\nacceaabddaaa",
"output": "7"
},
{
"input": "13\nabddfbfaeecfa",
"output": "7"
},
{
"input": "14\neeceecacdbcbbb",
"output": "9"
},
{
"input": "15\ndcbceaaggabaheb",
"output": "8"
},
{
"input": "16\nhgiegfbadgcicbhd",
"output": "7"
},
{
"input": "17\nabhfibbdddfghgfdi",
"output": "10"
},
{
"input": "26\nbbbbbabbaababaaabaaababbaa",
"output": "24"
},
{
"input": "26\nahnxdnbfbcrirerssyzydihuee",
"output": "11"
},
{
"input": "26\nhwqeqhkpxwulbsiwmnlfyhgknc",
"output": "8"
},
{
"input": "26\nrvxmulriorilidecqwmfaemifj",
"output": "10"
},
{
"input": "26\naowpmreooavnmamogdoopuisge",
"output": "12"
},
{
"input": "26\ninimevtuefhvuefirdehmmfudh",
"output": "15"
},
{
"input": "26\naaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "25"
},
{
"input": "27\nqdcfjtblgglnilgassirrjekcjt",
"output": "-1"
},
{
"input": "27\nabcdefghijklmnopqrstuvwxyza",
"output": "-1"
},
{
"input": "26\nqwertyuiopasdfghjklzxcvbnm",
"output": "0"
},
{
"input": "5\nzzzzz",
"output": "4"
},
{
"input": "27\naaaaaaaaaaaaaaaaabaaaaaaaaa",
"output": "-1"
},
{
"input": "1\nq",
"output": "0"
},
{
"input": "27\nqwertyuioplkjhgfdsazxcvbnmm",
"output": "-1"
},
{
"input": "9\nxxxyyyzzz",
"output": "6"
},
{
"input": "45\naaabbbcccdddeeefffgghhiijjkkkkkkkkkkkkkkkkkkk",
"output": "-1"
},
{
"input": "27\nqwertyuiopasdfghjklzxcvbnmm",
"output": "-1"
},
{
"input": "26\nabcdefghijklmnopqrstuvwxyz",
"output": "0"
},
{
"input": "26\nabcdefghijklmnopqrstuvwxya",
"output": "1"
},
{
"input": "27\nabcdefghijklmnopqrstuvwxyzz",
"output": "-1"
},
{
"input": "26\naaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "25"
},
{
"input": "26\nqwertyuioplkjhgfdsazxcvbnm",
"output": "0"
},
{
"input": "10\nzzzzzzzzzz",
"output": "9"
},
{
"input": "1\na",
"output": "0"
},
{
"input": "30\nabcdefghtyabcdefghtyabcdefghty",
"output": "-1"
}
] | 1,633,084,064
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 47
| 77
| 6,963,200
|
def minChanges(str):
MAX_CHAR = [26]
n = len(str )
# If length is more than maximum
# allowed characters, we cannot
# get the required string.
if (n > MAX_CHAR[0]):
return -1
# Variable to store count of
# distinct characters
dist_count = 0
# To store counts of different
# characters
count = [0] * MAX_CHAR[0]
for i in range(n):
if (count[ord(str[i]) - ord('a')] == 0) :
dist_count += 1
count[(ord(str[i]) - ord('a'))] += 1
# Answer is, n - number of distinct char
return (n - dist_count)
n=int(input())
s=str(input())
print(minChanges(s))
|
Title: Different is Good
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A wise man told Kerem "Different is good" once, so Kerem wants all things in his life to be different.
Kerem recently got a string *s* consisting of lowercase English letters. Since Kerem likes it when things are different, he wants all substrings of his string *s* to be distinct. Substring is a string formed by some number of consecutive characters of the string. For example, string "aba" has substrings "" (empty substring), "a", "b", "a", "ab", "ba", "aba".
If string *s* has at least two equal substrings then Kerem will change characters at some positions to some other lowercase English letters. Changing characters is a very tiring job, so Kerem want to perform as few changes as possible.
Your task is to find the minimum number of changes needed to make all the substrings of the given string distinct, or determine that it is impossible.
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100<=000) — the length of the string *s*.
The second line contains the string *s* of length *n* consisting of only lowercase English letters.
Output Specification:
If it's impossible to change the string *s* such that all its substring are distinct print -1. Otherwise print the minimum required number of changes.
Demo Input:
['2\naa\n', '4\nkoko\n', '5\nmurat\n']
Demo Output:
['1\n', '2\n', '0\n']
Note:
In the first sample one of the possible solutions is to change the first character to 'b'.
In the second sample, one may change the first character to 'a' and second character to 'b', so the string becomes "abko".
|
```python
def minChanges(str):
MAX_CHAR = [26]
n = len(str )
# If length is more than maximum
# allowed characters, we cannot
# get the required string.
if (n > MAX_CHAR[0]):
return -1
# Variable to store count of
# distinct characters
dist_count = 0
# To store counts of different
# characters
count = [0] * MAX_CHAR[0]
for i in range(n):
if (count[ord(str[i]) - ord('a')] == 0) :
dist_count += 1
count[(ord(str[i]) - ord('a'))] += 1
# Answer is, n - number of distinct char
return (n - dist_count)
n=int(input())
s=str(input())
print(minChanges(s))
```
| 3
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,672,713,883
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 46
| 0
|
import math
a,b,c=map(int,input().split())
print(math.ceil(b/c)*math.ceil(a/c))
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
import math
a,b,c=map(int,input().split())
print(math.ceil(b/c)*math.ceil(a/c))
```
| 3.977
|
318
|
A
|
Even Odds
|
PROGRAMMING
| 900
|
[
"math"
] | null | null |
Being a nonconformist, Volodya is displeased with the current state of things, particularly with the order of natural numbers (natural number is positive integer number). He is determined to rearrange them. But there are too many natural numbers, so Volodya decided to start with the first *n*. He writes down the following sequence of numbers: firstly all odd integers from 1 to *n* (in ascending order), then all even integers from 1 to *n* (also in ascending order). Help our hero to find out which number will stand at the position number *k*.
|
The only line of input contains integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1012).
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
Print the number that will stand at the position number *k* after Volodya's manipulations.
|
[
"10 3\n",
"7 7\n"
] |
[
"5",
"6"
] |
In the first sample Volodya's sequence will look like this: {1, 3, 5, 7, 9, 2, 4, 6, 8, 10}. The third place in the sequence is therefore occupied by the number 5.
| 500
|
[
{
"input": "10 3",
"output": "5"
},
{
"input": "7 7",
"output": "6"
},
{
"input": "7 1",
"output": "1"
},
{
"input": "7 2",
"output": "3"
},
{
"input": "8 5",
"output": "2"
},
{
"input": "8 3",
"output": "5"
},
{
"input": "8 4",
"output": "7"
},
{
"input": "1000000000000 500000000001",
"output": "2"
},
{
"input": "999999999997 499999999999",
"output": "999999999997"
},
{
"input": "999999999999 999999999999",
"output": "999999999998"
},
{
"input": "1000000000000 1",
"output": "1"
},
{
"input": "999999999999 1",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000000 1000000000000",
"output": "1000000000000"
},
{
"input": "1000000000000 500000000000",
"output": "999999999999"
},
{
"input": "1000000000000 499999999999",
"output": "999999999997"
},
{
"input": "999999999997 499999999998",
"output": "999999999995"
},
{
"input": "619234238 556154835",
"output": "493075432"
},
{
"input": "38151981 36650624",
"output": "35149266"
},
{
"input": "680402465 442571217",
"output": "204739968"
},
{
"input": "109135284 9408714",
"output": "18817427"
},
{
"input": "603701841 56038951",
"output": "112077901"
},
{
"input": "356764822 321510177",
"output": "286255532"
},
{
"input": "284911189 142190783",
"output": "284381565"
},
{
"input": "91028405 61435545",
"output": "31842684"
}
] | 1,696,072,422
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 62
| 0
|
n, k = map(int, input().split())
s = n // 2 + n % 2
if k > s:
print((k-s)*2)
else:
print(k*2-1)
|
Title: Even Odds
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Being a nonconformist, Volodya is displeased with the current state of things, particularly with the order of natural numbers (natural number is positive integer number). He is determined to rearrange them. But there are too many natural numbers, so Volodya decided to start with the first *n*. He writes down the following sequence of numbers: firstly all odd integers from 1 to *n* (in ascending order), then all even integers from 1 to *n* (also in ascending order). Help our hero to find out which number will stand at the position number *k*.
Input Specification:
The only line of input contains integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1012).
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
Output Specification:
Print the number that will stand at the position number *k* after Volodya's manipulations.
Demo Input:
['10 3\n', '7 7\n']
Demo Output:
['5', '6']
Note:
In the first sample Volodya's sequence will look like this: {1, 3, 5, 7, 9, 2, 4, 6, 8, 10}. The third place in the sequence is therefore occupied by the number 5.
|
```python
n, k = map(int, input().split())
s = n // 2 + n % 2
if k > s:
print((k-s)*2)
else:
print(k*2-1)
```
| 3
|
|
38
|
A
|
Army
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Army
|
2
|
256
|
The Berland Armed Forces System consists of *n* ranks that are numbered using natural numbers from 1 to *n*, where 1 is the lowest rank and *n* is the highest rank.
One needs exactly *d**i* years to rise from rank *i* to rank *i*<=+<=1. Reaching a certain rank *i* having not reached all the previous *i*<=-<=1 ranks is impossible.
Vasya has just reached a new rank of *a*, but he dreams of holding the rank of *b*. Find for how many more years Vasya should serve in the army until he can finally realize his dream.
|
The first input line contains an integer *n* (2<=≤<=*n*<=≤<=100). The second line contains *n*<=-<=1 integers *d**i* (1<=≤<=*d**i*<=≤<=100). The third input line contains two integers *a* and *b* (1<=≤<=*a*<=<<=*b*<=≤<=*n*). The numbers on the lines are space-separated.
|
Print the single number which is the number of years that Vasya needs to rise from rank *a* to rank *b*.
|
[
"3\n5 6\n1 2\n",
"3\n5 6\n1 3\n"
] |
[
"5\n",
"11\n"
] |
none
| 0
|
[
{
"input": "3\n5 6\n1 2",
"output": "5"
},
{
"input": "3\n5 6\n1 3",
"output": "11"
},
{
"input": "2\n55\n1 2",
"output": "55"
},
{
"input": "3\n85 78\n1 3",
"output": "163"
},
{
"input": "4\n63 4 49\n2 3",
"output": "4"
},
{
"input": "5\n93 83 42 56\n2 5",
"output": "181"
},
{
"input": "6\n22 9 87 89 57\n1 6",
"output": "264"
},
{
"input": "7\n52 36 31 23 74 78\n2 7",
"output": "242"
},
{
"input": "8\n82 14 24 5 91 49 94\n3 8",
"output": "263"
},
{
"input": "9\n12 40 69 39 59 21 59 5\n4 6",
"output": "98"
},
{
"input": "10\n95 81 32 59 71 30 50 61 100\n1 6",
"output": "338"
},
{
"input": "15\n89 55 94 4 15 69 19 60 91 77 3 94 91 62\n3 14",
"output": "617"
},
{
"input": "20\n91 1 41 51 95 67 92 35 23 70 44 91 57 50 21 8 9 71 40\n8 17",
"output": "399"
},
{
"input": "25\n70 95 21 84 97 39 12 98 53 24 78 29 84 65 70 22 100 17 69 27 62 48 35 80\n8 23",
"output": "846"
},
{
"input": "30\n35 69 50 44 19 56 86 56 98 24 21 2 61 24 85 30 2 22 57 35 59 84 12 77 92 53 50 92 9\n1 16",
"output": "730"
},
{
"input": "35\n2 34 47 15 27 61 6 88 67 20 53 65 29 68 77 5 78 86 44 98 32 81 91 79 54 84 95 23 65 97 22 33 42 87\n8 35",
"output": "1663"
},
{
"input": "40\n32 88 59 36 95 45 28 78 73 30 97 13 13 47 48 100 43 21 22 45 88 25 15 13 63 25 72 92 29 5 25 11 50 5 54 51 48 84 23\n7 26",
"output": "862"
},
{
"input": "45\n83 74 73 95 10 31 100 26 29 15 80 100 22 70 31 88 9 56 19 70 2 62 48 30 27 47 52 50 94 44 21 94 23 85 15 3 95 72 43 62 94 89 68 88\n17 40",
"output": "1061"
},
{
"input": "50\n28 8 16 29 19 82 70 51 96 84 74 72 17 69 12 21 37 21 39 3 18 66 19 49 86 96 94 93 2 90 96 84 59 88 58 15 61 33 55 22 35 54 51 29 64 68 29 38 40\n23 28",
"output": "344"
},
{
"input": "60\n24 28 25 21 43 71 64 73 71 90 51 83 69 43 75 43 78 72 56 61 99 7 23 86 9 16 16 94 23 74 18 56 20 72 13 31 75 34 35 86 61 49 4 72 84 7 65 70 66 52 21 38 6 43 69 40 73 46 5\n28 60",
"output": "1502"
},
{
"input": "70\n69 95 34 14 67 61 6 95 94 44 28 94 73 66 39 13 19 71 73 71 28 48 26 22 32 88 38 95 43 59 88 77 80 55 17 95 40 83 67 1 38 95 58 63 56 98 49 2 41 4 73 8 78 41 64 71 60 71 41 61 67 4 4 19 97 14 39 20 27\n9 41",
"output": "1767"
},
{
"input": "80\n65 15 43 6 43 98 100 16 69 98 4 54 25 40 2 35 12 23 38 29 10 89 30 6 4 8 7 96 64 43 11 49 89 38 20 59 54 85 46 16 16 89 60 54 28 37 32 34 67 9 78 30 50 87 58 53 99 48 77 3 5 6 19 99 16 20 31 10 80 76 82 56 56 83 72 81 84 60 28\n18 24",
"output": "219"
},
{
"input": "90\n61 35 100 99 67 87 42 90 44 4 81 65 29 63 66 56 53 22 55 87 39 30 34 42 27 80 29 97 85 28 81 22 50 22 24 75 67 86 78 79 94 35 13 97 48 76 68 66 94 13 82 1 22 85 5 36 86 73 65 97 43 56 35 26 87 25 74 47 81 67 73 75 99 75 53 38 70 21 66 78 38 17 57 40 93 57 68 55 1\n12 44",
"output": "1713"
},
{
"input": "95\n37 74 53 96 65 84 65 72 95 45 6 77 91 35 58 50 51 51 97 30 51 20 79 81 92 10 89 34 40 76 71 54 26 34 73 72 72 28 53 19 95 64 97 10 44 15 12 38 5 63 96 95 86 8 36 96 45 53 81 5 18 18 47 97 65 9 33 53 41 86 37 53 5 40 15 76 83 45 33 18 26 5 19 90 46 40 100 42 10 90 13 81 40 53\n6 15",
"output": "570"
},
{
"input": "96\n51 32 95 75 23 54 70 89 67 3 1 51 4 100 97 30 9 35 56 38 54 77 56 98 43 17 60 43 72 46 87 61 100 65 81 22 74 38 16 96 5 10 54 22 23 22 10 91 9 54 49 82 29 73 33 98 75 8 4 26 24 90 71 42 90 24 94 74 94 10 41 98 56 63 18 43 56 21 26 64 74 33 22 38 67 66 38 60 64 76 53 10 4 65 76\n21 26",
"output": "328"
},
{
"input": "97\n18 90 84 7 33 24 75 55 86 10 96 72 16 64 37 9 19 71 62 97 5 34 85 15 46 72 82 51 52 16 55 68 27 97 42 72 76 97 32 73 14 56 11 86 2 81 59 95 60 93 1 22 71 37 77 100 6 16 78 47 78 62 94 86 16 91 56 46 47 35 93 44 7 86 70 10 29 45 67 62 71 61 74 39 36 92 24 26 65 14 93 92 15 28 79 59\n6 68",
"output": "3385"
},
{
"input": "98\n32 47 26 86 43 42 79 72 6 68 40 46 29 80 24 89 29 7 21 56 8 92 13 33 50 79 5 7 84 85 24 23 1 80 51 21 26 55 96 51 24 2 68 98 81 88 57 100 64 84 54 10 14 2 74 1 89 71 1 20 84 85 17 31 42 58 69 67 48 60 97 90 58 10 21 29 2 21 60 61 68 89 77 39 57 18 61 44 67 100 33 74 27 40 83 29 6\n8 77",
"output": "3319"
},
{
"input": "99\n46 5 16 66 53 12 84 89 26 27 35 68 41 44 63 17 88 43 80 15 59 1 42 50 53 34 75 16 16 55 92 30 28 11 12 71 27 65 11 28 86 47 24 10 60 47 7 53 16 75 6 49 56 66 70 3 20 78 75 41 38 57 89 23 16 74 30 39 1 32 49 84 9 33 25 95 75 45 54 59 17 17 29 40 79 96 47 11 69 86 73 56 91 4 87 47 31 24\n23 36",
"output": "514"
},
{
"input": "100\n63 65 21 41 95 23 3 4 12 23 95 50 75 63 58 34 71 27 75 31 23 94 96 74 69 34 43 25 25 55 44 19 43 86 68 17 52 65 36 29 72 96 84 25 84 23 71 54 6 7 71 7 21 100 99 58 93 35 62 47 36 70 68 9 75 13 35 70 76 36 62 22 52 51 2 87 66 41 54 35 78 62 30 35 65 44 74 93 78 37 96 70 26 32 71 27 85 85 63\n43 92",
"output": "2599"
},
{
"input": "51\n85 38 22 38 42 36 55 24 36 80 49 15 66 91 88 61 46 82 1 61 89 92 6 56 28 8 46 80 56 90 91 38 38 17 69 64 57 68 13 44 45 38 8 72 61 39 87 2 73 88\n15 27",
"output": "618"
},
{
"input": "2\n3\n1 2",
"output": "3"
},
{
"input": "5\n6 8 22 22\n2 3",
"output": "8"
},
{
"input": "6\n3 12 27 28 28\n3 4",
"output": "27"
},
{
"input": "9\n1 2 2 2 2 3 3 5\n3 7",
"output": "9"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1\n6 8",
"output": "2"
},
{
"input": "20\n1 1 1 1 1 1 1 1 2 2 2 2 2 3 3 3 3 3 3\n5 17",
"output": "23"
},
{
"input": "25\n1 1 1 4 5 6 8 11 11 11 11 12 13 14 14 14 15 16 16 17 17 17 19 19\n4 8",
"output": "23"
},
{
"input": "35\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2\n30 31",
"output": "2"
},
{
"input": "45\n1 1 1 1 2 2 2 2 2 2 2 3 3 3 3 3 3 4 5 5 5 5 6 6 6 6 6 6 6 7 7 7 7 8 8 8 9 9 9 9 9 10 10 10\n42 45",
"output": "30"
},
{
"input": "50\n1 8 8 13 14 15 15 16 19 21 22 24 26 31 32 37 45 47 47 47 50 50 51 54 55 56 58 61 61 61 63 63 64 66 66 67 67 70 71 80 83 84 85 92 92 94 95 95 100\n4 17",
"output": "285"
},
{
"input": "60\n1 2 4 4 4 6 6 8 9 10 10 13 14 18 20 20 21 22 23 23 26 29 30 32 33 34 35 38 40 42 44 44 46 48 52 54 56 56 60 60 66 67 68 68 69 73 73 74 80 80 81 81 82 84 86 86 87 89 89\n56 58",
"output": "173"
},
{
"input": "70\n1 2 3 3 4 5 5 7 7 7 8 8 8 8 9 9 10 12 12 12 12 13 16 16 16 16 16 16 17 17 18 18 20 20 21 23 24 25 25 26 29 29 29 29 31 32 32 34 35 36 36 37 37 38 39 39 40 40 40 40 41 41 42 43 44 44 44 45 45\n62 65",
"output": "126"
},
{
"input": "80\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 4 4 4 4 5 5 5 5 5 5 5 6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 12 12\n17 65",
"output": "326"
},
{
"input": "90\n1 1 3 5 8 9 10 11 11 11 11 12 13 14 15 15 15 16 16 19 19 20 22 23 24 25 25 28 29 29 30 31 33 34 35 37 37 38 41 43 43 44 45 47 51 54 55 56 58 58 59 59 60 62 66 67 67 67 68 68 69 70 71 72 73 73 76 77 77 78 78 78 79 79 79 82 83 84 85 85 87 87 89 93 93 93 95 99 99\n28 48",
"output": "784"
},
{
"input": "95\n2 2 3 3 4 6 6 7 7 7 9 10 12 12 12 12 13 14 15 16 17 18 20 20 20 20 21 21 21 21 22 22 22 22 22 23 23 23 25 26 26 27 27 27 28 29 29 30 30 31 32 33 34 36 37 37 38 39 39 39 42 43 43 43 45 47 48 50 50 51 52 53 54 54 54 55 55 55 58 59 60 61 61 61 61 62 62 63 64 65 66 67 67 67\n64 93",
"output": "1636"
},
{
"input": "96\n1 1 2 3 3 5 8 9 9 10 10 10 11 11 11 11 11 12 13 13 13 14 15 15 16 16 17 17 17 17 18 18 20 20 20 21 21 21 23 24 24 25 25 26 27 27 27 27 29 29 29 30 30 30 32 32 32 32 32 32 33 33 34 34 34 35 35 35 36 36 37 37 37 38 39 40 41 41 41 41 42 42 43 43 45 45 45 46 46 47 47 49 50 52 52\n76 96",
"output": "898"
},
{
"input": "98\n2 3 4 4 5 7 8 10 10 10 11 11 12 12 12 12 13 14 15 15 16 16 18 19 19 20 21 21 21 21 22 23 24 25 26 26 27 27 27 27 29 29 30 30 31 31 37 40 40 40 41 41 41 42 43 44 44 44 46 46 47 49 49 50 50 50 51 53 55 55 56 56 56 56 56 57 57 58 59 60 60 60 62 62 63 64 64 64 65 66 66 67 68 70 70 71 71\n8 90",
"output": "3016"
},
{
"input": "99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n66 95",
"output": "29"
},
{
"input": "100\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 10 10 10 10 11 11 11 11 12 12 12 13 13 13 13 13 13 13 13 13 13 14 14 14 14 14 14 15 15 15 15 15 15 16 16 16 17 17\n39 52",
"output": "82"
},
{
"input": "51\n5 7 9 16 19 25 26 29 29 30 31 32 32 41 43 44 47 49 50 50 51 52 54 55 56 63 64 66 67 70 74 74 77 78 79 80 80 85 86 87 89 89 90 92 93 94 94 95 95 97\n3 44",
"output": "2268"
}
] | 1,613,116,375
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 50
| 124
| 0
|
n=int(input())
d=list(map(int, input().split()))
a,b=input().split()
a=int(a)
b=int(b)
di=b-a
di+=a-1
s=0
for i in range(a-1,di):
s+=d[i]
print(s)
|
Title: Army
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The Berland Armed Forces System consists of *n* ranks that are numbered using natural numbers from 1 to *n*, where 1 is the lowest rank and *n* is the highest rank.
One needs exactly *d**i* years to rise from rank *i* to rank *i*<=+<=1. Reaching a certain rank *i* having not reached all the previous *i*<=-<=1 ranks is impossible.
Vasya has just reached a new rank of *a*, but he dreams of holding the rank of *b*. Find for how many more years Vasya should serve in the army until he can finally realize his dream.
Input Specification:
The first input line contains an integer *n* (2<=≤<=*n*<=≤<=100). The second line contains *n*<=-<=1 integers *d**i* (1<=≤<=*d**i*<=≤<=100). The third input line contains two integers *a* and *b* (1<=≤<=*a*<=<<=*b*<=≤<=*n*). The numbers on the lines are space-separated.
Output Specification:
Print the single number which is the number of years that Vasya needs to rise from rank *a* to rank *b*.
Demo Input:
['3\n5 6\n1 2\n', '3\n5 6\n1 3\n']
Demo Output:
['5\n', '11\n']
Note:
none
|
```python
n=int(input())
d=list(map(int, input().split()))
a,b=input().split()
a=int(a)
b=int(b)
di=b-a
di+=a-1
s=0
for i in range(a-1,di):
s+=d[i]
print(s)
```
| 3.969
|
817
|
B
|
Makes And The Product
|
PROGRAMMING
| 1,500
|
[
"combinatorics",
"implementation",
"math",
"sortings"
] | null | null |
After returning from the army Makes received a gift — an array *a* consisting of *n* positive integer numbers. He hadn't been solving problems for a long time, so he became interested to answer a particular question: how many triples of indices (*i*,<= *j*,<= *k*) (*i*<=<<=*j*<=<<=*k*), such that *a**i*·*a**j*·*a**k* is minimum possible, are there in the array? Help him with it!
|
The first line of input contains a positive integer number *n* (3<=≤<=*n*<=≤<=105) — the number of elements in array *a*. The second line contains *n* positive integer numbers *a**i* (1<=≤<=*a**i*<=≤<=109) — the elements of a given array.
|
Print one number — the quantity of triples (*i*,<= *j*,<= *k*) such that *i*,<= *j* and *k* are pairwise distinct and *a**i*·*a**j*·*a**k* is minimum possible.
|
[
"4\n1 1 1 1\n",
"5\n1 3 2 3 4\n",
"6\n1 3 3 1 3 2\n"
] |
[
"4\n",
"2\n",
"1\n"
] |
In the first example Makes always chooses three ones out of four, and the number of ways to choose them is 4.
In the second example a triple of numbers (1, 2, 3) is chosen (numbers, not indices). Since there are two ways to choose an element 3, then the answer is 2.
In the third example a triple of numbers (1, 1, 2) is chosen, and there's only one way to choose indices.
| 0
|
[
{
"input": "4\n1 1 1 1",
"output": "4"
},
{
"input": "5\n1 3 2 3 4",
"output": "2"
},
{
"input": "6\n1 3 3 1 3 2",
"output": "1"
},
{
"input": "3\n1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "4\n1 1 2 2",
"output": "2"
},
{
"input": "3\n1 3 1",
"output": "1"
},
{
"input": "11\n1 2 2 2 2 2 2 2 2 2 2",
"output": "45"
},
{
"input": "5\n1 2 2 2 2",
"output": "6"
},
{
"input": "6\n1 2 2 3 3 4",
"output": "1"
},
{
"input": "8\n1 1 2 2 2 3 3 3",
"output": "3"
},
{
"input": "6\n1 2 2 2 2 3",
"output": "6"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "6\n1 2 2 2 3 3",
"output": "3"
},
{
"input": "6\n1 2 2 2 2 2",
"output": "10"
},
{
"input": "4\n1 2 2 2",
"output": "3"
},
{
"input": "5\n1 2 3 2 3",
"output": "1"
},
{
"input": "6\n2 2 3 3 3 3",
"output": "4"
},
{
"input": "6\n1 2 2 2 5 6",
"output": "3"
},
{
"input": "10\n1 2 2 2 2 2 2 2 2 2",
"output": "36"
},
{
"input": "3\n2 1 2",
"output": "1"
},
{
"input": "5\n1 2 3 3 3",
"output": "3"
},
{
"input": "6\n1 2 2 2 4 5",
"output": "3"
},
{
"input": "4\n1 2 2 3",
"output": "1"
},
{
"input": "10\n2 2 2 2 2 1 2 2 2 2",
"output": "36"
},
{
"input": "7\n2 2 2 3 3 3 1",
"output": "3"
},
{
"input": "3\n1 1 2",
"output": "1"
},
{
"input": "5\n1 1 2 2 2",
"output": "3"
},
{
"input": "3\n1 2 3",
"output": "1"
},
{
"input": "9\n2 2 3 3 3 3 3 3 3",
"output": "7"
},
{
"input": "5\n1 1 2 2 3",
"output": "2"
},
{
"input": "4\n1 1 3 3",
"output": "2"
},
{
"input": "4\n33554432 33554432 67108864 33554432",
"output": "1"
},
{
"input": "6\n2 2 2 1 2 2",
"output": "10"
},
{
"input": "10\n1 2 1 2 3 2 3 2 2 2",
"output": "6"
},
{
"input": "10\n9 6 4 7 1 8 9 5 9 4",
"output": "1"
},
{
"input": "4\n5 7 2 7",
"output": "2"
},
{
"input": "3\n7 6 7",
"output": "1"
},
{
"input": "6\n3 2 8 2 5 3",
"output": "2"
},
{
"input": "3\n5 9 5",
"output": "1"
},
{
"input": "5\n6 3 7 6 3",
"output": "2"
},
{
"input": "9\n10 10 4 10 7 9 6 7 3",
"output": "1"
},
{
"input": "5\n9 10 10 3 8",
"output": "1"
},
{
"input": "5\n2 9 5 10 5",
"output": "1"
},
{
"input": "9\n7 1 9 6 6 8 3 1 3",
"output": "2"
},
{
"input": "5\n3 4 4 4 5",
"output": "3"
},
{
"input": "3\n3 1 3",
"output": "1"
},
{
"input": "8\n3 2 2 5 2 2 1 2",
"output": "10"
}
] | 1,498,245,138
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 80
| 1,637
| 13,721,600
|
from math import factorial as f
def ncr(n,r):
return (f(n))//(f(r)*f(n-r))
n = int(input())
l = list(map(int,input().split()))
l.sort()
mn= min(l)
p = sum(1 for x in l if x==mn)
mn2 = max(l)
for x in l:
if mn<x<mn2:
mn2=x
q = sum(1 for x in l if x==mn2)
mn3 = max(l)
for x in l:
if mn2<x<mn3:
mn3=x
r = sum(1 for x in l if x==mn3)
if p>=3:
print(ncr(p,3))
else:
if p==2:
print(q)
if p==1:
if q==1:
print(r)
else:
print(ncr(q,2))
|
Title: Makes And The Product
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After returning from the army Makes received a gift — an array *a* consisting of *n* positive integer numbers. He hadn't been solving problems for a long time, so he became interested to answer a particular question: how many triples of indices (*i*,<= *j*,<= *k*) (*i*<=<<=*j*<=<<=*k*), such that *a**i*·*a**j*·*a**k* is minimum possible, are there in the array? Help him with it!
Input Specification:
The first line of input contains a positive integer number *n* (3<=≤<=*n*<=≤<=105) — the number of elements in array *a*. The second line contains *n* positive integer numbers *a**i* (1<=≤<=*a**i*<=≤<=109) — the elements of a given array.
Output Specification:
Print one number — the quantity of triples (*i*,<= *j*,<= *k*) such that *i*,<= *j* and *k* are pairwise distinct and *a**i*·*a**j*·*a**k* is minimum possible.
Demo Input:
['4\n1 1 1 1\n', '5\n1 3 2 3 4\n', '6\n1 3 3 1 3 2\n']
Demo Output:
['4\n', '2\n', '1\n']
Note:
In the first example Makes always chooses three ones out of four, and the number of ways to choose them is 4.
In the second example a triple of numbers (1, 2, 3) is chosen (numbers, not indices). Since there are two ways to choose an element 3, then the answer is 2.
In the third example a triple of numbers (1, 1, 2) is chosen, and there's only one way to choose indices.
|
```python
from math import factorial as f
def ncr(n,r):
return (f(n))//(f(r)*f(n-r))
n = int(input())
l = list(map(int,input().split()))
l.sort()
mn= min(l)
p = sum(1 for x in l if x==mn)
mn2 = max(l)
for x in l:
if mn<x<mn2:
mn2=x
q = sum(1 for x in l if x==mn2)
mn3 = max(l)
for x in l:
if mn2<x<mn3:
mn3=x
r = sum(1 for x in l if x==mn3)
if p>=3:
print(ncr(p,3))
else:
if p==2:
print(q)
if p==1:
if q==1:
print(r)
else:
print(ncr(q,2))
```
| 3
|
|
129
|
A
|
Cookies
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
|
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
|
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
|
[
"1\n1\n",
"10\n1 2 2 3 4 4 4 2 2 2\n",
"11\n2 2 2 2 2 2 2 2 2 2 99\n"
] |
[
"1\n",
"8\n",
"1\n"
] |
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
| 500
|
[
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 2 2 3 4 4 4 2 2 2",
"output": "8"
},
{
"input": "11\n2 2 2 2 2 2 2 2 2 2 99",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n2 2",
"output": "2"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "7\n7 7 7 7 7 7 7",
"output": "7"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "4"
},
{
"input": "100\n1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2",
"output": "50"
},
{
"input": "99\n99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99",
"output": "49"
},
{
"input": "82\n43 44 96 33 23 42 33 66 53 87 8 90 43 91 40 88 51 18 48 62 59 10 22 20 54 6 13 63 2 56 31 52 98 42 54 32 26 77 9 24 33 91 16 30 39 34 78 82 73 90 12 15 67 76 30 18 44 86 84 98 65 54 100 79 28 34 40 56 11 43 72 35 86 59 89 40 30 33 7 19 44 15",
"output": "50"
},
{
"input": "17\n50 14 17 77 74 74 38 76 41 27 45 29 66 98 38 73 38",
"output": "7"
},
{
"input": "94\n81 19 90 99 26 11 86 44 78 36 80 59 99 90 78 72 71 20 94 56 42 40 71 84 10 85 10 70 52 27 39 55 90 16 48 25 7 79 99 100 38 10 99 56 3 4 78 9 16 57 14 40 52 54 57 70 30 86 56 84 97 60 59 69 49 66 23 92 90 46 86 73 53 47 1 83 14 20 24 66 13 45 41 14 86 75 55 88 48 95 82 24 47 87",
"output": "39"
},
{
"input": "88\n64 95 12 90 40 65 98 45 52 54 79 7 81 25 98 19 68 82 41 53 35 50 5 22 32 21 8 39 8 6 72 27 81 30 12 79 21 42 60 2 66 87 46 93 62 78 52 71 76 32 78 94 86 85 55 15 34 76 41 20 32 26 94 81 89 45 74 49 11 40 40 39 49 46 80 85 90 23 80 40 86 58 70 26 48 93 23 53",
"output": "37"
},
{
"input": "84\n95 9 43 43 13 84 60 90 1 8 97 99 54 34 59 83 33 15 51 26 40 12 66 65 19 30 29 78 92 60 25 13 19 84 71 73 12 24 54 49 16 41 11 40 57 59 34 40 39 9 71 83 1 77 79 53 94 47 78 55 77 85 29 52 80 90 53 77 97 97 27 79 28 23 83 25 26 22 49 86 63 56 3 32",
"output": "51"
},
{
"input": "47\n61 97 76 94 91 22 2 68 62 73 90 47 16 79 44 71 98 68 43 6 53 52 40 27 68 67 43 96 14 91 60 61 96 24 97 13 32 65 85 96 81 77 34 18 23 14 80",
"output": "21"
},
{
"input": "69\n71 1 78 74 58 89 30 6 100 90 22 61 11 59 14 74 27 25 78 61 45 19 25 33 37 4 52 43 53 38 9 100 56 67 69 38 76 91 63 60 93 52 28 61 9 98 8 14 57 63 89 64 98 51 36 66 36 86 13 82 50 91 52 64 86 78 78 83 81",
"output": "37"
},
{
"input": "52\n38 78 36 75 19 3 56 1 39 97 24 79 84 16 93 55 96 64 12 24 1 86 80 29 12 32 36 36 73 39 76 65 53 98 30 20 28 8 86 43 70 22 75 69 62 65 81 25 53 40 71 59",
"output": "28"
},
{
"input": "74\n81 31 67 97 26 75 69 81 11 13 13 74 77 88 52 20 52 64 66 75 72 28 41 54 26 75 41 91 75 15 18 36 13 83 63 61 14 48 53 63 19 67 35 48 23 65 73 100 44 55 92 88 99 17 73 25 83 7 31 89 12 80 98 39 42 75 14 29 81 35 77 87 33 94",
"output": "47"
},
{
"input": "44\n46 56 31 31 37 71 94 2 14 100 45 72 36 72 80 3 38 54 42 98 50 32 31 42 62 31 45 50 95 100 18 17 64 22 18 25 52 56 70 57 43 40 81 28",
"output": "15"
},
{
"input": "22\n28 57 40 74 51 4 45 84 99 12 95 14 92 60 47 81 84 51 31 91 59 42",
"output": "11"
},
{
"input": "59\n73 45 94 76 41 49 65 13 74 66 36 25 47 75 40 23 92 72 11 32 32 8 81 26 68 56 41 8 76 47 96 55 70 11 84 14 83 18 70 22 30 39 28 100 48 11 92 45 78 69 86 1 54 90 98 91 13 17 35",
"output": "33"
},
{
"input": "63\n20 18 44 94 68 57 16 43 74 55 68 24 21 95 76 84 50 50 47 86 86 12 58 55 28 72 86 18 34 45 81 88 3 72 41 9 60 90 81 93 12 6 9 6 2 41 1 7 9 29 81 14 64 80 20 36 67 54 7 5 35 81 22",
"output": "37"
},
{
"input": "28\n49 84 48 19 44 91 11 82 96 95 88 90 71 82 87 25 31 23 18 13 98 45 26 65 35 12 31 14",
"output": "15"
},
{
"input": "61\n34 18 28 64 28 45 9 77 77 20 63 92 79 16 16 100 86 2 91 91 57 15 31 95 10 88 84 5 82 83 53 98 59 17 97 80 76 80 81 3 91 81 87 93 61 46 10 49 6 22 21 75 63 89 21 81 30 19 67 38 77",
"output": "35"
},
{
"input": "90\n41 90 43 1 28 75 90 50 3 70 76 64 81 63 25 69 83 82 29 91 59 66 21 61 7 55 72 49 38 69 72 20 64 58 30 81 61 29 96 14 39 5 100 20 29 98 75 29 44 78 97 45 26 77 73 59 22 99 41 6 3 96 71 20 9 18 96 18 90 62 34 78 54 5 41 6 73 33 2 54 26 21 18 6 45 57 43 73 95 75",
"output": "42"
},
{
"input": "45\n93 69 4 27 20 14 71 48 79 3 32 26 49 30 57 88 13 56 49 61 37 32 47 41 41 70 45 68 82 18 8 6 25 20 15 13 71 99 28 6 52 34 19 59 26",
"output": "23"
},
{
"input": "33\n29 95 48 49 91 10 83 71 47 25 66 36 51 12 34 10 54 74 41 96 89 26 89 1 42 33 1 62 9 32 49 65 78",
"output": "15"
},
{
"input": "34\n98 24 42 36 41 82 28 58 89 34 77 70 76 44 74 54 66 100 13 79 4 88 21 1 11 45 91 29 87 100 29 54 82 78",
"output": "13"
},
{
"input": "29\n91 84 26 84 9 63 52 9 65 56 90 2 36 7 67 33 91 14 65 38 53 36 81 83 85 14 33 95 51",
"output": "17"
},
{
"input": "100\n2 88 92 82 87 100 78 28 84 43 78 32 43 33 97 19 15 52 29 84 57 72 54 13 99 28 82 79 40 70 34 92 91 53 9 88 27 43 14 92 72 37 26 37 20 95 19 34 49 64 33 37 34 27 80 79 9 54 99 68 25 4 68 73 46 66 24 78 3 87 26 52 50 84 4 95 23 83 39 58 86 36 33 16 98 2 84 19 53 12 69 60 10 11 78 17 79 92 77 59",
"output": "45"
},
{
"input": "100\n2 95 45 73 9 54 20 97 57 82 88 26 18 71 25 27 75 54 31 11 58 85 69 75 72 91 76 5 25 80 45 49 4 73 8 81 81 38 5 12 53 77 7 96 90 35 28 80 73 94 19 69 96 17 94 49 69 9 32 19 5 12 46 29 26 40 59 59 6 95 82 50 72 2 45 69 12 5 72 29 39 72 23 96 81 28 28 56 68 58 37 41 30 1 90 84 15 24 96 43",
"output": "53"
},
{
"input": "100\n27 72 35 91 13 10 35 45 24 55 83 84 63 96 29 79 34 67 63 92 48 83 18 77 28 27 49 66 29 88 55 15 6 58 14 67 94 36 77 7 7 64 61 52 71 18 36 99 76 6 50 67 16 13 41 7 89 73 61 51 78 22 78 32 76 100 3 31 89 71 63 53 15 85 77 54 89 33 68 74 3 23 57 5 43 89 75 35 9 86 90 11 31 46 48 37 74 17 77 8",
"output": "40"
},
{
"input": "100\n69 98 69 88 11 49 55 8 25 91 17 81 47 26 15 73 96 71 18 42 42 61 48 14 92 78 35 72 4 27 62 75 83 79 17 16 46 80 96 90 82 54 37 69 85 21 67 70 96 10 46 63 21 59 56 92 54 88 77 30 75 45 44 29 86 100 51 11 65 69 66 56 82 63 27 1 51 51 13 10 3 55 26 85 34 16 87 72 13 100 81 71 90 95 86 50 83 55 55 54",
"output": "53"
},
{
"input": "100\n34 35 99 64 2 66 78 93 20 48 12 79 19 10 87 7 42 92 60 79 5 2 24 89 57 48 63 92 74 4 16 51 7 12 90 48 87 17 18 73 51 58 97 97 25 38 15 97 96 73 67 91 6 75 14 13 87 79 75 3 15 55 35 95 71 45 10 13 20 37 82 26 2 22 13 83 97 84 39 79 43 100 54 59 98 8 61 34 7 65 75 44 24 77 73 88 34 95 44 77",
"output": "55"
},
{
"input": "100\n15 86 3 1 51 26 74 85 37 87 64 58 10 6 57 26 30 47 85 65 24 72 50 40 12 35 91 47 91 60 47 87 95 34 80 91 26 3 36 39 14 86 28 70 51 44 28 21 72 79 57 61 16 71 100 94 57 67 36 74 24 21 89 85 25 2 97 67 76 53 76 80 97 64 35 13 8 32 21 52 62 61 67 14 74 73 66 44 55 76 24 3 43 42 99 61 36 80 38 66",
"output": "52"
},
{
"input": "100\n45 16 54 54 80 94 74 93 75 85 58 95 79 30 81 2 84 4 57 23 92 64 78 1 50 36 13 27 56 54 10 77 87 1 5 38 85 74 94 82 30 45 72 83 82 30 81 82 82 3 69 82 7 92 39 60 94 42 41 5 3 17 67 21 79 44 79 96 28 3 53 68 79 89 63 83 1 44 4 31 84 15 73 77 19 66 54 6 73 1 67 24 91 11 86 45 96 82 20 89",
"output": "51"
},
{
"input": "100\n84 23 50 32 90 71 92 43 58 70 6 82 7 55 85 19 70 89 12 26 29 56 74 30 2 27 4 39 63 67 91 81 11 33 75 10 82 88 39 43 43 80 68 35 55 67 53 62 73 65 86 74 43 51 14 48 42 92 83 57 22 33 24 99 5 27 78 96 7 28 11 15 8 38 85 67 5 92 24 96 57 59 14 95 91 4 9 18 45 33 74 83 64 85 14 51 51 94 29 2",
"output": "53"
},
{
"input": "100\n77 56 56 45 73 55 32 37 39 50 30 95 79 21 44 34 51 43 86 91 39 30 85 15 35 93 100 14 57 31 80 79 38 40 88 4 91 54 7 95 76 26 62 84 17 33 67 47 6 82 69 51 17 2 59 24 11 12 31 90 12 11 55 38 72 49 30 50 42 46 5 97 9 9 30 45 86 23 19 82 40 42 5 40 35 98 35 32 60 60 5 28 84 35 21 49 68 53 68 23",
"output": "48"
},
{
"input": "100\n78 38 79 61 45 86 83 83 86 90 74 69 2 84 73 39 2 5 20 71 24 80 54 89 58 34 77 40 39 62 2 47 28 53 97 75 88 98 94 96 33 71 44 90 47 36 19 89 87 98 90 87 5 85 34 79 82 3 42 88 89 63 35 7 89 30 40 48 12 41 56 76 83 60 80 80 39 56 77 4 72 96 30 55 57 51 7 19 11 1 66 1 91 87 11 62 95 85 79 25",
"output": "48"
},
{
"input": "100\n5 34 23 20 76 75 19 51 17 82 60 13 83 6 65 16 20 43 66 54 87 10 87 73 50 24 16 98 33 28 80 52 54 82 26 92 14 13 84 92 94 29 61 21 60 20 48 94 24 20 75 70 58 27 68 45 86 89 29 8 67 38 83 48 18 100 11 22 46 84 52 97 70 19 50 75 3 7 52 53 72 41 18 31 1 38 49 53 11 64 99 76 9 87 48 12 100 32 44 71",
"output": "58"
},
{
"input": "100\n76 89 68 78 24 72 73 95 98 72 58 15 2 5 56 32 9 65 50 70 94 31 29 54 89 52 31 93 43 56 26 35 72 95 51 55 78 70 11 92 17 5 54 94 81 31 78 95 73 91 95 37 59 9 53 48 65 55 84 8 45 97 64 37 96 34 36 53 66 17 72 48 99 23 27 18 92 84 44 73 60 78 53 29 68 99 19 39 61 40 69 6 77 12 47 29 15 4 8 45",
"output": "53"
},
{
"input": "100\n82 40 31 53 8 50 85 93 3 84 54 17 96 59 51 42 18 19 35 84 79 31 17 46 54 82 72 49 35 73 26 89 61 73 3 50 12 29 25 77 88 21 58 24 22 89 96 54 82 29 96 56 77 16 1 68 90 93 20 23 57 22 31 18 92 90 51 14 50 72 31 54 12 50 66 62 2 34 17 45 68 50 87 97 23 71 1 72 17 82 42 15 20 78 4 49 66 59 10 17",
"output": "54"
},
{
"input": "100\n32 82 82 24 39 53 48 5 29 24 9 37 91 37 91 95 1 97 84 52 12 56 93 47 22 20 14 17 40 22 79 34 24 2 69 30 69 29 3 89 21 46 60 92 39 29 18 24 49 18 40 22 60 13 77 50 39 64 50 70 99 8 66 31 90 38 20 54 7 21 5 56 41 68 69 20 54 89 69 62 9 53 43 89 81 97 15 2 52 78 89 65 16 61 59 42 56 25 32 52",
"output": "49"
},
{
"input": "100\n72 54 23 24 97 14 99 87 15 25 7 23 17 87 72 31 71 87 34 82 51 77 74 85 62 38 24 7 84 48 98 21 29 71 70 84 25 58 67 92 18 44 32 9 81 15 53 29 63 18 86 16 7 31 38 99 70 32 89 16 23 11 66 96 69 82 97 59 6 9 49 80 85 19 6 9 52 51 85 74 53 46 73 55 31 63 78 61 34 80 77 65 87 77 92 52 89 8 52 31",
"output": "44"
},
{
"input": "100\n56 88 8 19 7 15 11 54 35 50 19 57 63 72 51 43 50 19 57 90 40 100 8 92 11 96 30 32 59 65 93 47 62 3 50 41 30 50 72 83 61 46 83 60 20 46 33 1 5 18 83 22 34 16 41 95 63 63 7 59 55 95 91 29 64 60 64 81 45 45 10 9 88 37 69 85 21 82 41 76 42 34 47 78 51 83 65 100 13 22 59 76 63 1 26 86 36 94 99 74",
"output": "46"
},
{
"input": "100\n27 89 67 60 62 80 43 50 28 88 72 5 94 11 63 91 18 78 99 3 71 26 12 97 74 62 23 24 22 3 100 72 98 7 94 32 12 75 61 88 42 48 10 14 45 9 48 56 73 76 70 70 79 90 35 39 96 37 81 11 19 65 99 39 23 79 34 61 35 74 90 37 73 23 46 21 94 84 73 58 11 89 13 9 10 85 42 78 73 32 53 39 49 90 43 5 28 31 97 75",
"output": "53"
},
{
"input": "100\n33 24 97 96 1 14 99 51 13 65 67 20 46 88 42 44 20 49 5 89 98 83 15 40 74 83 58 3 10 79 34 2 69 28 37 100 55 52 14 8 44 94 97 89 6 42 11 28 30 33 55 56 20 57 52 25 75 1 87 42 62 41 37 12 54 85 95 80 42 36 94 96 28 76 54 36 4 17 26 24 62 15 17 79 84 36 92 78 74 91 96 77 54 92 81 91 62 98 37 37",
"output": "43"
},
{
"input": "100\n86 24 61 15 11 85 1 31 47 36 23 36 59 34 3 27 16 29 82 28 58 52 52 66 71 61 98 39 60 20 67 41 67 90 73 29 92 17 70 95 58 98 58 32 21 73 46 56 87 72 80 75 40 27 94 31 59 92 93 37 14 99 96 21 97 23 81 91 52 52 96 94 92 28 38 29 52 16 57 27 17 24 91 21 79 55 96 98 95 94 23 78 79 12 77 35 32 75 100 82",
"output": "51"
},
{
"input": "100\n88 85 41 37 69 21 7 69 36 5 92 26 64 75 22 46 67 20 70 22 62 66 38 24 47 49 68 30 90 31 67 86 86 82 9 51 43 45 48 42 73 44 31 94 45 60 54 66 20 87 11 94 34 32 87 66 56 28 75 39 37 90 72 93 55 72 31 42 30 71 87 61 4 12 12 81 23 61 56 98 71 32 30 33 96 63 92 16 8 78 47 91 47 54 49 3 81 82 41 5",
"output": "47"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "5\n1 1 3 2 2",
"output": "3"
}
] | 1,434,283,360
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 52
| 124
| 0
|
n = int(input())
a = [int(x) for x in input().split()]
res, res1, res2 = 0, 0, 0
for i in a:
res += i
if i % 2 == 0:
res1 += 1
else:
res2 += 1
if res % 2 == 0:
print(res1)
else:
print(res2)
|
Title: Cookies
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
Input Specification:
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
Output Specification:
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
Demo Input:
['1\n1\n', '10\n1 2 2 3 4 4 4 2 2 2\n', '11\n2 2 2 2 2 2 2 2 2 2 99\n']
Demo Output:
['1\n', '8\n', '1\n']
Note:
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
|
```python
n = int(input())
a = [int(x) for x in input().split()]
res, res1, res2 = 0, 0, 0
for i in a:
res += i
if i % 2 == 0:
res1 += 1
else:
res2 += 1
if res % 2 == 0:
print(res1)
else:
print(res2)
```
| 3
|
|
181
|
A
|
Series of Crimes
|
PROGRAMMING
| 800
|
[
"brute force",
"geometry",
"implementation"
] | null | null |
The Berland capital is shaken with three bold crimes committed by the Pihsters, a notorious criminal gang.
The Berland capital's map is represented by an *n*<=×<=*m* rectangular table. Each cell of the table on the map represents some districts of the capital.
The capital's main detective Polycarpus took a map and marked there the districts where the first three robberies had been committed as asterisks. Deduction tells Polycarpus that the fourth robbery will be committed in such district, that all four robbed districts will form the vertices of some rectangle, parallel to the sides of the map.
Polycarpus is good at deduction but he's hopeless at math. So he asked you to find the district where the fourth robbery will be committed.
|
The first line contains two space-separated integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of rows and columns in the table, correspondingly.
Each of the next *n* lines contains *m* characters — the description of the capital's map. Each character can either be a "." (dot), or an "*" (asterisk). A character equals "*" if the corresponding district has been robbed. Otherwise, it equals ".".
It is guaranteed that the map has exactly three characters "*" and we can always find the fourth district that meets the problem requirements.
|
Print two integers — the number of the row and the number of the column of the city district that is the fourth one to be robbed. The rows are numbered starting from one from top to bottom and the columns are numbered starting from one from left to right.
|
[
"3 2\n.*\n..\n**\n",
"3 3\n*.*\n*..\n...\n"
] |
[
"1 1\n",
"2 3\n"
] |
none
| 500
|
[
{
"input": "3 2\n.*\n..\n**",
"output": "1 1"
},
{
"input": "2 5\n*....\n*...*",
"output": "1 5"
},
{
"input": "7 2\n..\n**\n..\n..\n..\n..\n.*",
"output": "7 1"
},
{
"input": "7 2\n*.\n..\n..\n..\n..\n..\n**",
"output": "1 2"
},
{
"input": "2 10\n*......*..\n.......*..",
"output": "2 1"
},
{
"input": "10 3\n*..\n...\n...\n...\n...\n...\n...\n...\n...\n**.",
"output": "1 2"
},
{
"input": "100 2\n*.\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n**",
"output": "1 2"
},
{
"input": "99 3\n**.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n*..",
"output": "99 2"
},
{
"input": "98 3\n...\n.*.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n.**",
"output": "2 3"
},
{
"input": "99 3\n**.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n*..",
"output": "99 2"
},
{
"input": "98 3\n...\n.*.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n.**",
"output": "2 3"
},
{
"input": "2 100\n...................................................................................................*\n*..................................................................................................*",
"output": "1 1"
},
{
"input": "2 2\n*.\n**",
"output": "1 2"
},
{
"input": "2 2\n**\n.*",
"output": "2 1"
},
{
"input": "2 3\n*.*\n..*",
"output": "2 1"
}
] | 1,614,803,680
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 36
| 216
| 1,433,600
|
a = input().split()
a = [int(a) for a in a]
points = []
for i in range(a[0]):
b = list(input())
for h in range(a[1]):
if b[h] == "*":
point = (i + 1), (h + 1)
points.append(point)
final_point = []
x = []
y = []
for i in range(3):
listed = points[i]
if listed[0] in final_point:
final_point.remove(listed[0])
continue
final_point.append(listed[0])
x = final_point[0]
final_point = []
for i in range(3):
listed = points[i]
if listed[1] in final_point:
final_point.remove(listed[1])
continue
final_point.append(listed[1])
y = final_point[0]
print(x, y)
|
Title: Series of Crimes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Berland capital is shaken with three bold crimes committed by the Pihsters, a notorious criminal gang.
The Berland capital's map is represented by an *n*<=×<=*m* rectangular table. Each cell of the table on the map represents some districts of the capital.
The capital's main detective Polycarpus took a map and marked there the districts where the first three robberies had been committed as asterisks. Deduction tells Polycarpus that the fourth robbery will be committed in such district, that all four robbed districts will form the vertices of some rectangle, parallel to the sides of the map.
Polycarpus is good at deduction but he's hopeless at math. So he asked you to find the district where the fourth robbery will be committed.
Input Specification:
The first line contains two space-separated integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of rows and columns in the table, correspondingly.
Each of the next *n* lines contains *m* characters — the description of the capital's map. Each character can either be a "." (dot), or an "*" (asterisk). A character equals "*" if the corresponding district has been robbed. Otherwise, it equals ".".
It is guaranteed that the map has exactly three characters "*" and we can always find the fourth district that meets the problem requirements.
Output Specification:
Print two integers — the number of the row and the number of the column of the city district that is the fourth one to be robbed. The rows are numbered starting from one from top to bottom and the columns are numbered starting from one from left to right.
Demo Input:
['3 2\n.*\n..\n**\n', '3 3\n*.*\n*..\n...\n']
Demo Output:
['1 1\n', '2 3\n']
Note:
none
|
```python
a = input().split()
a = [int(a) for a in a]
points = []
for i in range(a[0]):
b = list(input())
for h in range(a[1]):
if b[h] == "*":
point = (i + 1), (h + 1)
points.append(point)
final_point = []
x = []
y = []
for i in range(3):
listed = points[i]
if listed[0] in final_point:
final_point.remove(listed[0])
continue
final_point.append(listed[0])
x = final_point[0]
final_point = []
for i in range(3):
listed = points[i]
if listed[1] in final_point:
final_point.remove(listed[1])
continue
final_point.append(listed[1])
y = final_point[0]
print(x, y)
```
| 3
|
|
372
|
A
|
Counting Kangaroos is Fun
|
PROGRAMMING
| 1,600
|
[
"binary search",
"greedy",
"sortings",
"two pointers"
] | null | null |
There are *n* kangaroos with pockets. Each kangaroo has a size (integer number). A kangaroo can go into another kangaroo's pocket if and only if the size of kangaroo who hold the kangaroo is at least twice as large as the size of kangaroo who is held.
Each kangaroo can hold at most one kangaroo, and the kangaroo who is held by another kangaroo cannot hold any kangaroos.
The kangaroo who is held by another kangaroo cannot be visible from outside. Please, find a plan of holding kangaroos with the minimal number of kangaroos who is visible.
|
The first line contains a single integer — *n* (1<=≤<=*n*<=≤<=5·105). Each of the next *n* lines contains an integer *s**i* — the size of the *i*-th kangaroo (1<=≤<=*s**i*<=≤<=105).
|
Output a single integer — the optimal number of visible kangaroos.
|
[
"8\n2\n5\n7\n6\n9\n8\n4\n2\n",
"8\n9\n1\n6\n2\n6\n5\n8\n3\n"
] |
[
"5\n",
"5\n"
] |
none
| 500
|
[
{
"input": "8\n2\n5\n7\n6\n9\n8\n4\n2",
"output": "5"
},
{
"input": "8\n9\n1\n6\n2\n6\n5\n8\n3",
"output": "5"
},
{
"input": "12\n3\n99\n24\n46\n75\n63\n57\n55\n10\n62\n34\n52",
"output": "7"
},
{
"input": "12\n55\n75\n1\n98\n63\n64\n9\n39\n82\n18\n47\n9",
"output": "6"
},
{
"input": "100\n678\n771\n96\n282\n135\n749\n168\n668\n17\n658\n979\n446\n998\n331\n606\n756\n37\n515\n538\n205\n647\n547\n904\n842\n647\n286\n774\n414\n267\n791\n595\n465\n8\n327\n855\n174\n339\n946\n184\n250\n807\n422\n679\n980\n64\n530\n312\n351\n676\n911\n803\n991\n669\n50\n293\n841\n545\n598\n737\n894\n231\n754\n588\n83\n873\n767\n833\n482\n905\n903\n970\n571\n715\n59\n777\n697\n537\n861\n339\n212\n149\n889\n905\n70\n970\n307\n830\n465\n968\n291\n430\n317\n942\n944\n330\n235\n814\n880\n415\n76",
"output": "58"
},
{
"input": "100\n154\n60\n97\n638\n139\n150\n570\n579\n601\n647\n804\n237\n245\n549\n288\n347\n778\n282\n916\n441\n974\n145\n957\n886\n655\n702\n930\n618\n132\n520\n972\n48\n94\n54\n682\n433\n896\n134\n845\n636\n242\n842\n125\n141\n240\n130\n409\n666\n948\n938\n604\n110\n474\n484\n364\n40\n807\n271\n438\n288\n201\n814\n754\n589\n341\n576\n146\n952\n819\n923\n222\n535\n336\n83\n314\n911\n303\n911\n384\n601\n249\n330\n735\n271\n142\n204\n405\n783\n775\n449\n590\n139\n109\n276\n45\n205\n454\n836\n82\n841",
"output": "50"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "4\n1\n1\n1\n2",
"output": "3"
},
{
"input": "5\n1\n2\n4\n8\n16",
"output": "3"
},
{
"input": "7\n1\n2\n4\n8\n16\n32\n64",
"output": "4"
},
{
"input": "3\n1\n2\n4",
"output": "2"
}
] | 1,587,543,189
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 997
| 14,950,400
|
n = int(input())
l = sorted([int(input()) for i in range(n)])
t=n-1
cnt=0
for i in range((n//2)- 1,-1,-1):
if l[i]*2<=l[t]:
cnt=cnt+1
t=t-1
print(cnt+(n-2*cnt))
|
Title: Counting Kangaroos is Fun
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* kangaroos with pockets. Each kangaroo has a size (integer number). A kangaroo can go into another kangaroo's pocket if and only if the size of kangaroo who hold the kangaroo is at least twice as large as the size of kangaroo who is held.
Each kangaroo can hold at most one kangaroo, and the kangaroo who is held by another kangaroo cannot hold any kangaroos.
The kangaroo who is held by another kangaroo cannot be visible from outside. Please, find a plan of holding kangaroos with the minimal number of kangaroos who is visible.
Input Specification:
The first line contains a single integer — *n* (1<=≤<=*n*<=≤<=5·105). Each of the next *n* lines contains an integer *s**i* — the size of the *i*-th kangaroo (1<=≤<=*s**i*<=≤<=105).
Output Specification:
Output a single integer — the optimal number of visible kangaroos.
Demo Input:
['8\n2\n5\n7\n6\n9\n8\n4\n2\n', '8\n9\n1\n6\n2\n6\n5\n8\n3\n']
Demo Output:
['5\n', '5\n']
Note:
none
|
```python
n = int(input())
l = sorted([int(input()) for i in range(n)])
t=n-1
cnt=0
for i in range((n//2)- 1,-1,-1):
if l[i]*2<=l[t]:
cnt=cnt+1
t=t-1
print(cnt+(n-2*cnt))
```
| 3
|
|
733
|
A
|
Grasshopper And the String
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
One day, the Grasshopper was jumping on the lawn and found a piece of paper with a string. Grasshopper became interested what is the minimum jump ability he should have in order to be able to reach the far end of the string, jumping only on vowels of the English alphabet. Jump ability is the maximum possible length of his jump.
Formally, consider that at the begginning the Grasshopper is located directly in front of the leftmost character of the string. His goal is to reach the position right after the rightmost character of the string. In one jump the Grasshopper could jump to the right any distance from 1 to the value of his jump ability.
The following letters are vowels: 'A', 'E', 'I', 'O', 'U' and 'Y'.
|
The first line contains non-empty string consisting of capital English letters. It is guaranteed that the length of the string does not exceed 100.
|
Print single integer *a* — the minimum jump ability of the Grasshopper (in the number of symbols) that is needed to overcome the given string, jumping only on vowels.
|
[
"ABABBBACFEYUKOTT\n",
"AAA\n"
] |
[
"4",
"1"
] |
none
| 500
|
[
{
"input": "ABABBBACFEYUKOTT",
"output": "4"
},
{
"input": "AAA",
"output": "1"
},
{
"input": "A",
"output": "1"
},
{
"input": "B",
"output": "2"
},
{
"input": "AEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOIKLMJNHGTRWSDZXCVBNMHGFDSXVWRTPPPLKMNBXIUOIUOIUOIUOOIU",
"output": "39"
},
{
"input": "AEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOIAEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOI",
"output": "1"
},
{
"input": "KMLPTGFHNBVCDRFGHNMBVXWSQFDCVBNHTJKLPMNFVCKMLPTGFHNBVCDRFGHNMBVXWSQFDCVBNHTJKLPMNFVC",
"output": "85"
},
{
"input": "QWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZ",
"output": "18"
},
{
"input": "PKLKBWTXVJ",
"output": "11"
},
{
"input": "CFHFPTGMOKXVLJJZJDQW",
"output": "12"
},
{
"input": "TXULTFSBUBFLRNQORMMULWNVLPWTYJXZBPBGAWNX",
"output": "9"
},
{
"input": "DAIUSEAUEUYUWEIOOEIOUYVYYOPEEWEBZOOOAOXUOIEUKYYOJOYAUYUUIYUXOUJLGIYEIIYUOCUAACRY",
"output": "4"
},
{
"input": "VRPHBNWNWVWBWMFJJDCTJQJDJBKSJRZLVQRVVFLTZFSGCGDXCWQVWWWMFVCQHPKXXVRKTGWGPSMQTPKNDQJHNSKLXPCXDJDQDZZD",
"output": "101"
},
{
"input": "SGDDFCDRDWGPNNFBBZZJSPXFYMZKPRXTCHVJSJJBWZXXQMDZBNKDHRGSRLGLRKPMWXNSXJPNJLDPXBSRCQMHJKPZNTPNTZXNPCJC",
"output": "76"
},
{
"input": "NVTQVNLGWFDBCBKSDLTBGWBMNQZWZQJWNGVCTCQBGWNTYJRDBPZJHXCXFMIXNRGSTXHQPCHNFQPCMDZWJGLJZWMRRFCVLBKDTDSC",
"output": "45"
},
{
"input": "SREZXQFVPQCLRCQGMKXCBRWKYZKWKRMZGXPMKWNMFZTRDPHJFCSXVPPXWKZMZTBFXGNLPLHZIPLFXNRRQFDTLFPKBGCXKTMCFKKT",
"output": "48"
},
{
"input": "ICKJKMVPDNZPLKDSLTPZNRLSQSGHQJQQPJJSNHNWVDLJRLZEJSXZDPHYXGGWXHLCTVQSKWNWGTLJMOZVJNZPVXGVPJKHFVZTGCCX",
"output": "47"
},
{
"input": "XXFPZDRPXLNHGDVCBDKJMKLGUQZXLLWYLOKFZVGXVNPJWZZZNRMQBRJCZTSDRHSNCVDMHKVXCXPCRBWSJCJWDRDPVZZLCZRTDRYA",
"output": "65"
},
{
"input": "HDDRZDKCHHHEDKHZMXQSNQGSGNNSCCPVJFGXGNCEKJMRKSGKAPQWPCWXXWHLSMRGSJWEHWQCSJJSGLQJXGVTBYALWMLKTTJMFPFS",
"output": "28"
},
{
"input": "PXVKJHXVDPWGLHWFWMJPMCCNHCKSHCPZXGIHHNMYNFQBUCKJJTXXJGKRNVRTQFDFMLLGPQKFOVNNLTNDIEXSARRJKGSCZKGGJCBW",
"output": "35"
},
{
"input": "EXNMTTFPJLDHXDQBJJRDRYBZVFFHUDCHCPNFZWXSMZXNFVJGHZWXVBRQFNUIDVLZOVPXQNVMFNBTJDSCKRLNGXPSADTGCAHCBJKL",
"output": "30"
},
{
"input": "NRNLSQQJGIJBCZFTNKJCXMGPARGWXPSHZXOBNSFOLDQVXTVAGJZNLXULHBRDGMNQKQGWMRRDPYCSNFVPUFTFBUBRXVJGNGSPJKLL",
"output": "19"
},
{
"input": "SRHOKCHQQMVZKTCVQXJJCFGYFXGMBZSZFNAFETXILZHPGHBWZRZQFMGSEYRUDVMCIQTXTBTSGFTHRRNGNTHHWWHCTDFHSVARMCMB",
"output": "30"
},
{
"input": "HBSVZHDKGNIRQUBYKYHUPJCEETGFMVBZJTHYHFQPFBVBSMQACYAVWZXSBGNKWXFNMQJFMSCHJVWBZXZGSNBRUHTHAJKVLEXFBOFB",
"output": "34"
},
{
"input": "NXKMUGOPTUQNSRYTKUKSCWCRQSZKKFPYUMDIBJAHJCEKZJVWZAWOLOEFBFXLQDDPNNZKCQHUPBFVDSXSUCVLMZXQROYQYIKPQPWR",
"output": "17"
},
{
"input": "TEHJDICFNOLQVQOAREVAGUAWODOCXJXIHYXFAEPEXRHPKEIIRCRIVASKNTVYUYDMUQKSTSSBYCDVZKDDHTSDWJWACPCLYYOXGCLT",
"output": "15"
},
{
"input": "LCJJUZZFEIUTMSEXEYNOOAIZMORQDOANAMUCYTFRARDCYHOYOPHGGYUNOGNXUAOYSEMXAZOOOFAVHQUBRNGORSPNQWZJYQQUNPEB",
"output": "9"
},
{
"input": "UUOKAOOJBXUTSMOLOOOOSUYYFTAVBNUXYFVOOGCGZYQEOYISIYOUULUAIJUYVVOENJDOCLHOSOHIHDEJOIGZNIXEMEGZACHUAQFW",
"output": "5"
},
{
"input": "OUUBEHXOOURMOAIAEHXCUOIYHUJEVAWYRCIIAGDRIPUIPAIUYAIWJEVYEYYUYBYOGVYESUJCFOJNUAHIOOKBUUHEJFEWPOEOUHYA",
"output": "4"
},
{
"input": "EMNOYEEUIOUHEWZITIAEZNCJUOUAOQEAUYEIHYUSUYUUUIAEDIOOERAEIRBOJIEVOMECOGAIAIUIYYUWYIHIOWVIJEYUEAFYULSE",
"output": "5"
},
{
"input": "BVOYEAYOIEYOREJUYEUOEOYIISYAEOUYAAOIOEOYOOOIEFUAEAAESUOOIIEUAAGAEISIAPYAHOOEYUJHUECGOYEIDAIRTBHOYOYA",
"output": "5"
},
{
"input": "GOIEOAYIEYYOOEOAIAEOOUWYEIOTNYAANAYOOXEEOEAVIOIAAIEOIAUIAIAAUEUAOIAEUOUUZYIYAIEUEGOOOOUEIYAEOSYAEYIO",
"output": "3"
},
{
"input": "AUEAOAYIAOYYIUIOAULIOEUEYAIEYYIUOEOEIEYRIYAYEYAEIIMMAAEAYAAAAEOUICAUAYOUIAOUIAIUOYEOEEYAEYEYAAEAOYIY",
"output": "3"
},
{
"input": "OAIIYEYYAOOEIUOEEIOUOIAEFIOAYETUYIOAAAEYYOYEYOEAUIIUEYAYYIIAOIEEYGYIEAAOOWYAIEYYYIAOUUOAIAYAYYOEUEOY",
"output": "2"
},
{
"input": "EEEAOEOEEIOUUUEUEAAOEOIUYJEYAIYIEIYYEAUOIIYIUOOEUCYEOOOYYYIUUAYIAOEUEIEAOUOIAACAOOUAUIYYEAAAOOUYIAAE",
"output": "2"
},
{
"input": "AYEYIIEUIYOYAYEUEIIIEUYUUAUEUIYAIAAUYONIEYIUIAEUUOUOYYOUUUIUIAEYEOUIIUOUUEOAIUUYAAEOAAEOYUUIYAYRAIII",
"output": "2"
},
{
"input": "YOOAAUUAAAYEUYIUIUYIUOUAEIEEIAUEOAUIIAAIUYEUUOYUIYEAYAAAYUEEOEEAEOEEYYOUAEUYEEAIIYEUEYJOIIYUIOIUOIEE",
"output": "2"
},
{
"input": "UYOIIIAYOOAIUUOOEEUYIOUAEOOEIOUIAIEYOAEAIOOEOOOIUYYUYIAAUIOUYYOOUAUIEYYUOAAUUEAAIEUIAUEUUIAUUOYOAYIU",
"output": "1"
},
{
"input": "ABBABBB",
"output": "4"
},
{
"input": "ABCD",
"output": "4"
},
{
"input": "XXYC",
"output": "3"
},
{
"input": "YYY",
"output": "1"
},
{
"input": "ABABBBBBBB",
"output": "8"
},
{
"input": "YYYY",
"output": "1"
},
{
"input": "YYYYY",
"output": "1"
},
{
"input": "AXXX",
"output": "4"
},
{
"input": "YYYYYYY",
"output": "1"
},
{
"input": "BYYBBB",
"output": "4"
},
{
"input": "YYYYYYYYY",
"output": "1"
},
{
"input": "CAAAAA",
"output": "2"
},
{
"input": "CCCACCCC",
"output": "5"
},
{
"input": "ABABBBACFEYUKOTTTT",
"output": "5"
},
{
"input": "AABBYYYYYYYY",
"output": "3"
},
{
"input": "BYBACYC",
"output": "2"
},
{
"input": "Y",
"output": "1"
},
{
"input": "ABBBBBB",
"output": "7"
},
{
"input": "BACDYDI",
"output": "3"
},
{
"input": "XEXXXXXXXXXXXXXXX",
"output": "16"
},
{
"input": "TTYTT",
"output": "3"
},
{
"input": "AAYBC",
"output": "3"
},
{
"input": "ABABBBACFEYUKOTTTTT",
"output": "6"
},
{
"input": "YYAYY",
"output": "1"
},
{
"input": "YZZY",
"output": "3"
},
{
"input": "YY",
"output": "1"
},
{
"input": "ZZYZZ",
"output": "3"
},
{
"input": "YBBBY",
"output": "4"
},
{
"input": "BBBACCCCCCC",
"output": "8"
},
{
"input": "YBBBBY",
"output": "5"
},
{
"input": "YYYYYYYYYY",
"output": "1"
},
{
"input": "ABABBBBBBBBBBBB",
"output": "13"
}
] | 1,594,028,312
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 70
| 140
| 20,172,800
|
str1=input()
list1=list(str1)
pos=0
listNew=[]
for i in range(len(list1)):
if list1[i]=='A' or list1[i]=='E' or list1[i]=='I' or list1[i]=='O' or list1[i]=='U' or list1[i]=='Y':
listNew.append((i+1)-pos)
pos=i+1
pos-=1
listNew.append(len(list1)-pos)
print(max(listNew))
|
Title: Grasshopper And the String
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day, the Grasshopper was jumping on the lawn and found a piece of paper with a string. Grasshopper became interested what is the minimum jump ability he should have in order to be able to reach the far end of the string, jumping only on vowels of the English alphabet. Jump ability is the maximum possible length of his jump.
Formally, consider that at the begginning the Grasshopper is located directly in front of the leftmost character of the string. His goal is to reach the position right after the rightmost character of the string. In one jump the Grasshopper could jump to the right any distance from 1 to the value of his jump ability.
The following letters are vowels: 'A', 'E', 'I', 'O', 'U' and 'Y'.
Input Specification:
The first line contains non-empty string consisting of capital English letters. It is guaranteed that the length of the string does not exceed 100.
Output Specification:
Print single integer *a* — the minimum jump ability of the Grasshopper (in the number of symbols) that is needed to overcome the given string, jumping only on vowels.
Demo Input:
['ABABBBACFEYUKOTT\n', 'AAA\n']
Demo Output:
['4', '1']
Note:
none
|
```python
str1=input()
list1=list(str1)
pos=0
listNew=[]
for i in range(len(list1)):
if list1[i]=='A' or list1[i]=='E' or list1[i]=='I' or list1[i]=='O' or list1[i]=='U' or list1[i]=='Y':
listNew.append((i+1)-pos)
pos=i+1
pos-=1
listNew.append(len(list1)-pos)
print(max(listNew))
```
| 3
|
|
82
|
A
|
Double Cola
|
PROGRAMMING
| 1,100
|
[
"implementation",
"math"
] |
A. Double Cola
|
1
|
256
|
Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum.
For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny.
Write a program that will print the name of a man who will drink the *n*-th can.
Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon.
|
The input data consist of a single integer *n* (1<=≤<=*n*<=≤<=109).
It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers.
|
Print the single line — the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially.
|
[
"1\n",
"6\n",
"1802\n"
] |
[
"Sheldon\n",
"Sheldon\n",
"Penny\n"
] |
none
| 500
|
[
{
"input": "1",
"output": "Sheldon"
},
{
"input": "6",
"output": "Sheldon"
},
{
"input": "1802",
"output": "Penny"
},
{
"input": "1",
"output": "Sheldon"
},
{
"input": "2",
"output": "Leonard"
},
{
"input": "3",
"output": "Penny"
},
{
"input": "4",
"output": "Rajesh"
},
{
"input": "5",
"output": "Howard"
},
{
"input": "10",
"output": "Penny"
},
{
"input": "534",
"output": "Rajesh"
},
{
"input": "5033",
"output": "Howard"
},
{
"input": "10010",
"output": "Howard"
},
{
"input": "500000000",
"output": "Penny"
},
{
"input": "63",
"output": "Rajesh"
},
{
"input": "841",
"output": "Leonard"
},
{
"input": "3667",
"output": "Penny"
},
{
"input": "38614",
"output": "Howard"
},
{
"input": "282798",
"output": "Rajesh"
},
{
"input": "9266286",
"output": "Rajesh"
},
{
"input": "27385966",
"output": "Leonard"
},
{
"input": "121580142",
"output": "Penny"
},
{
"input": "5",
"output": "Howard"
},
{
"input": "300",
"output": "Howard"
},
{
"input": "1745",
"output": "Leonard"
},
{
"input": "8302",
"output": "Rajesh"
},
{
"input": "184518",
"output": "Sheldon"
},
{
"input": "1154414",
"output": "Rajesh"
},
{
"input": "28643950",
"output": "Leonard"
},
{
"input": "159222638",
"output": "Howard"
},
{
"input": "24",
"output": "Penny"
},
{
"input": "505",
"output": "Penny"
},
{
"input": "4425",
"output": "Rajesh"
},
{
"input": "12079",
"output": "Sheldon"
},
{
"input": "469726",
"output": "Penny"
},
{
"input": "3961838",
"output": "Penny"
},
{
"input": "57710446",
"output": "Leonard"
},
{
"input": "80719470",
"output": "Howard"
},
{
"input": "1000000000",
"output": "Penny"
},
{
"input": "999999999",
"output": "Penny"
},
{
"input": "999999998",
"output": "Penny"
},
{
"input": "5",
"output": "Howard"
}
] | 1,635,487,165
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 41
| 46
| 4,505,600
|
n = int(input())
queue = ['Sheldon', 'Leonard', 'Penny', 'Rajesh', 'Howard']
i = 0
while True:
if 5*(2**(i+1)-1) > n:
break
else:
i += 1
l = n - 5*(2**(i)-1)
print(queue[int((l-1)//(2**i))])
|
Title: Double Cola
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum.
For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny.
Write a program that will print the name of a man who will drink the *n*-th can.
Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon.
Input Specification:
The input data consist of a single integer *n* (1<=≤<=*n*<=≤<=109).
It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers.
Output Specification:
Print the single line — the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially.
Demo Input:
['1\n', '6\n', '1802\n']
Demo Output:
['Sheldon\n', 'Sheldon\n', 'Penny\n']
Note:
none
|
```python
n = int(input())
queue = ['Sheldon', 'Leonard', 'Penny', 'Rajesh', 'Howard']
i = 0
while True:
if 5*(2**(i+1)-1) > n:
break
else:
i += 1
l = n - 5*(2**(i)-1)
print(queue[int((l-1)//(2**i))])
```
| 3.968608
|
758
|
A
|
Holiday Of Equality
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
In Berland it is the holiday of equality. In honor of the holiday the king decided to equalize the welfare of all citizens in Berland by the expense of the state treasury.
Totally in Berland there are *n* citizens, the welfare of each of them is estimated as the integer in *a**i* burles (burle is the currency in Berland).
You are the royal treasurer, which needs to count the minimum charges of the kingdom on the king's present. The king can only give money, he hasn't a power to take away them.
|
The first line contains the integer *n* (1<=≤<=*n*<=≤<=100) — the number of citizens in the kingdom.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (0<=≤<=*a**i*<=≤<=106) — the welfare of the *i*-th citizen.
|
In the only line print the integer *S* — the minimum number of burles which are had to spend.
|
[
"5\n0 1 2 3 4\n",
"5\n1 1 0 1 1\n",
"3\n1 3 1\n",
"1\n12\n"
] |
[
"10",
"1",
"4",
"0"
] |
In the first example if we add to the first citizen 4 burles, to the second 3, to the third 2 and to the fourth 1, then the welfare of all citizens will equal 4.
In the second example it is enough to give one burle to the third citizen.
In the third example it is necessary to give two burles to the first and the third citizens to make the welfare of citizens equal 3.
In the fourth example it is possible to give nothing to everyone because all citizens have 12 burles.
| 500
|
[
{
"input": "5\n0 1 2 3 4",
"output": "10"
},
{
"input": "5\n1 1 0 1 1",
"output": "1"
},
{
"input": "3\n1 3 1",
"output": "4"
},
{
"input": "1\n12",
"output": "0"
},
{
"input": "3\n1 2 3",
"output": "3"
},
{
"input": "14\n52518 718438 358883 462189 853171 592966 225788 46977 814826 295697 676256 561479 56545 764281",
"output": "5464380"
},
{
"input": "21\n842556 216391 427181 626688 775504 168309 851038 448402 880826 73697 593338 519033 135115 20128 424606 939484 846242 756907 377058 241543 29353",
"output": "9535765"
},
{
"input": "3\n1 3 2",
"output": "3"
},
{
"input": "3\n2 1 3",
"output": "3"
},
{
"input": "3\n2 3 1",
"output": "3"
},
{
"input": "3\n3 1 2",
"output": "3"
},
{
"input": "3\n3 2 1",
"output": "3"
},
{
"input": "1\n228503",
"output": "0"
},
{
"input": "2\n32576 550340",
"output": "517764"
},
{
"input": "3\n910648 542843 537125",
"output": "741328"
},
{
"input": "4\n751720 572344 569387 893618",
"output": "787403"
},
{
"input": "6\n433864 631347 597596 794426 713555 231193",
"output": "1364575"
},
{
"input": "9\n31078 645168 695751 126111 375934 150495 838412 434477 993107",
"output": "4647430"
},
{
"input": "30\n315421 772664 560686 654312 151528 356749 351486 707462 820089 226682 546700 136028 824236 842130 578079 337807 665903 764100 617900 822937 992759 591749 651310 742085 767695 695442 17967 515106 81059 186025",
"output": "13488674"
},
{
"input": "45\n908719 394261 815134 419990 926993 383792 772842 277695 527137 655356 684956 695716 273062 550324 106247 399133 442382 33076 462920 294674 846052 817752 421365 474141 290471 358990 109812 74492 543281 169434 919692 786809 24028 197184 310029 801476 699355 429672 51343 374128 776726 850380 293868 981569 550763",
"output": "21993384"
},
{
"input": "56\n100728 972537 13846 385421 756708 184642 259487 319707 376662 221694 675284 972837 499419 13846 38267 289898 901299 831197 954715 197515 514102 910423 127555 883934 362472 870788 538802 741008 973434 448124 391526 363321 947321 544618 68006 782313 955075 741981 815027 723297 585059 718114 700739 413489 454091 736144 308999 98065 3716 347323 9635 289003 986510 607065 60236 273351",
"output": "26984185"
},
{
"input": "70\n644488 5444 150441 714420 602059 335330 510670 196555 546346 740011 509449 850947 692874 524857 750434 952985 223744 374727 896124 753037 367352 679050 560202 172728 569291 778616 332116 286927 843598 372698 244906 498046 900681 709791 420904 724593 864493 813094 791377 39998 296710 625656 403891 579231 706693 984045 16901 574259 562265 761104 930361 256045 124461 538980 573508 372148 988722 108592 784354 55302 232524 277205 782251 299943 436488 743389 324618 742543 266915 99642",
"output": "32816391"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n1000000",
"output": "0"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100\n1000000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "99000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1000000",
"output": "99000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1000000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "99000000"
},
{
"input": "3\n0 0 0",
"output": "0"
},
{
"input": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "3\n5 0 0",
"output": "10"
},
{
"input": "5\n2 10 0 0 0",
"output": "38"
}
] | 1,695,652,828
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 41
| 46
| 0
|
def getmax(elements):
max_val = elements[0]
for i in elements:
if i > max_val:
max_val = i
return max_val
def counter(elements, max_val):
count = 0
for i in elements:
count += max_val - i
return count
n = int(input())
elements = list(map(int, input().split(" ")))
max_val = getmax(elements)
count = counter(elements, max_val)
print(count)
|
Title: Holiday Of Equality
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In Berland it is the holiday of equality. In honor of the holiday the king decided to equalize the welfare of all citizens in Berland by the expense of the state treasury.
Totally in Berland there are *n* citizens, the welfare of each of them is estimated as the integer in *a**i* burles (burle is the currency in Berland).
You are the royal treasurer, which needs to count the minimum charges of the kingdom on the king's present. The king can only give money, he hasn't a power to take away them.
Input Specification:
The first line contains the integer *n* (1<=≤<=*n*<=≤<=100) — the number of citizens in the kingdom.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (0<=≤<=*a**i*<=≤<=106) — the welfare of the *i*-th citizen.
Output Specification:
In the only line print the integer *S* — the minimum number of burles which are had to spend.
Demo Input:
['5\n0 1 2 3 4\n', '5\n1 1 0 1 1\n', '3\n1 3 1\n', '1\n12\n']
Demo Output:
['10', '1', '4', '0']
Note:
In the first example if we add to the first citizen 4 burles, to the second 3, to the third 2 and to the fourth 1, then the welfare of all citizens will equal 4.
In the second example it is enough to give one burle to the third citizen.
In the third example it is necessary to give two burles to the first and the third citizens to make the welfare of citizens equal 3.
In the fourth example it is possible to give nothing to everyone because all citizens have 12 burles.
|
```python
def getmax(elements):
max_val = elements[0]
for i in elements:
if i > max_val:
max_val = i
return max_val
def counter(elements, max_val):
count = 0
for i in elements:
count += max_val - i
return count
n = int(input())
elements = list(map(int, input().split(" ")))
max_val = getmax(elements)
count = counter(elements, max_val)
print(count)
```
| 3
|
|
514
|
A
|
Chewbaсca and Number
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation"
] | null | null |
Luke Skywalker gave Chewbacca an integer number *x*. Chewbacca isn't good at numbers but he loves inverting digits in them. Inverting digit *t* means replacing it with digit 9<=-<=*t*.
Help Chewbacca to transform the initial number *x* to the minimum possible positive number by inverting some (possibly, zero) digits. The decimal representation of the final number shouldn't start with a zero.
|
The first line contains a single integer *x* (1<=≤<=*x*<=≤<=1018) — the number that Luke Skywalker gave to Chewbacca.
|
Print the minimum possible positive number that Chewbacca can obtain after inverting some digits. The number shouldn't contain leading zeroes.
|
[
"27\n",
"4545\n"
] |
[
"22\n",
"4444\n"
] |
none
| 500
|
[
{
"input": "27",
"output": "22"
},
{
"input": "4545",
"output": "4444"
},
{
"input": "1",
"output": "1"
},
{
"input": "9",
"output": "9"
},
{
"input": "8772",
"output": "1222"
},
{
"input": "81",
"output": "11"
},
{
"input": "71723447",
"output": "21223442"
},
{
"input": "91730629",
"output": "91230320"
},
{
"input": "420062703497",
"output": "420032203402"
},
{
"input": "332711047202",
"output": "332211042202"
},
{
"input": "3395184971407775",
"output": "3304114021402224"
},
{
"input": "8464062628894325",
"output": "1434032321104324"
},
{
"input": "164324828731963982",
"output": "134324121231033012"
},
{
"input": "384979173822804784",
"output": "314020123122104214"
},
{
"input": "41312150450968417",
"output": "41312140440031412"
},
{
"input": "2156",
"output": "2143"
},
{
"input": "1932",
"output": "1032"
},
{
"input": "5902",
"output": "4002"
},
{
"input": "5728",
"output": "4221"
},
{
"input": "8537",
"output": "1432"
},
{
"input": "55403857",
"output": "44403142"
},
{
"input": "270739",
"output": "220230"
},
{
"input": "28746918",
"output": "21243011"
},
{
"input": "10279211",
"output": "10220211"
},
{
"input": "40289679",
"output": "40210320"
},
{
"input": "545203238506",
"output": "444203231403"
},
{
"input": "461117063340",
"output": "431112033340"
},
{
"input": "658492686568",
"output": "341402313431"
},
{
"input": "857373361868",
"output": "142323331131"
},
{
"input": "429325660016",
"output": "420324330013"
},
{
"input": "9894448650287940",
"output": "9104441340212040"
},
{
"input": "6354510839296263",
"output": "3344410130203233"
},
{
"input": "6873575462224593",
"output": "3123424432224403"
},
{
"input": "4237951492601449",
"output": "4232041402301440"
},
{
"input": "2680352384836991",
"output": "2310342314133001"
},
{
"input": "606187734191890310",
"output": "303112234101100310"
},
{
"input": "351499943576823355",
"output": "341400043423123344"
},
{
"input": "180593481782177068",
"output": "110403411212122031"
},
{
"input": "999999999999999999",
"output": "900000000000000000"
},
{
"input": "1000000000000000000",
"output": "1000000000000000000"
},
{
"input": "9999",
"output": "9000"
},
{
"input": "99",
"output": "90"
},
{
"input": "9991",
"output": "9001"
}
] | 1,697,359,770
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 43
| 46
| 0
|
n = input()
string = str(n)
new_num = 0
if string[0]=='9':
new_num = 9
string = string[1:]
for digit in string :
digit = int(digit)
if digit >= 5 :
new_num= new_num*10 + (9-digit)
else :
new_num= new_num*10 + (digit)
print(new_num)
|
Title: Chewbaсca and Number
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Luke Skywalker gave Chewbacca an integer number *x*. Chewbacca isn't good at numbers but he loves inverting digits in them. Inverting digit *t* means replacing it with digit 9<=-<=*t*.
Help Chewbacca to transform the initial number *x* to the minimum possible positive number by inverting some (possibly, zero) digits. The decimal representation of the final number shouldn't start with a zero.
Input Specification:
The first line contains a single integer *x* (1<=≤<=*x*<=≤<=1018) — the number that Luke Skywalker gave to Chewbacca.
Output Specification:
Print the minimum possible positive number that Chewbacca can obtain after inverting some digits. The number shouldn't contain leading zeroes.
Demo Input:
['27\n', '4545\n']
Demo Output:
['22\n', '4444\n']
Note:
none
|
```python
n = input()
string = str(n)
new_num = 0
if string[0]=='9':
new_num = 9
string = string[1:]
for digit in string :
digit = int(digit)
if digit >= 5 :
new_num= new_num*10 + (9-digit)
else :
new_num= new_num*10 + (digit)
print(new_num)
```
| 3
|
|
493
|
B
|
Vasya and Wrestling
|
PROGRAMMING
| 1,400
|
[
"implementation"
] | null | null |
Vasya has become interested in wrestling. In wrestling wrestlers use techniques for which they are awarded points by judges. The wrestler who gets the most points wins.
When the numbers of points of both wrestlers are equal, the wrestler whose sequence of points is lexicographically greater, wins.
If the sequences of the awarded points coincide, the wrestler who performed the last technique wins. Your task is to determine which wrestler won.
|
The first line contains number *n* — the number of techniques that the wrestlers have used (1<=≤<=*n*<=≤<=2·105).
The following *n* lines contain integer numbers *a**i* (|*a**i*|<=≤<=109, *a**i*<=≠<=0). If *a**i* is positive, that means that the first wrestler performed the technique that was awarded with *a**i* points. And if *a**i* is negative, that means that the second wrestler performed the technique that was awarded with (<=-<=*a**i*) points.
The techniques are given in chronological order.
|
If the first wrestler wins, print string "first", otherwise print "second"
|
[
"5\n1\n2\n-3\n-4\n3\n",
"3\n-1\n-2\n3\n",
"2\n4\n-4\n"
] |
[
"second\n",
"first\n",
"second\n"
] |
Sequence *x* = *x*<sub class="lower-index">1</sub>*x*<sub class="lower-index">2</sub>... *x*<sub class="lower-index">|*x*|</sub> is lexicographically larger than sequence *y* = *y*<sub class="lower-index">1</sub>*y*<sub class="lower-index">2</sub>... *y*<sub class="lower-index">|*y*|</sub>, if either |*x*| > |*y*| and *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">|*y*|</sub> = *y*<sub class="lower-index">|*y*|</sub>, or there is such number *r* (*r* < |*x*|, *r* < |*y*|), that *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">*r*</sub> = *y*<sub class="lower-index">*r*</sub> and *x*<sub class="lower-index">*r* + 1</sub> > *y*<sub class="lower-index">*r* + 1</sub>.
We use notation |*a*| to denote length of sequence *a*.
| 1,000
|
[
{
"input": "5\n1\n2\n-3\n-4\n3",
"output": "second"
},
{
"input": "3\n-1\n-2\n3",
"output": "first"
},
{
"input": "2\n4\n-4",
"output": "second"
},
{
"input": "7\n1\n2\n-3\n4\n5\n-6\n7",
"output": "first"
},
{
"input": "14\n1\n2\n3\n4\n5\n6\n7\n-8\n-9\n-10\n-11\n-12\n-13\n-14",
"output": "second"
},
{
"input": "4\n16\n12\n19\n-98",
"output": "second"
},
{
"input": "5\n-6\n-1\n-1\n5\n3",
"output": "second"
},
{
"input": "11\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1",
"output": "first"
},
{
"input": "1\n-534365",
"output": "second"
},
{
"input": "1\n10253033",
"output": "first"
},
{
"input": "3\n-1\n-2\n3",
"output": "first"
},
{
"input": "8\n1\n-2\n-3\n4\n5\n-6\n-7\n8",
"output": "second"
},
{
"input": "2\n1\n-1",
"output": "second"
},
{
"input": "5\n1\n2\n3\n4\n5",
"output": "first"
},
{
"input": "5\n-1\n-2\n-3\n-4\n-5",
"output": "second"
},
{
"input": "10\n-1\n-2\n-3\n-4\n-5\n5\n4\n3\n2\n1",
"output": "first"
},
{
"input": "131\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n-1\n-1\n2",
"output": "first"
},
{
"input": "6\n-1\n-2\n-3\n1\n2\n3",
"output": "first"
},
{
"input": "3\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "12\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "4\n1000000000\n1000000000\n1000000000\n-1000000000",
"output": "first"
},
{
"input": "20\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "5\n1000000000\n1000000000\n-1000000000\n-1000000000\n-1000000000",
"output": "second"
},
{
"input": "4\n1\n-1000000000\n-1000000000\n-1000000000",
"output": "second"
},
{
"input": "5\n1000000000\n1000000000\n1000000000\n-1000000000\n-1000000000",
"output": "first"
},
{
"input": "4\n-1\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "11\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "2\n-4\n4",
"output": "first"
},
{
"input": "3\n-12\n3\n9",
"output": "second"
},
{
"input": "3\n9\n1\n-10",
"output": "second"
},
{
"input": "3\n1\n2\n-3",
"output": "second"
},
{
"input": "4\n55\n5\n-5\n-55",
"output": "first"
},
{
"input": "4\n5\n-1\n1\n-5",
"output": "first"
},
{
"input": "2\n-5\n6",
"output": "first"
},
{
"input": "4\n5\n-4\n3\n-40",
"output": "second"
},
{
"input": "4\n1000000000\n1000000000\n1000000000\n-5",
"output": "first"
},
{
"input": "6\n3\n2\n1\n-3\n-1\n-2",
"output": "first"
},
{
"input": "5\n4\n1\n1\n-3\n-3",
"output": "first"
},
{
"input": "5\n208\n-52\n-52\n-52\n-52",
"output": "first"
},
{
"input": "3\n-100\n-200\n300",
"output": "first"
},
{
"input": "3\n400\n-200\n-200",
"output": "first"
},
{
"input": "3\n208\n-207\n-1",
"output": "first"
},
{
"input": "3\n98888887\n98888888\n-197777775",
"output": "second"
}
] | 1,582,362,175
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 57
| 1,497
| 10,752,000
|
n=int(input())
fst=[]
sec = []
last = ''
for i in range(n):
t=int(input())
if t>0:
fst.append(t)
else:
sec.append(abs(t))
if i==n-1:
if t>0:
last = 'first'
else:
last= "second"
if sum(fst)>sum(sec):
print("first")
elif (sum(sec)>sum(fst)):
print("second")
else:
if fst==sec:
print(last)
elif fst>sec:
print("first")
else:
print("second")
|
Title: Vasya and Wrestling
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has become interested in wrestling. In wrestling wrestlers use techniques for which they are awarded points by judges. The wrestler who gets the most points wins.
When the numbers of points of both wrestlers are equal, the wrestler whose sequence of points is lexicographically greater, wins.
If the sequences of the awarded points coincide, the wrestler who performed the last technique wins. Your task is to determine which wrestler won.
Input Specification:
The first line contains number *n* — the number of techniques that the wrestlers have used (1<=≤<=*n*<=≤<=2·105).
The following *n* lines contain integer numbers *a**i* (|*a**i*|<=≤<=109, *a**i*<=≠<=0). If *a**i* is positive, that means that the first wrestler performed the technique that was awarded with *a**i* points. And if *a**i* is negative, that means that the second wrestler performed the technique that was awarded with (<=-<=*a**i*) points.
The techniques are given in chronological order.
Output Specification:
If the first wrestler wins, print string "first", otherwise print "second"
Demo Input:
['5\n1\n2\n-3\n-4\n3\n', '3\n-1\n-2\n3\n', '2\n4\n-4\n']
Demo Output:
['second\n', 'first\n', 'second\n']
Note:
Sequence *x* = *x*<sub class="lower-index">1</sub>*x*<sub class="lower-index">2</sub>... *x*<sub class="lower-index">|*x*|</sub> is lexicographically larger than sequence *y* = *y*<sub class="lower-index">1</sub>*y*<sub class="lower-index">2</sub>... *y*<sub class="lower-index">|*y*|</sub>, if either |*x*| > |*y*| and *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">|*y*|</sub> = *y*<sub class="lower-index">|*y*|</sub>, or there is such number *r* (*r* < |*x*|, *r* < |*y*|), that *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">*r*</sub> = *y*<sub class="lower-index">*r*</sub> and *x*<sub class="lower-index">*r* + 1</sub> > *y*<sub class="lower-index">*r* + 1</sub>.
We use notation |*a*| to denote length of sequence *a*.
|
```python
n=int(input())
fst=[]
sec = []
last = ''
for i in range(n):
t=int(input())
if t>0:
fst.append(t)
else:
sec.append(abs(t))
if i==n-1:
if t>0:
last = 'first'
else:
last= "second"
if sum(fst)>sum(sec):
print("first")
elif (sum(sec)>sum(fst)):
print("second")
else:
if fst==sec:
print(last)
elif fst>sec:
print("first")
else:
print("second")
```
| 3
|
|
427
|
A
|
Police Recruits
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups.
Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime.
If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated.
Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated.
|
The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers.
If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time.
|
Print a single integer, the number of crimes which will go untreated.
|
[
"3\n-1 -1 1\n",
"8\n1 -1 1 -1 -1 1 1 1\n",
"11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n"
] |
[
"2\n",
"1\n",
"8\n"
] |
Lets consider the second example:
1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired.
The answer is one, as one crime (on step 5) will go untreated.
| 500
|
[
{
"input": "3\n-1 -1 1",
"output": "2"
},
{
"input": "8\n1 -1 1 -1 -1 1 1 1",
"output": "1"
},
{
"input": "11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1",
"output": "8"
},
{
"input": "7\n-1 -1 1 1 -1 -1 1",
"output": "2"
},
{
"input": "21\n-1 -1 -1 -1 -1 3 2 -1 6 -1 -1 2 1 -1 2 2 1 6 5 -1 5",
"output": "5"
},
{
"input": "98\n-1 -1 1 -1 -1 -1 -1 1 -1 -1 1 -1 -1 1 -1 1 1 1 -1 1 1 1 1 1 -1 1 -1 -1 -1 -1 1 -1 -1 1 1 -1 1 1 1 -1 -1 -1 -1 -1 -1 1 -1 -1 -1 1 -1 1 -1 1 -1 1 1 1 1 1 1 1 -1 -1 1 1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 1 -1 1 1 1 -1 1 1 -1 -1 -1 1 1 1 -1 -1 -1 1 -1 1 1",
"output": "13"
},
{
"input": "3\n-1 5 4",
"output": "1"
},
{
"input": "146\n4 -1 -1 -1 -1 -1 -1 -1 -1 -1 4 -1 3 -1 3 -1 -1 1 4 -1 2 -1 -1 3 -1 -1 -1 4 1 -1 -1 -1 4 -1 -1 -1 -1 -1 -1 3 2 -1 3 2 4 5 2 4 1 5 -1 -1 2 -1 -1 1 -1 5 3 -1 1 2 2 3 5 3 -1 -1 3 -1 -1 3 5 5 -1 -1 5 -1 4 4 1 -1 -1 -1 2 1 -1 -1 -1 2 5 3 -1 -1 -1 3 -1 5 4 -1 1 -1 -1 3 -1 -1 3 1 1 2 -1 -1 -1 1 3 1 -1 2 -1 -1 5 5 -1 -1 3 4 5 1 -1 2 -1 -1 -1 3 -1 5 3 2 -1 2 -1 -1 5 -1 3 -1",
"output": "5"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "1\n-1",
"output": "1"
},
{
"input": "2\n1 -1",
"output": "0"
},
{
"input": "2\n-1 1",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n-1 -1",
"output": "2"
},
{
"input": "4\n10 -1 -1 -1",
"output": "0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "4\n-1 -1 1 1",
"output": "2"
}
] | 1,693,475,318
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 63
| 62
| 8,704,000
|
n=int(input())
liste=input().split(" ")
reserve=0
crimes=0
for i in liste:
if i=="-1":
if reserve==0:
crimes+=1
else:
reserve-=1
else :
reserve+=int(i)
print(crimes)
|
Title: Police Recruits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups.
Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime.
If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated.
Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated.
Input Specification:
The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers.
If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time.
Output Specification:
Print a single integer, the number of crimes which will go untreated.
Demo Input:
['3\n-1 -1 1\n', '8\n1 -1 1 -1 -1 1 1 1\n', '11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n']
Demo Output:
['2\n', '1\n', '8\n']
Note:
Lets consider the second example:
1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired.
The answer is one, as one crime (on step 5) will go untreated.
|
```python
n=int(input())
liste=input().split(" ")
reserve=0
crimes=0
for i in liste:
if i=="-1":
if reserve==0:
crimes+=1
else:
reserve-=1
else :
reserve+=int(i)
print(crimes)
```
| 3
|
|
525
|
A
|
Vitaliy and Pie
|
PROGRAMMING
| 1,100
|
[
"greedy",
"hashing",
"strings"
] | null | null |
After a hard day Vitaly got very hungry and he wants to eat his favorite potato pie. But it's not that simple. Vitaly is in the first room of the house with *n* room located in a line and numbered starting from one from left to right. You can go from the first room to the second room, from the second room to the third room and so on — you can go from the (*n*<=-<=1)-th room to the *n*-th room. Thus, you can go to room *x* only from room *x*<=-<=1.
The potato pie is located in the *n*-th room and Vitaly needs to go there.
Each pair of consecutive rooms has a door between them. In order to go to room *x* from room *x*<=-<=1, you need to open the door between the rooms with the corresponding key.
In total the house has several types of doors (represented by uppercase Latin letters) and several types of keys (represented by lowercase Latin letters). The key of type *t* can open the door of type *T* if and only if *t* and *T* are the same letter, written in different cases. For example, key f can open door F.
Each of the first *n*<=-<=1 rooms contains exactly one key of some type that Vitaly can use to get to next rooms. Once the door is open with some key, Vitaly won't get the key from the keyhole but he will immediately run into the next room. In other words, each key can open no more than one door.
Vitaly realizes that he may end up in some room without the key that opens the door to the next room. Before the start his run for the potato pie Vitaly can buy any number of keys of any type that is guaranteed to get to room *n*.
Given the plan of the house, Vitaly wants to know what is the minimum number of keys he needs to buy to surely get to the room *n*, which has a delicious potato pie. Write a program that will help Vitaly find out this number.
|
The first line of the input contains a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of rooms in the house.
The second line of the input contains string *s* of length 2·*n*<=-<=2. Let's number the elements of the string from left to right, starting from one.
The odd positions in the given string *s* contain lowercase Latin letters — the types of the keys that lie in the corresponding rooms. Thus, each odd position *i* of the given string *s* contains a lowercase Latin letter — the type of the key that lies in room number (*i*<=+<=1)<=/<=2.
The even positions in the given string contain uppercase Latin letters — the types of doors between the rooms. Thus, each even position *i* of the given string *s* contains an uppercase letter — the type of the door that leads from room *i*<=/<=2 to room *i*<=/<=2<=+<=1.
|
Print the only integer — the minimum number of keys that Vitaly needs to buy to surely get from room one to room *n*.
|
[
"3\naAbB\n",
"4\naBaCaB\n",
"5\nxYyXzZaZ\n"
] |
[
"0\n",
"3\n",
"2\n"
] |
none
| 250
|
[
{
"input": "3\naAbB",
"output": "0"
},
{
"input": "4\naBaCaB",
"output": "3"
},
{
"input": "5\nxYyXzZaZ",
"output": "2"
},
{
"input": "26\naAbBcCdDeEfFgGhHiIjJkKlLmMnNoOpPqQrRsStTuUvVwWxXyY",
"output": "0"
},
{
"input": "26\nzAyBxCwDvEuFtGsHrIqJpKoLnMmNlOkPjQiRhSgTfUeVdWcXbY",
"output": "13"
},
{
"input": "5\naArRaRaR",
"output": "2"
},
{
"input": "2\ndA",
"output": "1"
},
{
"input": "2\ncB",
"output": "1"
},
{
"input": "10\nhNcMeXsSlHsUwYeMcA",
"output": "7"
},
{
"input": "100\nqDpInBmCrFwXpDbFgOzVvOcEmJrUcToAdEwEgTvBvBfWwRpGyEaXgDdRwVlQnYgWmWhMrHaIzPyXvGaFlRsVzHhZrOuVpXrKxFzAmWwPlFtNfPtJxVmLuHjKfYyArHrEnSwSzOvDpQhCgCqLlAcNpGhXrEeFuCmAqIkXyYtSsQwIxJzNiIuTgEbVuWrMwPrAlLyKaZ",
"output": "42"
},
{
"input": "2\ndD",
"output": "0"
},
{
"input": "2\ndE",
"output": "1"
},
{
"input": "3\ndDdD",
"output": "0"
},
{
"input": "3\ndEdD",
"output": "1"
},
{
"input": "3\ndEeD",
"output": "1"
},
{
"input": "3\ndEeF",
"output": "2"
}
] | 1,427,418,596
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 46
| 186
| 2,355,200
|
from collections import Counter
n = int(input())
s = input()
nkeys = Counter()
cnt = 0
for i in range(n-1):
nkeys[s[i*2]] += 1
door = s[i*2+1].lower()
if nkeys[door] > 0:
nkeys[door] -= 1
else:
cnt += 1
print(cnt)
|
Title: Vitaliy and Pie
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After a hard day Vitaly got very hungry and he wants to eat his favorite potato pie. But it's not that simple. Vitaly is in the first room of the house with *n* room located in a line and numbered starting from one from left to right. You can go from the first room to the second room, from the second room to the third room and so on — you can go from the (*n*<=-<=1)-th room to the *n*-th room. Thus, you can go to room *x* only from room *x*<=-<=1.
The potato pie is located in the *n*-th room and Vitaly needs to go there.
Each pair of consecutive rooms has a door between them. In order to go to room *x* from room *x*<=-<=1, you need to open the door between the rooms with the corresponding key.
In total the house has several types of doors (represented by uppercase Latin letters) and several types of keys (represented by lowercase Latin letters). The key of type *t* can open the door of type *T* if and only if *t* and *T* are the same letter, written in different cases. For example, key f can open door F.
Each of the first *n*<=-<=1 rooms contains exactly one key of some type that Vitaly can use to get to next rooms. Once the door is open with some key, Vitaly won't get the key from the keyhole but he will immediately run into the next room. In other words, each key can open no more than one door.
Vitaly realizes that he may end up in some room without the key that opens the door to the next room. Before the start his run for the potato pie Vitaly can buy any number of keys of any type that is guaranteed to get to room *n*.
Given the plan of the house, Vitaly wants to know what is the minimum number of keys he needs to buy to surely get to the room *n*, which has a delicious potato pie. Write a program that will help Vitaly find out this number.
Input Specification:
The first line of the input contains a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of rooms in the house.
The second line of the input contains string *s* of length 2·*n*<=-<=2. Let's number the elements of the string from left to right, starting from one.
The odd positions in the given string *s* contain lowercase Latin letters — the types of the keys that lie in the corresponding rooms. Thus, each odd position *i* of the given string *s* contains a lowercase Latin letter — the type of the key that lies in room number (*i*<=+<=1)<=/<=2.
The even positions in the given string contain uppercase Latin letters — the types of doors between the rooms. Thus, each even position *i* of the given string *s* contains an uppercase letter — the type of the door that leads from room *i*<=/<=2 to room *i*<=/<=2<=+<=1.
Output Specification:
Print the only integer — the minimum number of keys that Vitaly needs to buy to surely get from room one to room *n*.
Demo Input:
['3\naAbB\n', '4\naBaCaB\n', '5\nxYyXzZaZ\n']
Demo Output:
['0\n', '3\n', '2\n']
Note:
none
|
```python
from collections import Counter
n = int(input())
s = input()
nkeys = Counter()
cnt = 0
for i in range(n-1):
nkeys[s[i*2]] += 1
door = s[i*2+1].lower()
if nkeys[door] > 0:
nkeys[door] -= 1
else:
cnt += 1
print(cnt)
```
| 3
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,534,951,415
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 40
| 140
| 0
|
n=list(map(str,input()))
x=["h","e","l","l","o"]
k=0
l=False
for i in n:
if i==x[k]:
k+=1
if k==5:
l=True
break
print("YES" if l else "NO")
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
n=list(map(str,input()))
x=["h","e","l","l","o"]
k=0
l=False
for i in n:
if i==x[k]:
k+=1
if k==5:
l=True
break
print("YES" if l else "NO")
```
| 3.93
|
102
|
A
|
Clothes
|
PROGRAMMING
| 1,200
|
[
"brute force"
] |
A. Clothes
|
2
|
256
|
A little boy Gerald entered a clothes shop and found out something very unpleasant: not all clothes turns out to match. For example, Gerald noticed that he looks rather ridiculous in a smoking suit and a baseball cap.
Overall the shop sells *n* clothing items, and exactly *m* pairs of clothing items match. Each item has its price, represented by an integer number of rubles. Gerald wants to buy three clothing items so that they matched each other. Besides, he wants to spend as little money as possible. Find the least possible sum he can spend.
|
The first input file line contains integers *n* and *m* — the total number of clothing items in the shop and the total number of matching pairs of clothing items ().
Next line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=106) — the prices of the clothing items in rubles.
Next *m* lines each contain a pair of space-separated integers *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*,<=*u**i*<=≠<=*v**i*). Each such pair of numbers means that the *u**i*-th and the *v**i*-th clothing items match each other. It is guaranteed that in each pair *u**i* and *v**i* are distinct and all the unordered pairs (*u**i*,<=*v**i*) are different.
|
Print the only number — the least possible sum in rubles that Gerald will have to pay in the shop. If the shop has no three clothing items that would match each other, print "-1" (without the quotes).
|
[
"3 3\n1 2 3\n1 2\n2 3\n3 1\n",
"3 2\n2 3 4\n2 3\n2 1\n",
"4 4\n1 1 1 1\n1 2\n2 3\n3 4\n4 1\n"
] |
[
"6\n",
"-1\n",
"-1\n"
] |
In the first test there only are three pieces of clothing and they all match each other. Thus, there is only one way — to buy the 3 pieces of clothing; in this case he spends 6 roubles.
The second test only has three pieces of clothing as well, yet Gerald can't buy them because the first piece of clothing does not match the third one. Thus, there are no three matching pieces of clothing. The answer is -1.
In the third example there are 4 pieces of clothing, but Gerald can't buy any 3 of them simultaneously. The answer is -1.
| 500
|
[
{
"input": "3 3\n1 2 3\n1 2\n2 3\n3 1",
"output": "6"
},
{
"input": "3 2\n2 3 4\n2 3\n2 1",
"output": "-1"
},
{
"input": "4 4\n1 1 1 1\n1 2\n2 3\n3 4\n4 1",
"output": "-1"
},
{
"input": "4 3\n10 10 5 1\n2 1\n3 1\n3 4",
"output": "-1"
},
{
"input": "4 0\n9 8 2 10",
"output": "-1"
},
{
"input": "4 3\n5 5 9 6\n3 2\n1 4\n3 4",
"output": "-1"
},
{
"input": "4 3\n5 1 10 1\n2 1\n3 2\n1 4",
"output": "-1"
},
{
"input": "4 3\n1 2 8 6\n1 3\n1 4\n3 4",
"output": "15"
},
{
"input": "4 4\n9 3 3 1\n1 2\n3 1\n3 2\n4 3",
"output": "15"
},
{
"input": "4 3\n6 8 10 1\n2 3\n1 4\n3 4",
"output": "-1"
},
{
"input": "4 5\n4 10 3 9\n1 2\n3 1\n3 2\n2 4\n4 3",
"output": "17"
},
{
"input": "4 2\n2 9 8 4\n1 3\n4 2",
"output": "-1"
},
{
"input": "4 3\n5 3 4 4\n2 1\n4 1\n3 4",
"output": "-1"
},
{
"input": "6 6\n39 15 73 82 37 40\n2 1\n5 1\n1 6\n2 6\n6 3\n4 6",
"output": "94"
},
{
"input": "6 7\n85 2 34 6 83 61\n1 2\n2 3\n4 2\n4 3\n1 5\n4 5\n6 3",
"output": "42"
},
{
"input": "6 8\n64 44 5 31 14 16\n1 2\n1 3\n1 4\n2 5\n3 5\n6 1\n6 3\n6 4",
"output": "85"
},
{
"input": "6 8\n36 19 99 8 52 77\n2 1\n3 1\n4 2\n4 3\n1 5\n5 4\n1 6\n6 2",
"output": "132"
},
{
"input": "6 5\n59 69 52 38 93 53\n4 2\n1 5\n6 1\n4 6\n5 6",
"output": "205"
},
{
"input": "6 11\n95 81 74 94 60 69\n3 2\n1 4\n4 2\n3 4\n1 5\n5 2\n5 3\n1 6\n2 6\n3 6\n4 6",
"output": "215"
},
{
"input": "6 8\n69 36 41 23 91 35\n1 2\n3 1\n3 2\n1 4\n3 4\n3 5\n5 4\n4 6",
"output": "133"
},
{
"input": "6 6\n33 76 98 59 4 69\n1 2\n3 2\n5 1\n2 5\n4 5\n6 5",
"output": "113"
},
{
"input": "6 6\n92 56 15 83 30 28\n3 1\n4 1\n2 5\n5 4\n2 6\n6 3",
"output": "-1"
},
{
"input": "6 10\n17 5 55 24 55 74\n1 3\n2 3\n3 4\n5 1\n5 2\n5 3\n4 5\n6 2\n6 3\n6 5",
"output": "115"
},
{
"input": "3 3\n1000000 1000000 1000000\n2 1\n1 3\n3 2",
"output": "3000000"
},
{
"input": "3 0\n1 1 1",
"output": "-1"
},
{
"input": "3 3\n100000 100000 100001\n1 2\n2 3\n3 1",
"output": "300001"
},
{
"input": "3 3\n1 1 999999\n1 2\n2 3\n3 1",
"output": "1000001"
},
{
"input": "3 3\n999999 1 1\n1 2\n2 3\n3 1",
"output": "1000001"
},
{
"input": "3 3\n1000000 1000000 1000000\n1 2\n2 3\n1 3",
"output": "3000000"
}
] | 1,644,136,474
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 32
| 560
| 7,372,800
|
import math
import sys
import queue
import itertools
from heapq import heappop, heappush
import random
def solve():
n, m = map(int, input().split())
a = list(map(int, input().split()))
f = [[0 for i in range(n)] for j in range(n)]
for i in range(m):
c, b = map(int, input().split())
f[c - 1][b - 1] = 1
f[b - 1][c - 1] = 1
min_cost = 1 << 60
for i in range(n):
for j in range(n):
for k in range(n):
if len(set([i, j, k])) == 3:
if f[i][j] == 1 and f[i][k] == 1 and f[j][k] == 1:
cost = a[i] + a[j] + a[k]
if cost < min_cost:
min_cost = cost
if min_cost != 1 << 60:
print(min_cost)
else:
print(-1)
if __name__ == '__main__':
multi_test = 0
if multi_test:
t = int(sys.stdin.readline())
for _ in range(t):
solve()
else:
solve()
|
Title: Clothes
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A little boy Gerald entered a clothes shop and found out something very unpleasant: not all clothes turns out to match. For example, Gerald noticed that he looks rather ridiculous in a smoking suit and a baseball cap.
Overall the shop sells *n* clothing items, and exactly *m* pairs of clothing items match. Each item has its price, represented by an integer number of rubles. Gerald wants to buy three clothing items so that they matched each other. Besides, he wants to spend as little money as possible. Find the least possible sum he can spend.
Input Specification:
The first input file line contains integers *n* and *m* — the total number of clothing items in the shop and the total number of matching pairs of clothing items ().
Next line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=106) — the prices of the clothing items in rubles.
Next *m* lines each contain a pair of space-separated integers *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*,<=*u**i*<=≠<=*v**i*). Each such pair of numbers means that the *u**i*-th and the *v**i*-th clothing items match each other. It is guaranteed that in each pair *u**i* and *v**i* are distinct and all the unordered pairs (*u**i*,<=*v**i*) are different.
Output Specification:
Print the only number — the least possible sum in rubles that Gerald will have to pay in the shop. If the shop has no three clothing items that would match each other, print "-1" (without the quotes).
Demo Input:
['3 3\n1 2 3\n1 2\n2 3\n3 1\n', '3 2\n2 3 4\n2 3\n2 1\n', '4 4\n1 1 1 1\n1 2\n2 3\n3 4\n4 1\n']
Demo Output:
['6\n', '-1\n', '-1\n']
Note:
In the first test there only are three pieces of clothing and they all match each other. Thus, there is only one way — to buy the 3 pieces of clothing; in this case he spends 6 roubles.
The second test only has three pieces of clothing as well, yet Gerald can't buy them because the first piece of clothing does not match the third one. Thus, there are no three matching pieces of clothing. The answer is -1.
In the third example there are 4 pieces of clothing, but Gerald can't buy any 3 of them simultaneously. The answer is -1.
|
```python
import math
import sys
import queue
import itertools
from heapq import heappop, heappush
import random
def solve():
n, m = map(int, input().split())
a = list(map(int, input().split()))
f = [[0 for i in range(n)] for j in range(n)]
for i in range(m):
c, b = map(int, input().split())
f[c - 1][b - 1] = 1
f[b - 1][c - 1] = 1
min_cost = 1 << 60
for i in range(n):
for j in range(n):
for k in range(n):
if len(set([i, j, k])) == 3:
if f[i][j] == 1 and f[i][k] == 1 and f[j][k] == 1:
cost = a[i] + a[j] + a[k]
if cost < min_cost:
min_cost = cost
if min_cost != 1 << 60:
print(min_cost)
else:
print(-1)
if __name__ == '__main__':
multi_test = 0
if multi_test:
t = int(sys.stdin.readline())
for _ in range(t):
solve()
else:
solve()
```
| 3.846267
|
443
|
A
|
Anton and Letters
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
Recently, Anton has found a set. The set consists of small English letters. Anton carefully wrote out all the letters from the set in one line, separated by a comma. He also added an opening curved bracket at the beginning of the line and a closing curved bracket at the end of the line.
Unfortunately, from time to time Anton would forget writing some letter and write it again. He asks you to count the total number of distinct letters in his set.
|
The first and the single line contains the set of letters. The length of the line doesn't exceed 1000. It is guaranteed that the line starts from an opening curved bracket and ends with a closing curved bracket. Between them, small English letters are listed, separated by a comma. Each comma is followed by a space.
|
Print a single number — the number of distinct letters in Anton's set.
|
[
"{a, b, c}\n",
"{b, a, b, a}\n",
"{}\n"
] |
[
"3\n",
"2\n",
"0\n"
] |
none
| 500
|
[
{
"input": "{a, b, c}",
"output": "3"
},
{
"input": "{b, a, b, a}",
"output": "2"
},
{
"input": "{}",
"output": "0"
},
{
"input": "{a, a, c, b, b, b, c, c, c, c}",
"output": "3"
},
{
"input": "{a, c, b, b}",
"output": "3"
},
{
"input": "{a, b}",
"output": "2"
},
{
"input": "{a}",
"output": "1"
},
{
"input": "{b, a, b, a, b, c, c, b, c, b}",
"output": "3"
},
{
"input": "{e, g, c, e}",
"output": "3"
},
{
"input": "{a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a}",
"output": "1"
},
{
"input": "{a, a, b}",
"output": "2"
},
{
"input": "{a, b, b, b, a, b, a, a, a, a, a, a, b, a, b, a, a, a, a, a, b, a, b, a}",
"output": "2"
},
{
"input": "{j, u, a, c, f, w, e, w, x, t, h, p, v, n, i, l, x, n, i, b, u, c, a, a}",
"output": "16"
},
{
"input": "{x, i, w, c, p, e, h, z, k, i}",
"output": "9"
},
{
"input": "{t, k, o, x, r, d, q, j, k, e, z, w, y, r, z, s, s, e, s, b, k, i}",
"output": "15"
},
{
"input": "{y}",
"output": "1"
},
{
"input": "{x}",
"output": "1"
},
{
"input": "{b, z, a, z}",
"output": "3"
},
{
"input": "{z}",
"output": "1"
},
{
"input": "{a, z}",
"output": "2"
},
{
"input": "{a, b, z}",
"output": "3"
},
{
"input": "{s, q, z, r, t, a, b, h, j, i, o, z, r, q}",
"output": "11"
}
] | 1,685,935,274
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 27
| 46
| 307,200
|
import sys
import math
import datetime
def main():
#n,k = map(int, input().split())
#a = [int(x) for x in sys.stdin.readline().split()]
#t = int(input())
t = input()
my_set = set()
for x in t:
if x!=',' and x!='{' and x!='}' and x!=' ':
my_set.add(x)
print(len(my_set))
main()
|
Title: Anton and Letters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, Anton has found a set. The set consists of small English letters. Anton carefully wrote out all the letters from the set in one line, separated by a comma. He also added an opening curved bracket at the beginning of the line and a closing curved bracket at the end of the line.
Unfortunately, from time to time Anton would forget writing some letter and write it again. He asks you to count the total number of distinct letters in his set.
Input Specification:
The first and the single line contains the set of letters. The length of the line doesn't exceed 1000. It is guaranteed that the line starts from an opening curved bracket and ends with a closing curved bracket. Between them, small English letters are listed, separated by a comma. Each comma is followed by a space.
Output Specification:
Print a single number — the number of distinct letters in Anton's set.
Demo Input:
['{a, b, c}\n', '{b, a, b, a}\n', '{}\n']
Demo Output:
['3\n', '2\n', '0\n']
Note:
none
|
```python
import sys
import math
import datetime
def main():
#n,k = map(int, input().split())
#a = [int(x) for x in sys.stdin.readline().split()]
#t = int(input())
t = input()
my_set = set()
for x in t:
if x!=',' and x!='{' and x!='}' and x!=' ':
my_set.add(x)
print(len(my_set))
main()
```
| 3
|
|
867
|
A
|
Between the Offices
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
|
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
|
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower).
|
[
"4\nFSSF\n",
"2\nSF\n",
"10\nFFFFFFFFFF\n",
"10\nSSFFSFFSFF\n"
] |
[
"NO\n",
"YES\n",
"NO\n",
"YES\n"
] |
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though.
| 500
|
[
{
"input": "4\nFSSF",
"output": "NO"
},
{
"input": "2\nSF",
"output": "YES"
},
{
"input": "10\nFFFFFFFFFF",
"output": "NO"
},
{
"input": "10\nSSFFSFFSFF",
"output": "YES"
},
{
"input": "20\nSFSFFFFSSFFFFSSSSFSS",
"output": "NO"
},
{
"input": "20\nSSFFFFFSFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "20\nSSFSFSFSFSFSFSFSSFSF",
"output": "YES"
},
{
"input": "20\nSSSSFSFSSFSFSSSSSSFS",
"output": "NO"
},
{
"input": "100\nFFFSFSFSFSSFSFFSSFFFFFSSSSFSSFFFFSFFFFFSFFFSSFSSSFFFFSSFFSSFSFFSSFSSSFSFFSFSFFSFSFFSSFFSFSSSSFSFSFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFSFFFFFFFFFSFSSFFFFFFFFFFFFFFFFFFFFFFSFFSFFFFFSFFFFFFFFSFFFFFFFFFFFFFSFFFFFFFFSFFFFFFFSF",
"output": "NO"
},
{
"input": "100\nSFFSSFFFFFFSSFFFSSFSFFFFFSSFFFSFFFFFFSFSSSFSFSFFFFSFSSFFFFFFFFSFFFFFSFFFFFSSFFFSFFSFSFFFFSFFSFFFFFFF",
"output": "YES"
},
{
"input": "100\nFFFFSSSSSFFSSSFFFSFFFFFSFSSFSFFSFFSSFFSSFSFFFFFSFSFSFSFFFFFFFFFSFSFFSFFFFSFSFFFFFFFFFFFFSFSSFFSSSSFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFSSFFFFSFSFFFSFSSSFSSSSSFSSSSFFSSFFFSFSFSSFFFSSSFFSFSFSSFSFSSFSFFFSFFFFFSSFSFFFSSSFSSSFFS",
"output": "NO"
},
{
"input": "100\nFFFSSSFSFSSSSFSSFSFFSSSFFSSFSSFFSSFFSFSSSSFFFSFFFSFSFSSSFSSFSFSFSFFSSSSSFSSSFSFSFFSSFSFSSFFSSFSFFSFS",
"output": "NO"
},
{
"input": "100\nFFSSSSFSSSFSSSSFSSSFFSFSSFFSSFSSSFSSSFFSFFSSSSSSSSSSSSFSSFSSSSFSFFFSSFFFFFFSFSFSSSSSSFSSSFSFSSFSSFSS",
"output": "NO"
},
{
"input": "100\nSSSFFFSSSSFFSSSSSFSSSSFSSSFSSSSSFSSSSSSSSFSFFSSSFFSSFSSSSFFSSSSSSFFSSSSFSSSSSSFSSSFSSSSSSSFSSSSFSSSS",
"output": "NO"
},
{
"input": "100\nFSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSSSSSSFSSSSSSSSSSSSSFSSFSSSSSFSSFSSSSSSSSSFFSSSSSFSFSSSFFSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSFSSSSSSSSSSSSFSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSFS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFSFFFFFFFFFFFSFSFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFSSFFFFSFFFFFFFFFFFFFFFFFFFSFFFSSFFFFSFSFFFSFFFFFFFFFFFFFFFSSFFFFFFFFSSFFFFFFFFFFFFFFSFF",
"output": "YES"
},
{
"input": "100\nSFFSSSFFSFSFSFFFFSSFFFFSFFFFFFFFSFSFFFSFFFSFFFSFFFFSFSFFFFFFFSFFFFFFFFFFSFFSSSFFSSFFFFSFFFFSFFFFSFFF",
"output": "YES"
},
{
"input": "100\nSFFFSFFFFSFFFSSFFFSFSFFFSFFFSSFSFFFFFSFFFFFFFFSFSFSFFSFFFSFSSFSFFFSFSFFSSFSFSSSFFFFFFSSFSFFSFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSSSSFFFFSFFFFFFFSFFFFSFSFFFFSSFFFFFFFFFSFFSSFFFFFFSFSFSSFSSSFFFFFFFSFSFFFSSSFFFFFFFSFFFSSFFFFSSFFFSF",
"output": "YES"
},
{
"input": "100\nSSSFSSFFFSFSSSSFSSFSSSSFSSFFFFFSFFSSSSFFSSSFSSSFSSSSFSSSSFSSSSSSSFSFSSFFFSSFFSFFSSSSFSSFFSFSSFSFFFSF",
"output": "YES"
},
{
"input": "100\nSFFSFSSSSSSSFFSSSFSSSSFSFSSFFFSSSSSSFSSSSFSSFSSSFSSSSSSSFSSFSFFFSSFSSFSFSFSSSSSSSSSSSSFFFFSSSSSFSFFF",
"output": "YES"
},
{
"input": "100\nSSSFSFFSFSFFSSSSSFSSSFSSSFFFSSSSSSSSSFSFSFSSSSFSFSSFFFFFSSSSSSSSSSSSSSSSSSSFFSSSSSFSFSSSSFFSSSSFSSSF",
"output": "YES"
},
{
"input": "100\nSSSFSSSSSSSSSSFSSSSFSSSSSSFSSSSSSFSSSSSSSSSSSSSSFSSSFSSSFSSSSSSSSSSSFSSSSSSFSFSSSSFSSSSSSFSSSSSSSSFF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFFSSSSSSSSSFSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "2\nSS",
"output": "NO"
}
] | 1,625,837,564
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 77
| 0
|
n = int(input())
string = input()
if string[0]=='S' and string[n-1]=='F':
print("YES")
else:
print("NO")
|
Title: Between the Offices
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
Input Specification:
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
Output Specification:
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower).
Demo Input:
['4\nFSSF\n', '2\nSF\n', '10\nFFFFFFFFFF\n', '10\nSSFFSFFSFF\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n', 'YES\n']
Note:
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though.
|
```python
n = int(input())
string = input()
if string[0]=='S' and string[n-1]=='F':
print("YES")
else:
print("NO")
```
| 3
|
|
47
|
B
|
Coins
|
PROGRAMMING
| 1,200
|
[
"implementation"
] |
B. Coins
|
2
|
256
|
One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal.
|
The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters «A», «B» and «C». Each result is a line that appears as (letter)(> or < sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A<B.
|
It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters «A», «B» and «C» which represent the coins in the increasing order of their weights.
|
[
"A>B\nC<B\nA>C\n",
"A<B\nB>C\nC>A\n"
] |
[
"CBA",
"ACB"
] |
none
| 1,000
|
[
{
"input": "A>B\nC<B\nA>C",
"output": "CBA"
},
{
"input": "A<B\nB>C\nC>A",
"output": "ACB"
},
{
"input": "A<C\nB<A\nB>C",
"output": "Impossible"
},
{
"input": "A<B\nA<C\nB>C",
"output": "ACB"
},
{
"input": "B>A\nC<B\nC>A",
"output": "ACB"
},
{
"input": "A>B\nB>C\nC<A",
"output": "CBA"
},
{
"input": "A>C\nA>B\nB<C",
"output": "BCA"
},
{
"input": "C<B\nB>A\nA<C",
"output": "ACB"
},
{
"input": "C<B\nA>B\nC<A",
"output": "CBA"
},
{
"input": "C>B\nB>A\nA<C",
"output": "ABC"
},
{
"input": "C<B\nB<A\nC>A",
"output": "Impossible"
},
{
"input": "B<C\nC<A\nA>B",
"output": "BCA"
},
{
"input": "A>B\nC<B\nC<A",
"output": "CBA"
},
{
"input": "B>A\nC>B\nA>C",
"output": "Impossible"
},
{
"input": "B<A\nC>B\nC>A",
"output": "BAC"
},
{
"input": "A<B\nC>B\nA<C",
"output": "ABC"
},
{
"input": "A<B\nC<A\nB<C",
"output": "Impossible"
},
{
"input": "A>C\nC<B\nB>A",
"output": "CAB"
},
{
"input": "C>A\nA<B\nB>C",
"output": "ACB"
},
{
"input": "C>A\nC<B\nB>A",
"output": "ACB"
},
{
"input": "B>C\nB>A\nA<C",
"output": "ACB"
},
{
"input": "C<B\nC<A\nB<A",
"output": "CBA"
},
{
"input": "A<C\nA<B\nB>C",
"output": "ACB"
},
{
"input": "B>A\nA>C\nB>C",
"output": "CAB"
},
{
"input": "B<A\nA<C\nC<B",
"output": "Impossible"
},
{
"input": "A<C\nB>C\nA>B",
"output": "Impossible"
},
{
"input": "B>A\nC<A\nC>B",
"output": "Impossible"
},
{
"input": "A>C\nC>B\nB<A",
"output": "BCA"
},
{
"input": "B<C\nB<A\nA>C",
"output": "BCA"
},
{
"input": "A>B\nC>B\nA<C",
"output": "BAC"
},
{
"input": "C<B\nC<A\nB<A",
"output": "CBA"
},
{
"input": "A<C\nA>B\nB>C",
"output": "Impossible"
},
{
"input": "B>A\nB>C\nA<C",
"output": "ACB"
},
{
"input": "B>C\nC<A\nB<A",
"output": "CBA"
},
{
"input": "C>A\nB>A\nB>C",
"output": "ACB"
},
{
"input": "B<A\nB>C\nA<C",
"output": "Impossible"
},
{
"input": "B<C\nA<B\nC>A",
"output": "ABC"
},
{
"input": "C<B\nB>A\nA>C",
"output": "CAB"
},
{
"input": "A>B\nC>A\nB<C",
"output": "BAC"
},
{
"input": "A>B\nB>C\nC<A",
"output": "CBA"
},
{
"input": "B>C\nC>A\nA>B",
"output": "Impossible"
},
{
"input": "B<A\nB>C\nC<A",
"output": "CBA"
},
{
"input": "C>B\nB>A\nC>A",
"output": "ABC"
},
{
"input": "A>C\nA>B\nB>C",
"output": "CBA"
},
{
"input": "B<C\nA>B\nA<C",
"output": "BAC"
},
{
"input": "C>A\nC<B\nB>A",
"output": "ACB"
},
{
"input": "C>B\nA<B\nC<A",
"output": "Impossible"
},
{
"input": "A<C\nC<B\nA>B",
"output": "Impossible"
},
{
"input": "B>C\nA<B\nA<C",
"output": "ACB"
},
{
"input": "C>A\nA<B\nC>B",
"output": "ABC"
}
] | 1,610,982,708
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 50
| 124
| 0
|
d = dict(zip('ABC', [0]*3))
for i in range(3):
x, w, y = input()
if w == '>':
x = y
d[x] -= 1
print('Impossible' if max(d.values()) < 0 else ''.join(sorted(d, key=d.get)))
|
Title: Coins
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal.
Input Specification:
The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters «A», «B» and «C». Each result is a line that appears as (letter)(> or < sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A<B.
Output Specification:
It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters «A», «B» and «C» which represent the coins in the increasing order of their weights.
Demo Input:
['A>B\nC<B\nA>C\n', 'A<B\nB>C\nC>A\n']
Demo Output:
['CBA', 'ACB']
Note:
none
|
```python
d = dict(zip('ABC', [0]*3))
for i in range(3):
x, w, y = input()
if w == '>':
x = y
d[x] -= 1
print('Impossible' if max(d.values()) < 0 else ''.join(sorted(d, key=d.get)))
```
| 3.969
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Petya got interested in grammar on his third year in school. He invented his own language called Petya's. Petya wanted to create a maximally simple language that would be enough to chat with friends, that's why all the language's grammar can be described with the following set of rules:
- There are three parts of speech: the adjective, the noun, the verb. Each word in his language is an adjective, noun or verb. - There are two genders: masculine and feminine. Each word in his language has gender either masculine or feminine. - Masculine adjectives end with -lios, and feminine adjectives end with -liala. - Masculine nouns end with -etr, and feminime nouns end with -etra. - Masculine verbs end with -initis, and feminime verbs end with -inites. - Thus, each word in the Petya's language has one of the six endings, given above. There are no other endings in Petya's language. - It is accepted that the whole word consists of an ending. That is, words "lios", "liala", "etr" and so on belong to the Petya's language. - There aren't any punctuation marks, grammatical tenses, singular/plural forms or other language complications. - A sentence is either exactly one valid language word or exactly one statement.
Statement is any sequence of the Petya's language, that satisfy both conditions:
- Words in statement follow in the following order (from the left to the right): zero or more adjectives followed by exactly one noun followed by zero or more verbs. - All words in the statement should have the same gender.
After Petya's friend Vasya wrote instant messenger (an instant messaging program) that supported the Petya's language, Petya wanted to add spelling and grammar checking to the program. As Vasya was in the country and Petya didn't feel like waiting, he asked you to help him with this problem. Your task is to define by a given sequence of words, whether it is true that the given text represents exactly one sentence in Petya's language.
|
The first line contains one or more words consisting of lowercase Latin letters. The overall number of characters (including letters and spaces) does not exceed 105.
It is guaranteed that any two consecutive words are separated by exactly one space and the input data do not contain any other spaces. It is possible that given words do not belong to the Petya's language.
|
If some word of the given text does not belong to the Petya's language or if the text contains more that one sentence, print "NO" (without the quotes). Otherwise, print "YES" (without the quotes).
|
[
"petr\n",
"etis atis animatis etis atis amatis\n",
"nataliala kataliala vetra feinites\n"
] |
[
"YES\n",
"NO\n",
"YES\n"
] |
none
| 0
|
[
{
"input": "petr",
"output": "YES"
},
{
"input": "etis atis animatis etis atis amatis",
"output": "NO"
},
{
"input": "nataliala kataliala vetra feinites",
"output": "YES"
},
{
"input": "qweasbvflios",
"output": "YES"
},
{
"input": "lios lios petr initis qwe",
"output": "NO"
},
{
"input": "lios initis",
"output": "NO"
},
{
"input": "petr initis lios",
"output": "NO"
},
{
"input": "petra petra petra",
"output": "NO"
},
{
"input": "in",
"output": "NO"
},
{
"input": "liala petra initis",
"output": "NO"
},
{
"input": "liala petra inites",
"output": "YES"
},
{
"input": "liala initis",
"output": "NO"
},
{
"input": "liala petra petr inites",
"output": "NO"
},
{
"input": "liala petr inites",
"output": "NO"
},
{
"input": "llilitos",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzentsphxqhdungbylhnikwviuhccbstghhxlmvcjznnkjqkugsdysjbedwpmsmxmgxlrlxctnebtbwrsvgjktkrosffwymovxvsgfmmqwfflpvbumozikroxrdgwjrnstngstxbiyyuxehrhviteptedlmyetr",
"output": "YES"
},
{
"input": "i i i i i i i i i i i i i i i a a a a a a v v v v v v v v v v v",
"output": "NO"
},
{
"input": "fbvzqonvdlqdanwliolaqfj sbauorbinites xkbfnfinitespjy phbexglblzpobtqpisyijycmtliola aosinites lbpjiwcjoqyuhglthloiniteswb mjtxhoofohzzgefvhsywojcuxtetxmojrlktodhbgyrkeejgjzxkzyvrxwmyaqkeoqnvusnlrsfffrzeoqjdfumolhksqkrtzwhnforgpenziokrxlnhcapbbupctlmuetrani pigxerwetupjbkvlmgnjhdfjliolanz tqhaidxbqmdaeincxjuliola",
"output": "NO"
},
{
"input": "mfrmqetr",
"output": "YES"
},
{
"input": "hnwvfllholxfialiola cknjtxpliola daliola gqfapnhmmworliola qhetra qrisbexsrefcwzoxqwxrevinites wwldqkqhvrgwplqinites nqdpoauitczttxoinites fgbmdfpxkhahkinites",
"output": "NO"
},
{
"input": "kcymcpgqdxkudadewddualeemhixhsdazudnjdmuvxvrlrbrpsdpxpagmrogplltnifrtomdtahxwadguvetxaqkvsvnoyhowirnluhmyewzapirnpfdisvhtbenxmfezahqoflkjrfqjubwdfktnpeirodwubftzlcczzavfiooihzvnqincndisudihvbcaxptrwovekmhiiwsgzgbxydvuldlnktxtltrlajjzietkxbnhetra",
"output": "YES"
},
{
"input": "dosiydnwxemojaavfdvlwsyhzqywqjutovygtlcleklhybczhjqfzxwdmlwqwcqqyfjkzhsizlmdarrfronxqkcknwpkvhdlgatdyjisjoopvngpjggldxjfxaauoxmqirkuphydyweoixftstlozaoywnxgriscudwlokncbmaebpssccmmmfjennyjaryqlzjknnklqketra",
"output": "YES"
},
{
"input": "etretra linites",
"output": "YES"
},
{
"input": "petretra petr",
"output": "NO"
},
{
"input": "lialalios petraveryfunnypetr",
"output": "YES"
},
{
"input": "petropetrapetr petra",
"output": "NO"
},
{
"input": "lios petrnonono",
"output": "NO"
},
{
"input": "lios petr initisandinitisandliala petrainitis",
"output": "NO"
},
{
"input": "petro",
"output": "NO"
},
{
"input": "petr initesinitis",
"output": "YES"
},
{
"input": "lios initis",
"output": "NO"
},
{
"input": "liala initespetra",
"output": "YES"
},
{
"input": "lios petrapetr",
"output": "YES"
},
{
"input": "initis petr",
"output": "NO"
},
{
"input": "lioslialapetrpetrainitisinitesliosliala initesinitislioslialapetrpetrainitisinitetra",
"output": "YES"
},
{
"input": "veryfunnyprefixpetr",
"output": "YES"
},
{
"input": "veryfunnyprefixpetra",
"output": "YES"
},
{
"input": "veryfunnyprefixinitis",
"output": "YES"
},
{
"input": "veryfunnyprefixinites",
"output": "YES"
},
{
"input": "veryfunnyprefixliala",
"output": "YES"
},
{
"input": "veryfunnyprefixlios",
"output": "YES"
},
{
"input": "veryfunnyprefixlialas",
"output": "NO"
},
{
"input": "veryfunnyprefixliala veryfunnyprefixpetretra",
"output": "YES"
},
{
"input": "veryfunnyprefixlios veryfunnyprefixinitisetr",
"output": "YES"
},
{
"input": "veryfunnyprefixlios aabbinitis",
"output": "NO"
},
{
"input": "veryfunnyprefixlios inites",
"output": "NO"
},
{
"input": "lios petr initis",
"output": "YES"
},
{
"input": "liala etra inites",
"output": "YES"
},
{
"input": "lios",
"output": "YES"
},
{
"input": "liala",
"output": "YES"
},
{
"input": "initis",
"output": "YES"
},
{
"input": "inites",
"output": "YES"
},
{
"input": "tes",
"output": "NO"
},
{
"input": "tr",
"output": "NO"
},
{
"input": "a",
"output": "NO"
},
{
"input": "lios lios",
"output": "NO"
},
{
"input": "lios",
"output": "YES"
},
{
"input": "liala",
"output": "YES"
},
{
"input": "petr",
"output": "YES"
},
{
"input": "petra",
"output": "YES"
},
{
"input": "pinitis",
"output": "YES"
},
{
"input": "pinites",
"output": "YES"
},
{
"input": "plios pliala",
"output": "NO"
},
{
"input": "plios petr",
"output": "YES"
},
{
"input": "plios petra",
"output": "NO"
},
{
"input": "plios plios",
"output": "NO"
},
{
"input": "plios initis",
"output": "NO"
},
{
"input": "plios pinites",
"output": "NO"
},
{
"input": "pliala plios",
"output": "NO"
},
{
"input": "pliala ppliala",
"output": "NO"
},
{
"input": "pliala petr",
"output": "NO"
},
{
"input": "pliala petra",
"output": "YES"
},
{
"input": "pliala pinitis",
"output": "NO"
},
{
"input": "pliala pinites",
"output": "NO"
},
{
"input": "petr plios",
"output": "NO"
},
{
"input": "petr pliala",
"output": "NO"
},
{
"input": "petr petr",
"output": "NO"
},
{
"input": "petr petra",
"output": "NO"
},
{
"input": "petr pinitis",
"output": "YES"
},
{
"input": "petr pinites",
"output": "NO"
},
{
"input": "petra lios",
"output": "NO"
},
{
"input": "petra liala",
"output": "NO"
},
{
"input": "petra petr",
"output": "NO"
},
{
"input": "petra petra",
"output": "NO"
},
{
"input": "petra initis",
"output": "NO"
},
{
"input": "petra inites",
"output": "YES"
},
{
"input": "initis lios",
"output": "NO"
},
{
"input": "initis liala",
"output": "NO"
},
{
"input": "initis petr",
"output": "NO"
},
{
"input": "initis petra",
"output": "NO"
},
{
"input": "initis initis",
"output": "NO"
},
{
"input": "initis inites",
"output": "NO"
},
{
"input": "inites lios",
"output": "NO"
},
{
"input": "inites liala",
"output": "NO"
},
{
"input": "inites petr",
"output": "NO"
},
{
"input": "inites petra",
"output": "NO"
},
{
"input": "inites initis",
"output": "NO"
},
{
"input": "inites inites",
"output": "NO"
},
{
"input": "lios lios lios",
"output": "NO"
},
{
"input": "lios lios liala",
"output": "NO"
},
{
"input": "lios lios etr",
"output": "YES"
},
{
"input": "lios lios etra",
"output": "NO"
},
{
"input": "lios lios initis",
"output": "NO"
},
{
"input": "lios lios inites",
"output": "NO"
},
{
"input": "lios liala lios",
"output": "NO"
},
{
"input": "lios liala liala",
"output": "NO"
},
{
"input": "lios liala etr",
"output": "NO"
},
{
"input": "lios liala etra",
"output": "NO"
},
{
"input": "lios liala initis",
"output": "NO"
},
{
"input": "lios liala inites",
"output": "NO"
},
{
"input": "lios etr lios",
"output": "NO"
},
{
"input": "lios etr liala",
"output": "NO"
},
{
"input": "lios etr etr",
"output": "NO"
},
{
"input": "lios etr etra",
"output": "NO"
},
{
"input": "lios etr initis",
"output": "YES"
},
{
"input": "lios etr inites",
"output": "NO"
},
{
"input": "lios etra lios",
"output": "NO"
},
{
"input": "lios etra liala",
"output": "NO"
},
{
"input": "lios etra etr",
"output": "NO"
},
{
"input": "lios etra etra",
"output": "NO"
},
{
"input": "lios etra initis",
"output": "NO"
},
{
"input": "lios etra inites",
"output": "NO"
},
{
"input": "lios initis lios",
"output": "NO"
},
{
"input": "lios initis liala",
"output": "NO"
},
{
"input": "lios initis etr",
"output": "NO"
},
{
"input": "lios initis etra",
"output": "NO"
},
{
"input": "lios initis initis",
"output": "NO"
},
{
"input": "lios initis inites",
"output": "NO"
},
{
"input": "lios inites lios",
"output": "NO"
},
{
"input": "lios inites liala",
"output": "NO"
},
{
"input": "lios inites etr",
"output": "NO"
},
{
"input": "lios inites etra",
"output": "NO"
},
{
"input": "lios inites initis",
"output": "NO"
},
{
"input": "lios inites inites",
"output": "NO"
},
{
"input": "liala lios lios",
"output": "NO"
},
{
"input": "liala lios liala",
"output": "NO"
},
{
"input": "liala lios etr",
"output": "NO"
},
{
"input": "liala lios etra",
"output": "NO"
},
{
"input": "liala lios initis",
"output": "NO"
},
{
"input": "liala lios inites",
"output": "NO"
},
{
"input": "liala liala lios",
"output": "NO"
},
{
"input": "liala liala liala",
"output": "NO"
},
{
"input": "liala liala etr",
"output": "NO"
},
{
"input": "liala liala etra",
"output": "YES"
},
{
"input": "liala liala initis",
"output": "NO"
},
{
"input": "liala liala inites",
"output": "NO"
},
{
"input": "liala etr lios",
"output": "NO"
},
{
"input": "liala etr liala",
"output": "NO"
},
{
"input": "liala etr etr",
"output": "NO"
},
{
"input": "liala etr etra",
"output": "NO"
},
{
"input": "liala etr initis",
"output": "NO"
},
{
"input": "liala etr inites",
"output": "NO"
},
{
"input": "liala etra lios",
"output": "NO"
},
{
"input": "liala etra liala",
"output": "NO"
},
{
"input": "liala etra etr",
"output": "NO"
},
{
"input": "liala etra etra",
"output": "NO"
},
{
"input": "liala etra initis",
"output": "NO"
},
{
"input": "liala etra inites",
"output": "YES"
},
{
"input": "liala initis lios",
"output": "NO"
},
{
"input": "liala initis liala",
"output": "NO"
},
{
"input": "liala initis etr",
"output": "NO"
},
{
"input": "liala initis etra",
"output": "NO"
},
{
"input": "liala initis initis",
"output": "NO"
},
{
"input": "liala initis inites",
"output": "NO"
},
{
"input": "liala inites lios",
"output": "NO"
},
{
"input": "liala inites liala",
"output": "NO"
},
{
"input": "liala inites etr",
"output": "NO"
},
{
"input": "liala inites etra",
"output": "NO"
},
{
"input": "liala inites initis",
"output": "NO"
},
{
"input": "liala inites inites",
"output": "NO"
},
{
"input": "etr lios lios",
"output": "NO"
},
{
"input": "etr lios liala",
"output": "NO"
},
{
"input": "etr lios etr",
"output": "NO"
},
{
"input": "etr lios etra",
"output": "NO"
},
{
"input": "etr lios initis",
"output": "NO"
},
{
"input": "etr lios inites",
"output": "NO"
},
{
"input": "etr liala lios",
"output": "NO"
},
{
"input": "etr liala liala",
"output": "NO"
},
{
"input": "etr liala etr",
"output": "NO"
},
{
"input": "etr liala etra",
"output": "NO"
},
{
"input": "etr liala initis",
"output": "NO"
},
{
"input": "etr liala inites",
"output": "NO"
},
{
"input": "etr etr lios",
"output": "NO"
},
{
"input": "etr etr liala",
"output": "NO"
},
{
"input": "etr etr etr",
"output": "NO"
},
{
"input": "etr etr etra",
"output": "NO"
},
{
"input": "etr etr initis",
"output": "NO"
},
{
"input": "etr etr inites",
"output": "NO"
},
{
"input": "etr etra lios",
"output": "NO"
},
{
"input": "etr etra liala",
"output": "NO"
},
{
"input": "etr etra etr",
"output": "NO"
},
{
"input": "etr etra etra",
"output": "NO"
},
{
"input": "etr etra initis",
"output": "NO"
},
{
"input": "etr etra inites",
"output": "NO"
},
{
"input": "etr initis lios",
"output": "NO"
},
{
"input": "etr initis liala",
"output": "NO"
},
{
"input": "etr initis etr",
"output": "NO"
},
{
"input": "etr initis etra",
"output": "NO"
},
{
"input": "etr initis initis",
"output": "YES"
},
{
"input": "etr initis inites",
"output": "NO"
},
{
"input": "etr inites lios",
"output": "NO"
},
{
"input": "etr inites liala",
"output": "NO"
},
{
"input": "etr inites etr",
"output": "NO"
},
{
"input": "etr inites etra",
"output": "NO"
},
{
"input": "etr inites initis",
"output": "NO"
},
{
"input": "etr inites inites",
"output": "NO"
},
{
"input": "etra lios lios",
"output": "NO"
},
{
"input": "etra lios liala",
"output": "NO"
},
{
"input": "etra lios etr",
"output": "NO"
},
{
"input": "etra lios etra",
"output": "NO"
},
{
"input": "etra lios initis",
"output": "NO"
},
{
"input": "etra lios inites",
"output": "NO"
},
{
"input": "etra liala lios",
"output": "NO"
},
{
"input": "etra liala liala",
"output": "NO"
},
{
"input": "etra liala etr",
"output": "NO"
},
{
"input": "etra liala etra",
"output": "NO"
},
{
"input": "etra liala initis",
"output": "NO"
},
{
"input": "etra liala inites",
"output": "NO"
},
{
"input": "etra etr lios",
"output": "NO"
},
{
"input": "etra etr liala",
"output": "NO"
},
{
"input": "etra etr etr",
"output": "NO"
},
{
"input": "etra etr etra",
"output": "NO"
},
{
"input": "etra etr initis",
"output": "NO"
},
{
"input": "etra etr inites",
"output": "NO"
},
{
"input": "etra etra lios",
"output": "NO"
},
{
"input": "etra etra liala",
"output": "NO"
},
{
"input": "etra etra etr",
"output": "NO"
},
{
"input": "etra etra etra",
"output": "NO"
},
{
"input": "etra etra initis",
"output": "NO"
},
{
"input": "etra etra inites",
"output": "NO"
},
{
"input": "etra initis lios",
"output": "NO"
},
{
"input": "etra initis liala",
"output": "NO"
},
{
"input": "etra initis etr",
"output": "NO"
},
{
"input": "etra initis etra",
"output": "NO"
},
{
"input": "etra initis initis",
"output": "NO"
},
{
"input": "etra initis inites",
"output": "NO"
},
{
"input": "etra inites lios",
"output": "NO"
},
{
"input": "etra inites liala",
"output": "NO"
},
{
"input": "etra inites etr",
"output": "NO"
},
{
"input": "etra inites etra",
"output": "NO"
},
{
"input": "etra inites initis",
"output": "NO"
},
{
"input": "etra inites inites",
"output": "YES"
},
{
"input": "initis lios lios",
"output": "NO"
},
{
"input": "initis lios liala",
"output": "NO"
},
{
"input": "initis lios etr",
"output": "NO"
},
{
"input": "initis lios etra",
"output": "NO"
},
{
"input": "initis lios initis",
"output": "NO"
},
{
"input": "initis lios inites",
"output": "NO"
},
{
"input": "initis liala lios",
"output": "NO"
},
{
"input": "initis liala liala",
"output": "NO"
},
{
"input": "initis liala etr",
"output": "NO"
},
{
"input": "initis liala etra",
"output": "NO"
},
{
"input": "initis liala initis",
"output": "NO"
},
{
"input": "initis liala inites",
"output": "NO"
},
{
"input": "initis etr lios",
"output": "NO"
},
{
"input": "initis etr liala",
"output": "NO"
},
{
"input": "initis etr etr",
"output": "NO"
},
{
"input": "initis etr etra",
"output": "NO"
},
{
"input": "initis etr initis",
"output": "NO"
},
{
"input": "initis etr inites",
"output": "NO"
},
{
"input": "initis etra lios",
"output": "NO"
},
{
"input": "initis etra liala",
"output": "NO"
},
{
"input": "initis etra etr",
"output": "NO"
},
{
"input": "initis etra etra",
"output": "NO"
},
{
"input": "initis etra initis",
"output": "NO"
},
{
"input": "initis etra inites",
"output": "NO"
},
{
"input": "initis initis lios",
"output": "NO"
},
{
"input": "initis initis liala",
"output": "NO"
},
{
"input": "initis initis etr",
"output": "NO"
},
{
"input": "initis initis etra",
"output": "NO"
},
{
"input": "initis initis initis",
"output": "NO"
},
{
"input": "initis initis inites",
"output": "NO"
},
{
"input": "initis inites lios",
"output": "NO"
},
{
"input": "initis inites liala",
"output": "NO"
},
{
"input": "initis inites etr",
"output": "NO"
},
{
"input": "initis inites etra",
"output": "NO"
},
{
"input": "initis inites initis",
"output": "NO"
},
{
"input": "initis inites inites",
"output": "NO"
},
{
"input": "inites lios lios",
"output": "NO"
},
{
"input": "inites lios liala",
"output": "NO"
},
{
"input": "inites lios etr",
"output": "NO"
},
{
"input": "inites lios etra",
"output": "NO"
},
{
"input": "inites lios initis",
"output": "NO"
},
{
"input": "inites lios inites",
"output": "NO"
},
{
"input": "inites liala lios",
"output": "NO"
},
{
"input": "inites liala liala",
"output": "NO"
},
{
"input": "inites liala etr",
"output": "NO"
},
{
"input": "inites liala etra",
"output": "NO"
},
{
"input": "inites liala initis",
"output": "NO"
},
{
"input": "inites liala inites",
"output": "NO"
},
{
"input": "inites etr lios",
"output": "NO"
},
{
"input": "inites etr liala",
"output": "NO"
},
{
"input": "inites etr etr",
"output": "NO"
},
{
"input": "inites etr etra",
"output": "NO"
},
{
"input": "inites etr initis",
"output": "NO"
},
{
"input": "inites etr inites",
"output": "NO"
},
{
"input": "inites etra lios",
"output": "NO"
},
{
"input": "inites etra liala",
"output": "NO"
},
{
"input": "inites etra etr",
"output": "NO"
},
{
"input": "inites etra etra",
"output": "NO"
},
{
"input": "inites etra initis",
"output": "NO"
},
{
"input": "inites etra inites",
"output": "NO"
},
{
"input": "inites initis lios",
"output": "NO"
},
{
"input": "inites initis liala",
"output": "NO"
},
{
"input": "inites initis etr",
"output": "NO"
},
{
"input": "inites initis etra",
"output": "NO"
},
{
"input": "inites initis initis",
"output": "NO"
},
{
"input": "inites initis inites",
"output": "NO"
},
{
"input": "inites inites lios",
"output": "NO"
},
{
"input": "inites inites liala",
"output": "NO"
},
{
"input": "inites inites etr",
"output": "NO"
},
{
"input": "inites inites etra",
"output": "NO"
},
{
"input": "inites inites initis",
"output": "NO"
},
{
"input": "inites inites inites",
"output": "NO"
}
] | 1,594,670,776
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 360
| 310
| 20,684,800
|
words = [c for c in input().split()]
verdict = True
category = ["" for i in range(len(words))]
gender = ["" for i in range(len(words))]
for i in range(len(words)):
if (not verdict): break
if (len(words[i]) < 3): verdict = False
elif (words[i][-3:] == "etr"):
category[i] = "noun"
gender[i] = "male"
elif (len(words[i]) >= 4 and words[i][-4:] == "etra"):
category[i] = "noun"
gender[i] = "female"
elif ((len(words[i]) >= 4 and words[i][-4:] == "lios")):
category[i] = "adjective"
gender[i] = "male"
elif (len(words[i]) >= 5 and words[i][-5:] == "liala"):
category[i] = "adjective"
gender[i] = "female"
elif (len(words[i]) >= 6):
category[i] = "verb"
if (words[i][-6:] == "initis"): gender[i] = "male"
elif (words[i][-6:] == "inites"): gender[i] = "female"
else: verdict = False
else: verdict = False
first_noun = -1
for i in range(len(category)):
if (not verdict): break
if (category[i] == "noun"):
first_noun = i
break
if (first_noun == -1 and len(words) > 1): verdict = False
elif (first_noun != -1 and verdict):
left, right = first_noun - 1, first_noun + 1
while (left >= 0 and category[left] == "adjective" and gender[left] == gender[first_noun]): left -= 1
while (right < len(category) and category[right] == "verb" and gender[right] == gender[first_noun]): right += 1
if (left >= 0 or right < len(category)): verdict = False
print(("NO" if (not verdict) else "YES"))
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya got interested in grammar on his third year in school. He invented his own language called Petya's. Petya wanted to create a maximally simple language that would be enough to chat with friends, that's why all the language's grammar can be described with the following set of rules:
- There are three parts of speech: the adjective, the noun, the verb. Each word in his language is an adjective, noun or verb. - There are two genders: masculine and feminine. Each word in his language has gender either masculine or feminine. - Masculine adjectives end with -lios, and feminine adjectives end with -liala. - Masculine nouns end with -etr, and feminime nouns end with -etra. - Masculine verbs end with -initis, and feminime verbs end with -inites. - Thus, each word in the Petya's language has one of the six endings, given above. There are no other endings in Petya's language. - It is accepted that the whole word consists of an ending. That is, words "lios", "liala", "etr" and so on belong to the Petya's language. - There aren't any punctuation marks, grammatical tenses, singular/plural forms or other language complications. - A sentence is either exactly one valid language word or exactly one statement.
Statement is any sequence of the Petya's language, that satisfy both conditions:
- Words in statement follow in the following order (from the left to the right): zero or more adjectives followed by exactly one noun followed by zero or more verbs. - All words in the statement should have the same gender.
After Petya's friend Vasya wrote instant messenger (an instant messaging program) that supported the Petya's language, Petya wanted to add spelling and grammar checking to the program. As Vasya was in the country and Petya didn't feel like waiting, he asked you to help him with this problem. Your task is to define by a given sequence of words, whether it is true that the given text represents exactly one sentence in Petya's language.
Input Specification:
The first line contains one or more words consisting of lowercase Latin letters. The overall number of characters (including letters and spaces) does not exceed 105.
It is guaranteed that any two consecutive words are separated by exactly one space and the input data do not contain any other spaces. It is possible that given words do not belong to the Petya's language.
Output Specification:
If some word of the given text does not belong to the Petya's language or if the text contains more that one sentence, print "NO" (without the quotes). Otherwise, print "YES" (without the quotes).
Demo Input:
['petr\n', 'etis atis animatis etis atis amatis\n', 'nataliala kataliala vetra feinites\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
none
|
```python
words = [c for c in input().split()]
verdict = True
category = ["" for i in range(len(words))]
gender = ["" for i in range(len(words))]
for i in range(len(words)):
if (not verdict): break
if (len(words[i]) < 3): verdict = False
elif (words[i][-3:] == "etr"):
category[i] = "noun"
gender[i] = "male"
elif (len(words[i]) >= 4 and words[i][-4:] == "etra"):
category[i] = "noun"
gender[i] = "female"
elif ((len(words[i]) >= 4 and words[i][-4:] == "lios")):
category[i] = "adjective"
gender[i] = "male"
elif (len(words[i]) >= 5 and words[i][-5:] == "liala"):
category[i] = "adjective"
gender[i] = "female"
elif (len(words[i]) >= 6):
category[i] = "verb"
if (words[i][-6:] == "initis"): gender[i] = "male"
elif (words[i][-6:] == "inites"): gender[i] = "female"
else: verdict = False
else: verdict = False
first_noun = -1
for i in range(len(category)):
if (not verdict): break
if (category[i] == "noun"):
first_noun = i
break
if (first_noun == -1 and len(words) > 1): verdict = False
elif (first_noun != -1 and verdict):
left, right = first_noun - 1, first_noun + 1
while (left >= 0 and category[left] == "adjective" and gender[left] == gender[first_noun]): left -= 1
while (right < len(category) and category[right] == "verb" and gender[right] == gender[first_noun]): right += 1
if (left >= 0 or right < len(category)): verdict = False
print(("NO" if (not verdict) else "YES"))
```
| 3
|
|
233
|
A
|
Perfect Permutation
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
A permutation is a sequence of integers *p*1,<=*p*2,<=...,<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. Let's denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size of permutation *p*1,<=*p*2,<=...,<=*p**n*.
Nickolas adores permutations. He likes some permutations more than the others. He calls such permutations perfect. A perfect permutation is such permutation *p* that for any *i* (1<=≤<=*i*<=≤<=*n*) (*n* is the permutation size) the following equations hold *p**p**i*<==<=*i* and *p**i*<=≠<=*i*. Nickolas asks you to print any perfect permutation of size *n* for the given *n*.
|
A single line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the permutation size.
|
If a perfect permutation of size *n* doesn't exist, print a single integer -1. Otherwise print *n* distinct integers from 1 to *n*, *p*1,<=*p*2,<=...,<=*p**n* — permutation *p*, that is perfect. Separate printed numbers by whitespaces.
|
[
"1\n",
"2\n",
"4\n"
] |
[
"-1\n",
"2 1 \n",
"2 1 4 3 \n"
] |
none
| 500
|
[
{
"input": "1",
"output": "-1"
},
{
"input": "2",
"output": "2 1 "
},
{
"input": "4",
"output": "2 1 4 3 "
},
{
"input": "3",
"output": "-1"
},
{
"input": "5",
"output": "-1"
},
{
"input": "6",
"output": "2 1 4 3 6 5 "
},
{
"input": "7",
"output": "-1"
},
{
"input": "20",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 "
},
{
"input": "8",
"output": "2 1 4 3 6 5 8 7 "
},
{
"input": "9",
"output": "-1"
},
{
"input": "10",
"output": "2 1 4 3 6 5 8 7 10 9 "
},
{
"input": "11",
"output": "-1"
},
{
"input": "21",
"output": "-1"
},
{
"input": "50",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 "
},
{
"input": "51",
"output": "-1"
},
{
"input": "52",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 "
},
{
"input": "84",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 "
},
{
"input": "86",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 "
},
{
"input": "100",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 "
},
{
"input": "98",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 "
},
{
"input": "96",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 "
},
{
"input": "33",
"output": "-1"
},
{
"input": "34",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 "
},
{
"input": "36",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 "
},
{
"input": "38",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 "
},
{
"input": "40",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 "
},
{
"input": "42",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 "
},
{
"input": "44",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 "
},
{
"input": "46",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 "
},
{
"input": "48",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 "
}
] | 1,662,710,661
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 30
| 124
| 0
|
size = input()
size = int(size)
l = [i+1 for i in range(size)]
no_iteration = []
if size % 2 == 1:
print(-1)
else:
for i in range(size):
if i not in no_iteration:
temp = l[i]
temp2 = l[size-1-i]
l[size-1-i] = temp
l[i] = temp2
no_iteration.append(i)
no_iteration.append(size-1-i)
for i in range(len(l)):
l[i] = str(l[i])
print(' '.join(l))
|
Title: Perfect Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A permutation is a sequence of integers *p*1,<=*p*2,<=...,<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. Let's denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size of permutation *p*1,<=*p*2,<=...,<=*p**n*.
Nickolas adores permutations. He likes some permutations more than the others. He calls such permutations perfect. A perfect permutation is such permutation *p* that for any *i* (1<=≤<=*i*<=≤<=*n*) (*n* is the permutation size) the following equations hold *p**p**i*<==<=*i* and *p**i*<=≠<=*i*. Nickolas asks you to print any perfect permutation of size *n* for the given *n*.
Input Specification:
A single line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the permutation size.
Output Specification:
If a perfect permutation of size *n* doesn't exist, print a single integer -1. Otherwise print *n* distinct integers from 1 to *n*, *p*1,<=*p*2,<=...,<=*p**n* — permutation *p*, that is perfect. Separate printed numbers by whitespaces.
Demo Input:
['1\n', '2\n', '4\n']
Demo Output:
['-1\n', '2 1 \n', '2 1 4 3 \n']
Note:
none
|
```python
size = input()
size = int(size)
l = [i+1 for i in range(size)]
no_iteration = []
if size % 2 == 1:
print(-1)
else:
for i in range(size):
if i not in no_iteration:
temp = l[i]
temp2 = l[size-1-i]
l[size-1-i] = temp
l[i] = temp2
no_iteration.append(i)
no_iteration.append(size-1-i)
for i in range(len(l)):
l[i] = str(l[i])
print(' '.join(l))
```
| 3
|
|
499
|
B
|
Lecture
|
PROGRAMMING
| 1,000
|
[
"implementation",
"strings"
] | null | null |
You have a new professor of graph theory and he speaks very quickly. You come up with the following plan to keep up with his lecture and make notes.
You know two languages, and the professor is giving the lecture in the first one. The words in both languages consist of lowercase English characters, each language consists of several words. For each language, all words are distinct, i.e. they are spelled differently. Moreover, the words of these languages have a one-to-one correspondence, that is, for each word in each language, there exists exactly one word in the other language having has the same meaning.
You can write down every word the professor says in either the first language or the second language. Of course, during the lecture you write down each word in the language in which the word is shorter. In case of equal lengths of the corresponding words you prefer the word of the first language.
You are given the text of the lecture the professor is going to read. Find out how the lecture will be recorded in your notes.
|
The first line contains two integers, *n* and *m* (1<=≤<=*n*<=≤<=3000, 1<=≤<=*m*<=≤<=3000) — the number of words in the professor's lecture and the number of words in each of these languages.
The following *m* lines contain the words. The *i*-th line contains two strings *a**i*, *b**i* meaning that the word *a**i* belongs to the first language, the word *b**i* belongs to the second language, and these two words have the same meaning. It is guaranteed that no word occurs in both languages, and each word occurs in its language exactly once.
The next line contains *n* space-separated strings *c*1,<=*c*2,<=...,<=*c**n* — the text of the lecture. It is guaranteed that each of the strings *c**i* belongs to the set of strings {*a*1,<=*a*2,<=... *a**m*}.
All the strings in the input are non-empty, each consisting of no more than 10 lowercase English letters.
|
Output exactly *n* words: how you will record the lecture in your notebook. Output the words of the lecture in the same order as in the input.
|
[
"4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest\n",
"5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll\n"
] |
[
"codeforces round letter round\n",
"hbnyiyc joll joll un joll\n"
] |
none
| 500
|
[
{
"input": "4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest",
"output": "codeforces round letter round"
},
{
"input": "5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll",
"output": "hbnyiyc joll joll un joll"
},
{
"input": "5 5\nqueyqj f\nb vn\ntabzvk qpfzoqx\nytnyonoc hnxsd\njpggvr lchinjmt\nqueyqj jpggvr b ytnyonoc b",
"output": "f jpggvr b hnxsd b"
},
{
"input": "10 22\nazbrll oen\ngh vdyayei\njphveblohx vfglv\nmfyxib jepnvhcuwo\nrpikazqj uam\nl rx\nokjenof qpnyi\nj tixqrno\nod itozmfct\nikkdxmirx ev\nqexftojc p\nkdazb zjs\nmbk ykvqjrxaxu\nhbcwhouzq pwt\nmirpsz zfaegpl\nuhkkvcj rlvwj\nef iqnnwtolrc\npjzfcpmeag ecdayth\nsa qcthz\ncbfhfxi qrnbvdryz\nwqel tj\natx smkbid\nef hbcwhouzq cbfhfxi hbcwhouzq mirpsz cbfhfxi cbfhfxi okjenof pjzfcpmeag kdazb",
"output": "ef pwt cbfhfxi pwt mirpsz cbfhfxi cbfhfxi qpnyi ecdayth zjs"
},
{
"input": "1 1\namit am\namit",
"output": "am"
},
{
"input": "1 1\na c\na",
"output": "a"
}
] | 1,614,868,454
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 37
| 685
| 11,161,600
|
n=input().split()
n,m=int(n[0]),int(n[1])
my_dict={}
for i in range(m):
a=input().split()
a,b=a[0],a[1]
my_dict[a]=b
lecture=input()
ans=''
for i in lecture.split():
if i == len(lecture.split())-1:
if len(i) <= len(my_dict[i]): ans+=i
else: ans+=my_dict[i]
else:
if len(i) <= len(my_dict[i]): ans+=i + ' '
else: ans+=my_dict[i]+' '
#9952402150
print(ans)
|
Title: Lecture
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have a new professor of graph theory and he speaks very quickly. You come up with the following plan to keep up with his lecture and make notes.
You know two languages, and the professor is giving the lecture in the first one. The words in both languages consist of lowercase English characters, each language consists of several words. For each language, all words are distinct, i.e. they are spelled differently. Moreover, the words of these languages have a one-to-one correspondence, that is, for each word in each language, there exists exactly one word in the other language having has the same meaning.
You can write down every word the professor says in either the first language or the second language. Of course, during the lecture you write down each word in the language in which the word is shorter. In case of equal lengths of the corresponding words you prefer the word of the first language.
You are given the text of the lecture the professor is going to read. Find out how the lecture will be recorded in your notes.
Input Specification:
The first line contains two integers, *n* and *m* (1<=≤<=*n*<=≤<=3000, 1<=≤<=*m*<=≤<=3000) — the number of words in the professor's lecture and the number of words in each of these languages.
The following *m* lines contain the words. The *i*-th line contains two strings *a**i*, *b**i* meaning that the word *a**i* belongs to the first language, the word *b**i* belongs to the second language, and these two words have the same meaning. It is guaranteed that no word occurs in both languages, and each word occurs in its language exactly once.
The next line contains *n* space-separated strings *c*1,<=*c*2,<=...,<=*c**n* — the text of the lecture. It is guaranteed that each of the strings *c**i* belongs to the set of strings {*a*1,<=*a*2,<=... *a**m*}.
All the strings in the input are non-empty, each consisting of no more than 10 lowercase English letters.
Output Specification:
Output exactly *n* words: how you will record the lecture in your notebook. Output the words of the lecture in the same order as in the input.
Demo Input:
['4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest\n', '5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll\n']
Demo Output:
['codeforces round letter round\n', 'hbnyiyc joll joll un joll\n']
Note:
none
|
```python
n=input().split()
n,m=int(n[0]),int(n[1])
my_dict={}
for i in range(m):
a=input().split()
a,b=a[0],a[1]
my_dict[a]=b
lecture=input()
ans=''
for i in lecture.split():
if i == len(lecture.split())-1:
if len(i) <= len(my_dict[i]): ans+=i
else: ans+=my_dict[i]
else:
if len(i) <= len(my_dict[i]): ans+=i + ' '
else: ans+=my_dict[i]+' '
#9952402150
print(ans)
```
| 3
|
|
595
|
A
|
Vitaly and Night
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment.
Vitaly sees a building of *n* floors and 2·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2·*j*<=-<=1 and 2·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on.
Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping.
|
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of floors in the house and the number of flats on each floor respectively.
Next *n* lines describe the floors from top to bottom and contain 2·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'.
|
Print a single integer — the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping.
|
[
"2 2\n0 0 0 1\n1 0 1 1\n",
"1 3\n1 1 0 1 0 0\n"
] |
[
"3\n",
"2\n"
] |
In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off.
In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off.
| 500
|
[
{
"input": "2 2\n0 0 0 1\n1 0 1 1",
"output": "3"
},
{
"input": "1 3\n1 1 0 1 0 0",
"output": "2"
},
{
"input": "3 3\n1 1 1 1 1 1\n1 1 0 1 1 0\n1 0 0 0 1 1",
"output": "8"
},
{
"input": "1 5\n1 0 1 1 1 0 1 1 1 1",
"output": "5"
},
{
"input": "1 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 0 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "99"
},
{
"input": "1 100\n0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "6"
},
{
"input": "1 100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "100"
},
{
"input": "100 1\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0",
"output": "8"
},
{
"input": "100 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "1 1\n0 0",
"output": "0"
},
{
"input": "1 1\n0 1",
"output": "1"
},
{
"input": "1 1\n1 0",
"output": "1"
},
{
"input": "1 1\n1 1",
"output": "1"
}
] | 1,689,179,548
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 77
| 102,400
|
p, q = map(int, input().split())
tot = 0
for k in range(p):
a = list(map(int, input().split()))
for l in range(0, len(a), 2):
if a[l] == 1 or a[l+1] == 1:
tot += 1
else:
continue
print(tot)
|
Title: Vitaly and Night
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment.
Vitaly sees a building of *n* floors and 2·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2·*j*<=-<=1 and 2·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on.
Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of floors in the house and the number of flats on each floor respectively.
Next *n* lines describe the floors from top to bottom and contain 2·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'.
Output Specification:
Print a single integer — the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping.
Demo Input:
['2 2\n0 0 0 1\n1 0 1 1\n', '1 3\n1 1 0 1 0 0\n']
Demo Output:
['3\n', '2\n']
Note:
In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off.
In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off.
|
```python
p, q = map(int, input().split())
tot = 0
for k in range(p):
a = list(map(int, input().split()))
for l in range(0, len(a), 2):
if a[l] == 1 or a[l+1] == 1:
tot += 1
else:
continue
print(tot)
```
| 3
|
|
169
|
A
|
Chores
|
PROGRAMMING
| 800
|
[
"sortings"
] | null | null |
Petya and Vasya are brothers. Today is a special day for them as their parents left them home alone and commissioned them to do *n* chores. Each chore is characterized by a single parameter — its complexity. The complexity of the *i*-th chore equals *h**i*.
As Petya is older, he wants to take the chores with complexity larger than some value *x* (*h**i*<=><=*x*) to leave to Vasya the chores with complexity less than or equal to *x* (*h**i*<=≤<=*x*). The brothers have already decided that Petya will do exactly *a* chores and Vasya will do exactly *b* chores (*a*<=+<=*b*<==<=*n*).
In how many ways can they choose an integer *x* so that Petya got exactly *a* chores and Vasya got exactly *b* chores?
|
The first input line contains three integers *n*,<=*a* and *b* (2<=≤<=*n*<=≤<=2000; *a*,<=*b*<=≥<=1; *a*<=+<=*b*<==<=*n*) — the total number of chores, the number of Petya's chores and the number of Vasya's chores.
The next line contains a sequence of integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=109), *h**i* is the complexity of the *i*-th chore. The numbers in the given sequence are not necessarily different.
All numbers on the lines are separated by single spaces.
|
Print the required number of ways to choose an integer value of *x*. If there are no such ways, print 0.
|
[
"5 2 3\n6 2 3 100 1\n",
"7 3 4\n1 1 9 1 1 1 1\n"
] |
[
"3\n",
"0\n"
] |
In the first sample the possible values of *x* are 3, 4 or 5.
In the second sample it is impossible to find such *x*, that Petya got 3 chores and Vasya got 4.
| 500
|
[
{
"input": "5 2 3\n6 2 3 100 1",
"output": "3"
},
{
"input": "7 3 4\n1 1 9 1 1 1 1",
"output": "0"
},
{
"input": "2 1 1\n10 2",
"output": "8"
},
{
"input": "2 1 1\n7 7",
"output": "0"
},
{
"input": "2 1 1\n1 1000000000",
"output": "999999999"
},
{
"input": "3 1 2\n6 5 5",
"output": "1"
},
{
"input": "3 2 1\n10 10 8",
"output": "2"
},
{
"input": "8 3 5\n42 55 61 72 83 10 22 33",
"output": "6"
},
{
"input": "10 5 5\n1 2 3 4 5 999999999 999999998 999999997 999999996 999999995",
"output": "999999990"
},
{
"input": "4 1 3\n10 8 7 3",
"output": "2"
},
{
"input": "4 2 2\n402 10 10 402",
"output": "392"
},
{
"input": "4 1 3\n10 402 402 10",
"output": "0"
},
{
"input": "4 3 1\n100 100 200 200",
"output": "0"
},
{
"input": "150 10 140\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "102 101 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
}
] | 1,516,246,229
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 62
| 5,632,000
|
def inp(): return map(int, input().split())
n,a,b = inp()
h = list(inp())
h.sort()
print(h[b] - h[b-1])
|
Title: Chores
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya and Vasya are brothers. Today is a special day for them as their parents left them home alone and commissioned them to do *n* chores. Each chore is characterized by a single parameter — its complexity. The complexity of the *i*-th chore equals *h**i*.
As Petya is older, he wants to take the chores with complexity larger than some value *x* (*h**i*<=><=*x*) to leave to Vasya the chores with complexity less than or equal to *x* (*h**i*<=≤<=*x*). The brothers have already decided that Petya will do exactly *a* chores and Vasya will do exactly *b* chores (*a*<=+<=*b*<==<=*n*).
In how many ways can they choose an integer *x* so that Petya got exactly *a* chores and Vasya got exactly *b* chores?
Input Specification:
The first input line contains three integers *n*,<=*a* and *b* (2<=≤<=*n*<=≤<=2000; *a*,<=*b*<=≥<=1; *a*<=+<=*b*<==<=*n*) — the total number of chores, the number of Petya's chores and the number of Vasya's chores.
The next line contains a sequence of integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=109), *h**i* is the complexity of the *i*-th chore. The numbers in the given sequence are not necessarily different.
All numbers on the lines are separated by single spaces.
Output Specification:
Print the required number of ways to choose an integer value of *x*. If there are no such ways, print 0.
Demo Input:
['5 2 3\n6 2 3 100 1\n', '7 3 4\n1 1 9 1 1 1 1\n']
Demo Output:
['3\n', '0\n']
Note:
In the first sample the possible values of *x* are 3, 4 or 5.
In the second sample it is impossible to find such *x*, that Petya got 3 chores and Vasya got 4.
|
```python
def inp(): return map(int, input().split())
n,a,b = inp()
h = list(inp())
h.sort()
print(h[b] - h[b-1])
```
| 3
|
|
118
|
A
|
String Task
|
PROGRAMMING
| 1,000
|
[
"implementation",
"strings"
] | null | null |
Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it:
- deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones.
Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string.
Help Petya cope with this easy task.
|
The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.
|
Print the resulting string. It is guaranteed that this string is not empty.
|
[
"tour\n",
"Codeforces\n",
"aBAcAba\n"
] |
[
".t.r\n",
".c.d.f.r.c.s\n",
".b.c.b\n"
] |
none
| 500
|
[
{
"input": "tour",
"output": ".t.r"
},
{
"input": "Codeforces",
"output": ".c.d.f.r.c.s"
},
{
"input": "aBAcAba",
"output": ".b.c.b"
},
{
"input": "obn",
"output": ".b.n"
},
{
"input": "wpwl",
"output": ".w.p.w.l"
},
{
"input": "ggdvq",
"output": ".g.g.d.v.q"
},
{
"input": "pumesz",
"output": ".p.m.s.z"
},
{
"input": "g",
"output": ".g"
},
{
"input": "zjuotps",
"output": ".z.j.t.p.s"
},
{
"input": "jzbwuehe",
"output": ".j.z.b.w.h"
},
{
"input": "tnkgwuugu",
"output": ".t.n.k.g.w.g"
},
{
"input": "kincenvizh",
"output": ".k.n.c.n.v.z.h"
},
{
"input": "xattxjenual",
"output": ".x.t.t.x.j.n.l"
},
{
"input": "ktajqhpqsvhw",
"output": ".k.t.j.q.h.p.q.s.v.h.w"
},
{
"input": "xnhcigytnqcmy",
"output": ".x.n.h.c.g.t.n.q.c.m"
},
{
"input": "jfmtbejyilxcec",
"output": ".j.f.m.t.b.j.l.x.c.c"
},
{
"input": "D",
"output": ".d"
},
{
"input": "ab",
"output": ".b"
},
{
"input": "Ab",
"output": ".b"
},
{
"input": "aB",
"output": ".b"
},
{
"input": "AB",
"output": ".b"
},
{
"input": "ba",
"output": ".b"
},
{
"input": "bA",
"output": ".b"
},
{
"input": "Ba",
"output": ".b"
},
{
"input": "BA",
"output": ".b"
},
{
"input": "aab",
"output": ".b"
},
{
"input": "baa",
"output": ".b"
},
{
"input": "femOZeCArKCpUiHYnbBPTIOFmsHmcpObtPYcLCdjFrUMIyqYzAokKUiiKZRouZiNMoiOuGVoQzaaCAOkquRjmmKKElLNqCnhGdQM",
"output": ".f.m.z.c.r.k.c.p.h.n.b.b.p.t.f.m.s.h.m.c.p.b.t.p.c.l.c.d.j.f.r.m.q.z.k.k.k.z.r.z.n.m.g.v.q.z.c.k.q.r.j.m.m.k.k.l.l.n.q.c.n.h.g.d.q.m"
},
{
"input": "VMBPMCmMDCLFELLIISUJDWQRXYRDGKMXJXJHXVZADRZWVWJRKFRRNSAWKKDPZZLFLNSGUNIVJFBEQsMDHSBJVDTOCSCgZWWKvZZN",
"output": ".v.m.b.p.m.c.m.m.d.c.l.f.l.l.s.j.d.w.q.r.x.r.d.g.k.m.x.j.x.j.h.x.v.z.d.r.z.w.v.w.j.r.k.f.r.r.n.s.w.k.k.d.p.z.z.l.f.l.n.s.g.n.v.j.f.b.q.s.m.d.h.s.b.j.v.d.t.c.s.c.g.z.w.w.k.v.z.z.n"
},
{
"input": "MCGFQQJNUKuAEXrLXibVjClSHjSxmlkQGTKZrRaDNDomIPOmtSgjJAjNVIVLeUGUAOHNkCBwNObVCHOWvNkLFQQbFnugYVMkJruJ",
"output": ".m.c.g.f.q.q.j.n.k.x.r.l.x.b.v.j.c.l.s.h.j.s.x.m.l.k.q.g.t.k.z.r.r.d.n.d.m.p.m.t.s.g.j.j.j.n.v.v.l.g.h.n.k.c.b.w.n.b.v.c.h.w.v.n.k.l.f.q.q.b.f.n.g.v.m.k.j.r.j"
},
{
"input": "iyaiuiwioOyzUaOtAeuEYcevvUyveuyioeeueoeiaoeiavizeeoeyYYaaAOuouueaUioueauayoiuuyiuovyOyiyoyioaoyuoyea",
"output": ".w.z.t.c.v.v.v.v.z.v"
},
{
"input": "yjnckpfyLtzwjsgpcrgCfpljnjwqzgVcufnOvhxplvflxJzqxnhrwgfJmPzifgubvspffmqrwbzivatlmdiBaddiaktdsfPwsevl",
"output": ".j.n.c.k.p.f.l.t.z.w.j.s.g.p.c.r.g.c.f.p.l.j.n.j.w.q.z.g.v.c.f.n.v.h.x.p.l.v.f.l.x.j.z.q.x.n.h.r.w.g.f.j.m.p.z.f.g.b.v.s.p.f.f.m.q.r.w.b.z.v.t.l.m.d.b.d.d.k.t.d.s.f.p.w.s.v.l"
},
{
"input": "RIIIUaAIYJOiuYIUWFPOOAIuaUEZeIooyUEUEAoIyIHYOEAlVAAIiLUAUAeiUIEiUMuuOiAgEUOIAoOUYYEYFEoOIIVeOOAOIIEg",
"output": ".r.j.w.f.p.z.h.l.v.l.m.g.f.v.g"
},
{
"input": "VBKQCFBMQHDMGNSGBQVJTGQCNHHRJMNKGKDPPSQRRVQTZNKBZGSXBPBRXPMVFTXCHZMSJVBRNFNTHBHGJLMDZJSVPZZBCCZNVLMQ",
"output": ".v.b.k.q.c.f.b.m.q.h.d.m.g.n.s.g.b.q.v.j.t.g.q.c.n.h.h.r.j.m.n.k.g.k.d.p.p.s.q.r.r.v.q.t.z.n.k.b.z.g.s.x.b.p.b.r.x.p.m.v.f.t.x.c.h.z.m.s.j.v.b.r.n.f.n.t.h.b.h.g.j.l.m.d.z.j.s.v.p.z.z.b.c.c.z.n.v.l.m.q"
},
{
"input": "iioyoaayeuyoolyiyoeuouiayiiuyTueyiaoiueyioiouyuauouayyiaeoeiiigmioiououeieeeyuyyaYyioiiooaiuouyoeoeg",
"output": ".l.t.g.m.g"
},
{
"input": "ueyiuiauuyyeueykeioouiiauzoyoeyeuyiaoaiiaaoaueyaeydaoauexuueafouiyioueeaaeyoeuaueiyiuiaeeayaioeouiuy",
"output": ".k.z.d.x.f"
},
{
"input": "FSNRBXLFQHZXGVMKLQDVHWLDSLKGKFMDRQWMWSSKPKKQBNDZRSCBLRSKCKKFFKRDMZFZGCNSMXNPMZVDLKXGNXGZQCLRTTDXLMXQ",
"output": ".f.s.n.r.b.x.l.f.q.h.z.x.g.v.m.k.l.q.d.v.h.w.l.d.s.l.k.g.k.f.m.d.r.q.w.m.w.s.s.k.p.k.k.q.b.n.d.z.r.s.c.b.l.r.s.k.c.k.k.f.f.k.r.d.m.z.f.z.g.c.n.s.m.x.n.p.m.z.v.d.l.k.x.g.n.x.g.z.q.c.l.r.t.t.d.x.l.m.x.q"
},
{
"input": "EYAYAYIOIOYOOAUOEUEUOUUYIYUUMOEOIIIAOIUOAAOIYOIOEUIERCEYYAOIOIGYUIAOYUEOEUAEAYPOYEYUUAUOAOEIYIEYUEEY",
"output": ".m.r.c.g.p"
},
{
"input": "jvvzcdcxjstbbksmqjsngxkgtttdxrljjxtwptgwwqzpvqchvgrkqlzxmptzblxhhsmrkmzzmgdfskhtmmnqzzflpmqdctvrfgtx",
"output": ".j.v.v.z.c.d.c.x.j.s.t.b.b.k.s.m.q.j.s.n.g.x.k.g.t.t.t.d.x.r.l.j.j.x.t.w.p.t.g.w.w.q.z.p.v.q.c.h.v.g.r.k.q.l.z.x.m.p.t.z.b.l.x.h.h.s.m.r.k.m.z.z.m.g.d.f.s.k.h.t.m.m.n.q.z.z.f.l.p.m.q.d.c.t.v.r.f.g.t.x"
},
{
"input": "YB",
"output": ".b"
},
{
"input": "fly",
"output": ".f.l"
},
{
"input": "YyyYYYyyYxdwdawdDAWDdaddYYYY",
"output": ".x.d.w.d.w.d.d.w.d.d.d.d"
}
] | 1,699,780,721
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 92
| 0
|
string = list(input())
vowels = ["A", "E", "I", "O", "U", "Y"]
for x in string:
if x.upper() in vowels:
string[string.index(x)] = ""
else:
string[string.index(x)] = f".{x}"
string1 = "".join(string)
string1 = string1.lower()
print(string1)
|
Title: String Task
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it:
- deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones.
Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string.
Help Petya cope with this easy task.
Input Specification:
The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.
Output Specification:
Print the resulting string. It is guaranteed that this string is not empty.
Demo Input:
['tour\n', 'Codeforces\n', 'aBAcAba\n']
Demo Output:
['.t.r\n', '.c.d.f.r.c.s\n', '.b.c.b\n']
Note:
none
|
```python
string = list(input())
vowels = ["A", "E", "I", "O", "U", "Y"]
for x in string:
if x.upper() in vowels:
string[string.index(x)] = ""
else:
string[string.index(x)] = f".{x}"
string1 = "".join(string)
string1 = string1.lower()
print(string1)
```
| 3
|
|
595
|
A
|
Vitaly and Night
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment.
Vitaly sees a building of *n* floors and 2·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2·*j*<=-<=1 and 2·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on.
Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping.
|
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of floors in the house and the number of flats on each floor respectively.
Next *n* lines describe the floors from top to bottom and contain 2·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'.
|
Print a single integer — the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping.
|
[
"2 2\n0 0 0 1\n1 0 1 1\n",
"1 3\n1 1 0 1 0 0\n"
] |
[
"3\n",
"2\n"
] |
In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off.
In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off.
| 500
|
[
{
"input": "2 2\n0 0 0 1\n1 0 1 1",
"output": "3"
},
{
"input": "1 3\n1 1 0 1 0 0",
"output": "2"
},
{
"input": "3 3\n1 1 1 1 1 1\n1 1 0 1 1 0\n1 0 0 0 1 1",
"output": "8"
},
{
"input": "1 5\n1 0 1 1 1 0 1 1 1 1",
"output": "5"
},
{
"input": "1 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 0 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "99"
},
{
"input": "1 100\n0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "6"
},
{
"input": "1 100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "100"
},
{
"input": "100 1\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0",
"output": "8"
},
{
"input": "100 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "1 1\n0 0",
"output": "0"
},
{
"input": "1 1\n0 1",
"output": "1"
},
{
"input": "1 1\n1 0",
"output": "1"
},
{
"input": "1 1\n1 1",
"output": "1"
}
] | 1,601,666,321
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 109
| 0
|
n,m = list(map(int,input().split()))
c =0
for i in range(n):
s = list(map(int,input().split()))[:2*m]
for j in range(1,2*m,2):
if s[j-1] == 1 or s[j] == 1:
c+=1
print(c)
|
Title: Vitaly and Night
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment.
Vitaly sees a building of *n* floors and 2·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2·*j*<=-<=1 and 2·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on.
Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of floors in the house and the number of flats on each floor respectively.
Next *n* lines describe the floors from top to bottom and contain 2·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'.
Output Specification:
Print a single integer — the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping.
Demo Input:
['2 2\n0 0 0 1\n1 0 1 1\n', '1 3\n1 1 0 1 0 0\n']
Demo Output:
['3\n', '2\n']
Note:
In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off.
In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off.
|
```python
n,m = list(map(int,input().split()))
c =0
for i in range(n):
s = list(map(int,input().split()))[:2*m]
for j in range(1,2*m,2):
if s[j-1] == 1 or s[j] == 1:
c+=1
print(c)
```
| 3
|
|
931
|
B
|
World Cup
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms",
"implementation"
] | null | null |
The last stage of Football World Cup is played using the play-off system.
There are *n* teams left in this stage, they are enumerated from 1 to *n*. Several rounds are held, in each round the remaining teams are sorted in the order of their ids, then the first in this order plays with the second, the third — with the fourth, the fifth — with the sixth, and so on. It is guaranteed that in each round there is even number of teams. The winner of each game advances to the next round, the loser is eliminated from the tournament, there are no draws. In the last round there is the only game with two remaining teams: the round is called the Final, the winner is called the champion, and the tournament is over.
Arkady wants his two favorite teams to play in the Final. Unfortunately, the team ids are already determined, and it may happen that it is impossible for teams to meet in the Final, because they are to meet in some earlier stage, if they are strong enough. Determine, in which round the teams with ids *a* and *b* can meet.
|
The only line contains three integers *n*, *a* and *b* (2<=≤<=*n*<=≤<=256, 1<=≤<=*a*,<=*b*<=≤<=*n*) — the total number of teams, and the ids of the teams that Arkady is interested in.
It is guaranteed that *n* is such that in each round an even number of team advance, and that *a* and *b* are not equal.
|
In the only line print "Final!" (without quotes), if teams *a* and *b* can meet in the Final.
Otherwise, print a single integer — the number of the round in which teams *a* and *b* can meet. The round are enumerated from 1.
|
[
"4 1 2\n",
"8 2 6\n",
"8 7 5\n"
] |
[
"1\n",
"Final!\n",
"2\n"
] |
In the first example teams 1 and 2 meet in the first round.
In the second example teams 2 and 6 can only meet in the third round, which is the Final, if they win all their opponents in earlier rounds.
In the third example the teams with ids 7 and 5 can meet in the second round, if they win their opponents in the first round.
| 1,000
|
[
{
"input": "4 1 2",
"output": "1"
},
{
"input": "8 2 6",
"output": "Final!"
},
{
"input": "8 7 5",
"output": "2"
},
{
"input": "128 30 98",
"output": "Final!"
},
{
"input": "256 128 256",
"output": "Final!"
},
{
"input": "256 2 127",
"output": "7"
},
{
"input": "2 1 2",
"output": "Final!"
},
{
"input": "2 2 1",
"output": "Final!"
},
{
"input": "4 1 3",
"output": "Final!"
},
{
"input": "4 1 4",
"output": "Final!"
},
{
"input": "4 2 1",
"output": "1"
},
{
"input": "4 2 3",
"output": "Final!"
},
{
"input": "4 2 4",
"output": "Final!"
},
{
"input": "4 3 1",
"output": "Final!"
},
{
"input": "4 3 2",
"output": "Final!"
},
{
"input": "4 3 4",
"output": "1"
},
{
"input": "4 4 1",
"output": "Final!"
},
{
"input": "4 4 2",
"output": "Final!"
},
{
"input": "4 4 3",
"output": "1"
},
{
"input": "8 8 7",
"output": "1"
},
{
"input": "8 8 5",
"output": "2"
},
{
"input": "8 8 1",
"output": "Final!"
},
{
"input": "16 4 3",
"output": "1"
},
{
"input": "16 2 4",
"output": "2"
},
{
"input": "16 14 11",
"output": "3"
},
{
"input": "16 3 11",
"output": "Final!"
},
{
"input": "32 10 9",
"output": "1"
},
{
"input": "32 25 28",
"output": "2"
},
{
"input": "32 22 18",
"output": "3"
},
{
"input": "32 17 25",
"output": "4"
},
{
"input": "32 18 3",
"output": "Final!"
},
{
"input": "64 40 39",
"output": "1"
},
{
"input": "64 60 58",
"output": "2"
},
{
"input": "64 34 37",
"output": "3"
},
{
"input": "64 26 24",
"output": "4"
},
{
"input": "64 50 43",
"output": "5"
},
{
"input": "64 17 42",
"output": "Final!"
},
{
"input": "128 116 115",
"output": "1"
},
{
"input": "128 35 33",
"output": "2"
},
{
"input": "128 61 59",
"output": "3"
},
{
"input": "128 116 123",
"output": "4"
},
{
"input": "128 17 15",
"output": "5"
},
{
"input": "128 124 77",
"output": "6"
},
{
"input": "128 4 80",
"output": "Final!"
},
{
"input": "256 224 223",
"output": "1"
},
{
"input": "256 24 22",
"output": "2"
},
{
"input": "256 199 196",
"output": "3"
},
{
"input": "256 148 159",
"output": "4"
},
{
"input": "256 178 166",
"output": "5"
},
{
"input": "256 75 97",
"output": "6"
},
{
"input": "256 185 200",
"output": "7"
},
{
"input": "256 3 238",
"output": "Final!"
},
{
"input": "256 128 129",
"output": "Final!"
},
{
"input": "256 255 129",
"output": "7"
},
{
"input": "256 255 128",
"output": "Final!"
},
{
"input": "256 129 256",
"output": "7"
},
{
"input": "128 98 69",
"output": "6"
},
{
"input": "128 47 83",
"output": "Final!"
},
{
"input": "16 2 3",
"output": "2"
},
{
"input": "64 32 30",
"output": "2"
},
{
"input": "8 4 5",
"output": "Final!"
},
{
"input": "8 7 8",
"output": "1"
},
{
"input": "8 2 3",
"output": "2"
},
{
"input": "8 2 5",
"output": "Final!"
}
] | 1,611,579,971
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 64
| 108
| 0
|
v, f, s = map(int, input().split())
f, s = f-1, s-1
a = list(range(v))
x = []
i = 0
z = True
g = 1
while z:
for i in range(0, v, 2):
if a[i+1] == f and a[i] == s or a[i+1] == s and a[i] == f:
print([g, "Final!"][v == 2])
exit(0)
elif a[i+1] != f and a[i] == s or a[i+1] != s and a[i] == f:
x.append(a[i])
elif a[i+1] == f and a[i] != s or a[i+1] == s and a[i] != f:
x.append(a[i+1])
else:
x.append(a[i+1])
a = x
v = v//2
x = []
g += 1
|
Title: World Cup
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The last stage of Football World Cup is played using the play-off system.
There are *n* teams left in this stage, they are enumerated from 1 to *n*. Several rounds are held, in each round the remaining teams are sorted in the order of their ids, then the first in this order plays with the second, the third — with the fourth, the fifth — with the sixth, and so on. It is guaranteed that in each round there is even number of teams. The winner of each game advances to the next round, the loser is eliminated from the tournament, there are no draws. In the last round there is the only game with two remaining teams: the round is called the Final, the winner is called the champion, and the tournament is over.
Arkady wants his two favorite teams to play in the Final. Unfortunately, the team ids are already determined, and it may happen that it is impossible for teams to meet in the Final, because they are to meet in some earlier stage, if they are strong enough. Determine, in which round the teams with ids *a* and *b* can meet.
Input Specification:
The only line contains three integers *n*, *a* and *b* (2<=≤<=*n*<=≤<=256, 1<=≤<=*a*,<=*b*<=≤<=*n*) — the total number of teams, and the ids of the teams that Arkady is interested in.
It is guaranteed that *n* is such that in each round an even number of team advance, and that *a* and *b* are not equal.
Output Specification:
In the only line print "Final!" (without quotes), if teams *a* and *b* can meet in the Final.
Otherwise, print a single integer — the number of the round in which teams *a* and *b* can meet. The round are enumerated from 1.
Demo Input:
['4 1 2\n', '8 2 6\n', '8 7 5\n']
Demo Output:
['1\n', 'Final!\n', '2\n']
Note:
In the first example teams 1 and 2 meet in the first round.
In the second example teams 2 and 6 can only meet in the third round, which is the Final, if they win all their opponents in earlier rounds.
In the third example the teams with ids 7 and 5 can meet in the second round, if they win their opponents in the first round.
|
```python
v, f, s = map(int, input().split())
f, s = f-1, s-1
a = list(range(v))
x = []
i = 0
z = True
g = 1
while z:
for i in range(0, v, 2):
if a[i+1] == f and a[i] == s or a[i+1] == s and a[i] == f:
print([g, "Final!"][v == 2])
exit(0)
elif a[i+1] != f and a[i] == s or a[i+1] != s and a[i] == f:
x.append(a[i])
elif a[i+1] == f and a[i] != s or a[i+1] == s and a[i] != f:
x.append(a[i+1])
else:
x.append(a[i+1])
a = x
v = v//2
x = []
g += 1
```
| 3
|
|
472
|
A
|
Design Tutorial: Learn from Math
|
PROGRAMMING
| 800
|
[
"math",
"number theory"
] | null | null |
One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that.
For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem.
You are given an integer *n* no less than 12, express it as a sum of two composite numbers.
|
The only line contains an integer *n* (12<=≤<=*n*<=≤<=106).
|
Output two composite integers *x* and *y* (1<=<<=*x*,<=*y*<=<<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them.
|
[
"12\n",
"15\n",
"23\n",
"1000000\n"
] |
[
"4 8\n",
"6 9\n",
"8 15\n",
"500000 500000\n"
] |
In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well.
In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number.
| 500
|
[
{
"input": "12",
"output": "4 8"
},
{
"input": "15",
"output": "6 9"
},
{
"input": "23",
"output": "8 15"
},
{
"input": "1000000",
"output": "500000 500000"
},
{
"input": "63874",
"output": "4 63870"
},
{
"input": "14568",
"output": "4 14564"
},
{
"input": "192",
"output": "4 188"
},
{
"input": "86",
"output": "4 82"
},
{
"input": "46220",
"output": "4 46216"
},
{
"input": "57114",
"output": "4 57110"
},
{
"input": "869",
"output": "4 865"
},
{
"input": "738457",
"output": "4 738453"
},
{
"input": "58113",
"output": "6 58107"
},
{
"input": "4864",
"output": "4 4860"
},
{
"input": "15",
"output": "6 9"
},
{
"input": "74752",
"output": "4 74748"
},
{
"input": "6073",
"output": "4 6069"
},
{
"input": "1289",
"output": "4 1285"
},
{
"input": "20",
"output": "4 16"
},
{
"input": "58134",
"output": "4 58130"
},
{
"input": "57756",
"output": "4 57752"
},
{
"input": "765",
"output": "6 759"
},
{
"input": "59",
"output": "4 55"
},
{
"input": "991666",
"output": "4 991662"
},
{
"input": "70761",
"output": "4 70757"
},
{
"input": "13",
"output": "4 9"
},
{
"input": "999999",
"output": "4 999995"
},
{
"input": "17",
"output": "8 9"
},
{
"input": "21",
"output": "6 15"
},
{
"input": "19",
"output": "4 15"
},
{
"input": "100007",
"output": "6 100001"
},
{
"input": "999987",
"output": "6 999981"
},
{
"input": "22",
"output": "4 18"
}
] | 1,676,050,290
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 33
| 62
| 0
|
n=int(input())
if n%2: print(9,n-9)
else: print(8,n-8)
|
Title: Design Tutorial: Learn from Math
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that.
For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem.
You are given an integer *n* no less than 12, express it as a sum of two composite numbers.
Input Specification:
The only line contains an integer *n* (12<=≤<=*n*<=≤<=106).
Output Specification:
Output two composite integers *x* and *y* (1<=<<=*x*,<=*y*<=<<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them.
Demo Input:
['12\n', '15\n', '23\n', '1000000\n']
Demo Output:
['4 8\n', '6 9\n', '8 15\n', '500000 500000\n']
Note:
In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well.
In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number.
|
```python
n=int(input())
if n%2: print(9,n-9)
else: print(8,n-8)
```
| 3
|
|
71
|
A
|
Way Too Long Words
|
PROGRAMMING
| 800
|
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500
|
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,688,709,057
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 46
| 0
|
n = int(input())
output = ""
for x in range(0, n):
w = input()
l = len(w)
if(l > 10):
output = output + w[0] + "%i" % (l-2) + w[l-1] + "\n"
else:
output = output + w + "\n"
print(output)
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
n = int(input())
output = ""
for x in range(0, n):
w = input()
l = len(w)
if(l > 10):
output = output + w[0] + "%i" % (l-2) + w[l-1] + "\n"
else:
output = output + w + "\n"
print(output)
```
| 3.977
|
37
|
A
|
Towers
|
PROGRAMMING
| 1,000
|
[
"sortings"
] |
A. Towers
|
2
|
256
|
Little Vasya has received a young builder’s kit. The kit consists of several wooden bars, the lengths of all of them are known. The bars can be put one on the top of the other if their lengths are the same.
Vasya wants to construct the minimal number of towers from the bars. Help Vasya to use the bars in the best way possible.
|
The first line contains an integer *N* (1<=≤<=*N*<=≤<=1000) — the number of bars at Vasya’s disposal. The second line contains *N* space-separated integers *l**i* — the lengths of the bars. All the lengths are natural numbers not exceeding 1000.
|
In one line output two numbers — the height of the largest tower and their total number. Remember that Vasya should use all the bars.
|
[
"3\n1 2 3\n",
"4\n6 5 6 7\n"
] |
[
"1 3\n",
"2 3\n"
] |
none
| 500
|
[
{
"input": "3\n1 2 3",
"output": "1 3"
},
{
"input": "4\n6 5 6 7",
"output": "2 3"
},
{
"input": "4\n3 2 1 1",
"output": "2 3"
},
{
"input": "4\n1 2 3 3",
"output": "2 3"
},
{
"input": "3\n20 22 36",
"output": "1 3"
},
{
"input": "25\n47 30 94 41 45 20 96 51 110 129 24 116 9 47 32 82 105 114 116 75 154 151 70 42 162",
"output": "2 23"
},
{
"input": "45\n802 664 442 318 318 827 417 878 711 291 231 414 807 553 657 392 279 202 386 606 465 655 658 112 887 15 25 502 95 44 679 775 942 609 209 871 31 234 4 231 150 110 22 823 193",
"output": "2 43"
},
{
"input": "63\n93 180 116 7 8 179 268 279 136 94 221 153 264 190 278 19 19 63 153 26 158 225 25 49 89 218 111 149 255 225 197 122 243 80 3 224 107 178 202 17 53 92 69 42 228 24 81 205 95 8 265 82 228 156 127 241 172 159 106 60 67 155 111",
"output": "2 57"
},
{
"input": "83\n246 535 994 33 390 927 321 97 223 922 812 705 79 80 977 457 476 636 511 137 6 360 815 319 717 674 368 551 714 628 278 713 761 553 184 414 623 753 428 214 581 115 439 61 677 216 772 592 187 603 658 310 439 559 870 376 109 321 189 337 277 26 70 734 796 907 979 693 570 227 345 650 737 633 701 914 134 403 972 940 371 6 642",
"output": "2 80"
},
{
"input": "105\n246 57 12 204 165 123 246 68 191 310 3 152 386 333 374 257 158 104 333 50 80 290 8 340 101 76 221 316 388 289 138 359 316 26 93 290 105 178 81 195 41 196 218 180 244 292 187 97 315 323 174 119 248 239 92 312 31 2 101 180 307 170 338 314 163 281 217 31 142 238 280 190 190 156 70 74 329 113 151 8 141 313 366 40 253 116 168 124 135 230 294 266 353 389 371 359 195 200 183 237 93 102 315 118 188",
"output": "2 92"
},
{
"input": "123\n112 277 170 247 252 115 157 293 256 143 196 90 12 164 164 42 8 223 167 109 175 232 239 111 148 51 9 254 93 32 268 162 231 91 47 162 161 191 195 145 247 292 129 199 230 94 144 217 18 205 176 20 143 198 121 243 211 262 230 277 195 255 108 290 220 275 158 2 286 200 60 267 278 207 123 150 123 116 131 13 12 226 33 244 30 275 263 45 158 192 254 149 242 176 62 224 221 288 250 160 155 225 132 143 276 293 218 145 197 175 33 129 79 206 210 192 222 262 190 52 274 243 233",
"output": "3 101"
},
{
"input": "5\n5 5 5 5 5",
"output": "5 1"
},
{
"input": "3\n1000 1000 1000",
"output": "3 1"
},
{
"input": "1\n1000",
"output": "1 1"
},
{
"input": "1\n1",
"output": "1 1"
},
{
"input": "5\n1 1000 1000 1000 1000",
"output": "4 2"
},
{
"input": "5\n1000 1000 1000 8 7",
"output": "3 3"
}
] | 1,434,527,080
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 61
| 124
| 409,600
|
from collections import Counter
input()
c = Counter(int(i) for i in input().split())
print(max(c.values()), len(c))
|
Title: Towers
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Vasya has received a young builder’s kit. The kit consists of several wooden bars, the lengths of all of them are known. The bars can be put one on the top of the other if their lengths are the same.
Vasya wants to construct the minimal number of towers from the bars. Help Vasya to use the bars in the best way possible.
Input Specification:
The first line contains an integer *N* (1<=≤<=*N*<=≤<=1000) — the number of bars at Vasya’s disposal. The second line contains *N* space-separated integers *l**i* — the lengths of the bars. All the lengths are natural numbers not exceeding 1000.
Output Specification:
In one line output two numbers — the height of the largest tower and their total number. Remember that Vasya should use all the bars.
Demo Input:
['3\n1 2 3\n', '4\n6 5 6 7\n']
Demo Output:
['1 3\n', '2 3\n']
Note:
none
|
```python
from collections import Counter
input()
c = Counter(int(i) for i in input().split())
print(max(c.values()), len(c))
```
| 3.968237
|
509
|
A
|
Maximum in Table
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
|
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
|
Print a single line containing a positive integer *m* — the maximum value in the table.
|
[
"1\n",
"5\n"
] |
[
"1",
"70"
] |
In the second test the rows of the table look as follows:
| 0
|
[
{
"input": "1",
"output": "1"
},
{
"input": "5",
"output": "70"
},
{
"input": "2",
"output": "2"
},
{
"input": "3",
"output": "6"
},
{
"input": "4",
"output": "20"
},
{
"input": "6",
"output": "252"
},
{
"input": "7",
"output": "924"
},
{
"input": "9",
"output": "12870"
},
{
"input": "10",
"output": "48620"
},
{
"input": "8",
"output": "3432"
}
] | 1,652,965,516
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 10
| 93
| 37,376,000
|
def answer(r,c):
if(r==1 or c==1):
return 1
return answer(r-1,c)+answer(r,c-1)
n=int(input())
print(answer(n,n))
|
Title: Maximum in Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
Input Specification:
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
Output Specification:
Print a single line containing a positive integer *m* — the maximum value in the table.
Demo Input:
['1\n', '5\n']
Demo Output:
['1', '70']
Note:
In the second test the rows of the table look as follows:
|
```python
def answer(r,c):
if(r==1 or c==1):
return 1
return answer(r-1,c)+answer(r,c-1)
n=int(input())
print(answer(n,n))
```
| 3
|
|
550
|
B
|
Preparing Olympiad
|
PROGRAMMING
| 1,400
|
[
"bitmasks",
"brute force"
] | null | null |
You have *n* problems. You have estimated the difficulty of the *i*-th one as integer *c**i*. Now you want to prepare a problemset for a contest, using some of the problems you've made.
A problemset for the contest must consist of at least two problems. You think that the total difficulty of the problems of the contest must be at least *l* and at most *r*. Also, you think that the difference between difficulties of the easiest and the hardest of the chosen problems must be at least *x*.
Find the number of ways to choose a problemset for the contest.
|
The first line contains four integers *n*, *l*, *r*, *x* (1<=≤<=*n*<=≤<=15, 1<=≤<=*l*<=≤<=*r*<=≤<=109, 1<=≤<=*x*<=≤<=106) — the number of problems you have, the minimum and maximum value of total difficulty of the problemset and the minimum difference in difficulty between the hardest problem in the pack and the easiest one, respectively.
The second line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=106) — the difficulty of each problem.
|
Print the number of ways to choose a suitable problemset for the contest.
|
[
"3 5 6 1\n1 2 3\n",
"4 40 50 10\n10 20 30 25\n",
"5 25 35 10\n10 10 20 10 20\n"
] |
[
"2\n",
"2\n",
"6\n"
] |
In the first example two sets are suitable, one consisting of the second and third problem, another one consisting of all three problems.
In the second example, two sets of problems are suitable — the set of problems with difficulties 10 and 30 as well as the set of problems with difficulties 20 and 30.
In the third example any set consisting of one problem of difficulty 10 and one problem of difficulty 20 is suitable.
| 750
|
[
{
"input": "3 5 6 1\n1 2 3",
"output": "2"
},
{
"input": "4 40 50 10\n10 20 30 25",
"output": "2"
},
{
"input": "5 25 35 10\n10 10 20 10 20",
"output": "6"
},
{
"input": "4 15 60 10\n10 20 30 25",
"output": "6"
},
{
"input": "1 10 20 1\n15",
"output": "0"
},
{
"input": "10 626451 11471247 246428\n369649 684428 303821 287098 422756 301599 720377 177567 515216 750602",
"output": "914"
},
{
"input": "15 1415849 15540979 356865\n8352 960238 276753 259695 712845 945369 60023 920446 181269 392011 318488 857649 30681 740872 115749",
"output": "31485"
},
{
"input": "7 1000 2000 1\n10 20 30 40 50 60 70",
"output": "0"
},
{
"input": "4 10 20 1\n4 6 4 6",
"output": "9"
},
{
"input": "4 10 20 1\n5 15 13 7",
"output": "4"
},
{
"input": "2 10 20 5\n5 10",
"output": "1"
},
{
"input": "5 1098816 3969849 167639\n85627 615007 794045 530104 7091",
"output": "15"
},
{
"input": "13 700147 8713522 390093\n996812 94040 954140 545670 369698 423872 365802 784830 700267 960664 949252 84637 257447",
"output": "8026"
},
{
"input": "15 4531977 20754263 137419\n637830 85299 755530 64382 896833 879525 331501 148182 741013 192101 112217 52165 702790 988594 587499",
"output": "6759"
},
{
"input": "15 2572491 5084070 823435\n570344 78552 775918 501843 844935 71141 331498 636557 435494 715447 992666 831188 28969 171046 989614",
"output": "15078"
},
{
"input": "15 4789415 23152928 233992\n502422 273992 449428 947379 700461 681985 857134 243310 478052 77769 936151 642380 464695 281772 964693",
"output": "10875"
},
{
"input": "3 390224 390224 1\n264237 125987 288891",
"output": "1"
},
{
"input": "7 1652707 1652707 1\n492387 684636 235422 332532 924898 499872 192988",
"output": "1"
},
{
"input": "10 501107 501107 1\n843967 30518 196518 619138 204862 690754 274071 550121 173607 359971",
"output": "1"
},
{
"input": "15 6627289 6627289 1\n683844 183950 184972 764255 211665 842336 790234 815301 914823 513046 93547 713159 554415 200951 388028",
"output": "1"
},
{
"input": "15 5083470 5083470 1\n978510 643688 591921 723137 573784 346171 920030 352119 528857 365128 627302 308557 716247 263519 654230",
"output": "1"
},
{
"input": "15 6558665 6558665 1\n572491 435494 916457 775918 823435 78552 501843 331498 71141 844935 636557 992666 570344 831188 715447",
"output": "1"
},
{
"input": "10 159699 10967276 3542\n998862 999751 995306 992648 992661 991407 997503 998809 999740 997669",
"output": "942"
},
{
"input": "5 2815840 8479687 4082\n991137 992161 997887 998891 994990",
"output": "14"
},
{
"input": "15 2898377 6694755 721\n992733 999159 990076 996808 990975 993338 993234 994757 997873 993303 994409 993801 998027 990495 999287",
"output": "9819"
},
{
"input": "6 20 70 1\n10 10 20 20 30 30",
"output": "35"
},
{
"input": "6 20 70 1\n10 10 10 10 10 10",
"output": "0"
},
{
"input": "15 1 1000000000 1\n10 20 30 40 50 60 70 80 90 100 110 120 130 140 150",
"output": "32752"
},
{
"input": "6 30 40 1\n19 20 21 14 15 16",
"output": "13"
},
{
"input": "4 5 234 2\n10 9 12 11",
"output": "8"
}
] | 1,671,972,358
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 30
| 93
| 3,584,000
|
import sys
from itertools import chain, combinations
def get_ints(): return map(int, sys.stdin.readline().strip().split())
def powerset(iterable):
s = list(iterable)
return chain.from_iterable(combinations(s, r) for r in range(len(s)+1))
n, l, r, x = get_ints()
c = list(get_ints())
def isValid(list, l, r, x):
intervalSum = sum(list)
if l <= intervalSum <= r and max(list) - min(list) >= x:
return True
return False
ans = 0
for list in powerset(c):
if isValid(list, l, r, x):
ans += 1
print(ans)
|
Title: Preparing Olympiad
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have *n* problems. You have estimated the difficulty of the *i*-th one as integer *c**i*. Now you want to prepare a problemset for a contest, using some of the problems you've made.
A problemset for the contest must consist of at least two problems. You think that the total difficulty of the problems of the contest must be at least *l* and at most *r*. Also, you think that the difference between difficulties of the easiest and the hardest of the chosen problems must be at least *x*.
Find the number of ways to choose a problemset for the contest.
Input Specification:
The first line contains four integers *n*, *l*, *r*, *x* (1<=≤<=*n*<=≤<=15, 1<=≤<=*l*<=≤<=*r*<=≤<=109, 1<=≤<=*x*<=≤<=106) — the number of problems you have, the minimum and maximum value of total difficulty of the problemset and the minimum difference in difficulty between the hardest problem in the pack and the easiest one, respectively.
The second line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=106) — the difficulty of each problem.
Output Specification:
Print the number of ways to choose a suitable problemset for the contest.
Demo Input:
['3 5 6 1\n1 2 3\n', '4 40 50 10\n10 20 30 25\n', '5 25 35 10\n10 10 20 10 20\n']
Demo Output:
['2\n', '2\n', '6\n']
Note:
In the first example two sets are suitable, one consisting of the second and third problem, another one consisting of all three problems.
In the second example, two sets of problems are suitable — the set of problems with difficulties 10 and 30 as well as the set of problems with difficulties 20 and 30.
In the third example any set consisting of one problem of difficulty 10 and one problem of difficulty 20 is suitable.
|
```python
import sys
from itertools import chain, combinations
def get_ints(): return map(int, sys.stdin.readline().strip().split())
def powerset(iterable):
s = list(iterable)
return chain.from_iterable(combinations(s, r) for r in range(len(s)+1))
n, l, r, x = get_ints()
c = list(get_ints())
def isValid(list, l, r, x):
intervalSum = sum(list)
if l <= intervalSum <= r and max(list) - min(list) >= x:
return True
return False
ans = 0
for list in powerset(c):
if isValid(list, l, r, x):
ans += 1
print(ans)
```
| 3
|
|
803
|
B
|
Distances to Zero
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms"
] | null | null |
You are given the array of integer numbers *a*0,<=*a*1,<=...,<=*a**n*<=-<=1. For each element find the distance to the nearest zero (to the element which equals to zero). There is at least one zero element in the given array.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=2·105) — length of the array *a*. The second line contains integer elements of the array separated by single spaces (<=-<=109<=≤<=*a**i*<=≤<=109).
|
Print the sequence *d*0,<=*d*1,<=...,<=*d**n*<=-<=1, where *d**i* is the difference of indices between *i* and nearest *j* such that *a**j*<==<=0. It is possible that *i*<==<=*j*.
|
[
"9\n2 1 0 3 0 0 3 2 4\n",
"5\n0 1 2 3 4\n",
"7\n5 6 0 1 -2 3 4\n"
] |
[
"2 1 0 1 0 0 1 2 3 ",
"0 1 2 3 4 ",
"2 1 0 1 2 3 4 "
] |
none
| 0
|
[
{
"input": "9\n2 1 0 3 0 0 3 2 4",
"output": "2 1 0 1 0 0 1 2 3 "
},
{
"input": "5\n0 1 2 3 4",
"output": "0 1 2 3 4 "
},
{
"input": "7\n5 6 0 1 -2 3 4",
"output": "2 1 0 1 2 3 4 "
},
{
"input": "1\n0",
"output": "0 "
},
{
"input": "2\n0 0",
"output": "0 0 "
},
{
"input": "2\n0 1",
"output": "0 1 "
},
{
"input": "2\n1 0",
"output": "1 0 "
},
{
"input": "5\n0 1000000000 1000000000 1000000000 1000000000",
"output": "0 1 2 3 4 "
},
{
"input": "5\n-1000000000 -1000000000 0 1000000000 1000000000",
"output": "2 1 0 1 2 "
},
{
"input": "5\n-1000000000 1000000000 1000000000 1000000000 0",
"output": "4 3 2 1 0 "
},
{
"input": "15\n1000000000 -1000000000 -1000000000 1000000000 -1000000000 -1000000000 -1000000000 1000000000 1000000000 -1000000000 -1000000000 -1000000000 -1000000000 1000000000 0",
"output": "14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 "
},
{
"input": "15\n0 0 0 0 1000000000 -1000000000 -1000000000 -1000000000 -1000000000 1000000000 1000000000 1000000000 -1000000000 -1000000000 1000000000",
"output": "0 0 0 0 1 2 3 4 5 6 7 8 9 10 11 "
},
{
"input": "15\n-1000000000 1000000000 1000000000 -1000000000 -1000000000 1000000000 0 -1000000000 -1000000000 0 0 1000000000 -1000000000 0 -1000000000",
"output": "6 5 4 3 2 1 0 1 1 0 0 1 1 0 1 "
},
{
"input": "15\n-1000000000 -1000000000 1000000000 1000000000 -1000000000 1000000000 1000000000 -1000000000 1000000000 1000000000 1000000000 0 0 0 0",
"output": "11 10 9 8 7 6 5 4 3 2 1 0 0 0 0 "
},
{
"input": "4\n0 0 2 0",
"output": "0 0 1 0 "
},
{
"input": "15\n1 2 3 4 0 1 2 3 -5 -4 -3 -1 0 5 4",
"output": "4 3 2 1 0 1 2 3 4 3 2 1 0 1 2 "
},
{
"input": "2\n0 -1",
"output": "0 1 "
},
{
"input": "5\n0 -1 -1 -1 0",
"output": "0 1 2 1 0 "
},
{
"input": "5\n0 0 0 -1 0",
"output": "0 0 0 1 0 "
},
{
"input": "3\n0 0 -1",
"output": "0 0 1 "
},
{
"input": "3\n0 -1 -1",
"output": "0 1 2 "
},
{
"input": "12\n0 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 0",
"output": "0 1 2 3 4 5 5 4 3 2 1 0 "
},
{
"input": "18\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -1",
"output": "0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 "
},
{
"input": "30\n0 0 0 0 0 0 0 0 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1",
"output": "0 0 0 0 0 0 0 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 "
},
{
"input": "1\n0",
"output": "0 "
},
{
"input": "1\n0",
"output": "0 "
},
{
"input": "1\n0",
"output": "0 "
},
{
"input": "2\n0 -1000000000",
"output": "0 1 "
},
{
"input": "2\n0 1000000000",
"output": "0 1 "
},
{
"input": "2\n-1000000000 0",
"output": "1 0 "
},
{
"input": "2\n0 0",
"output": "0 0 "
},
{
"input": "2\n0 0",
"output": "0 0 "
},
{
"input": "2\n0 0",
"output": "0 0 "
},
{
"input": "3\n0 -1000000000 -1000000000",
"output": "0 1 2 "
},
{
"input": "3\n0 1000000000 1000000000",
"output": "0 1 2 "
},
{
"input": "3\n1000000000 1000000000 0",
"output": "2 1 0 "
},
{
"input": "3\n0 0 -1000000000",
"output": "0 0 1 "
},
{
"input": "3\n0 1000000000 0",
"output": "0 1 0 "
},
{
"input": "3\n-1000000000 0 0",
"output": "1 0 0 "
},
{
"input": "3\n0 0 0",
"output": "0 0 0 "
},
{
"input": "3\n0 0 0",
"output": "0 0 0 "
},
{
"input": "3\n0 0 0",
"output": "0 0 0 "
},
{
"input": "4\n0 -1000000000 -1000000000 -1000000000",
"output": "0 1 2 3 "
},
{
"input": "4\n1000000000 -1000000000 0 -1000000000",
"output": "2 1 0 1 "
},
{
"input": "4\n1000000000 -1000000000 1000000000 0",
"output": "3 2 1 0 "
},
{
"input": "4\n0 0 -1000000000 1000000000",
"output": "0 0 1 2 "
},
{
"input": "4\n0 0 1000000000 -1000000000",
"output": "0 0 1 2 "
},
{
"input": "4\n-1000000000 1000000000 0 0",
"output": "2 1 0 0 "
},
{
"input": "4\n0 0 0 -1000000000",
"output": "0 0 0 1 "
},
{
"input": "4\n1000000000 0 0 0",
"output": "1 0 0 0 "
},
{
"input": "4\n1000000000 0 0 0",
"output": "1 0 0 0 "
},
{
"input": "4\n0 0 0 0",
"output": "0 0 0 0 "
},
{
"input": "4\n0 0 0 0",
"output": "0 0 0 0 "
},
{
"input": "4\n0 0 0 0",
"output": "0 0 0 0 "
},
{
"input": "5\n0 1000000000 1000000000 1000000000 1000000000",
"output": "0 1 2 3 4 "
},
{
"input": "5\n1000000000 -1000000000 -1000000000 1000000000 0",
"output": "4 3 2 1 0 "
},
{
"input": "5\n1000000000 -1000000000 1000000000 -1000000000 0",
"output": "4 3 2 1 0 "
},
{
"input": "5\n0 0 -1000000000 -1000000000 -1000000000",
"output": "0 0 1 2 3 "
},
{
"input": "5\n1000000000 0 -1000000000 0 -1000000000",
"output": "1 0 1 0 1 "
},
{
"input": "5\n1000000000 1000000000 1000000000 0 0",
"output": "3 2 1 0 0 "
},
{
"input": "5\n0 0 0 -1000000000 -1000000000",
"output": "0 0 0 1 2 "
},
{
"input": "5\n-1000000000 1000000000 0 0 0",
"output": "2 1 0 0 0 "
},
{
"input": "5\n1000000000 1000000000 0 0 0",
"output": "2 1 0 0 0 "
},
{
"input": "5\n0 0 0 0 -1000000000",
"output": "0 0 0 0 1 "
},
{
"input": "5\n0 0 1000000000 0 0",
"output": "0 0 1 0 0 "
},
{
"input": "5\n1000000000 0 0 0 0",
"output": "1 0 0 0 0 "
},
{
"input": "5\n0 0 0 0 0",
"output": "0 0 0 0 0 "
},
{
"input": "5\n0 0 0 0 0",
"output": "0 0 0 0 0 "
},
{
"input": "5\n0 0 0 0 0",
"output": "0 0 0 0 0 "
},
{
"input": "6\n0 1000000000 -1000000000 1000000000 -1000000000 1000000000",
"output": "0 1 2 3 4 5 "
},
{
"input": "6\n-1000000000 -1000000000 1000000000 1000000000 1000000000 0",
"output": "5 4 3 2 1 0 "
},
{
"input": "6\n-1000000000 1000000000 -1000000000 1000000000 -1000000000 0",
"output": "5 4 3 2 1 0 "
},
{
"input": "6\n0 0 1000000000 1000000000 -1000000000 -1000000000",
"output": "0 0 1 2 3 4 "
},
{
"input": "6\n0 0 1000000000 1000000000 -1000000000 -1000000000",
"output": "0 0 1 2 3 4 "
},
{
"input": "6\n-1000000000 1000000000 -1000000000 -1000000000 0 0",
"output": "4 3 2 1 0 0 "
},
{
"input": "6\n0 0 0 -1000000000 1000000000 1000000000",
"output": "0 0 0 1 2 3 "
},
{
"input": "6\n-1000000000 1000000000 -1000000000 0 0 0",
"output": "3 2 1 0 0 0 "
},
{
"input": "6\n-1000000000 -1000000000 1000000000 0 0 0",
"output": "3 2 1 0 0 0 "
},
{
"input": "6\n0 0 0 0 -1000000000 1000000000",
"output": "0 0 0 0 1 2 "
},
{
"input": "6\n0 0 0 -1000000000 1000000000 0",
"output": "0 0 0 1 1 0 "
},
{
"input": "6\n1000000000 1000000000 0 0 0 0",
"output": "2 1 0 0 0 0 "
},
{
"input": "6\n0 0 0 0 0 -1000000000",
"output": "0 0 0 0 0 1 "
},
{
"input": "6\n0 0 0 1000000000 0 0",
"output": "0 0 0 1 0 0 "
},
{
"input": "6\n1000000000 0 0 0 0 0",
"output": "1 0 0 0 0 0 "
},
{
"input": "6\n0 0 0 0 0 0",
"output": "0 0 0 0 0 0 "
},
{
"input": "6\n0 0 0 0 0 0",
"output": "0 0 0 0 0 0 "
},
{
"input": "6\n0 0 0 0 0 0",
"output": "0 0 0 0 0 0 "
},
{
"input": "7\n0 -1000000000 1000000000 -1000000000 -1000000000 -1000000000 -1000000000",
"output": "0 1 2 3 4 5 6 "
},
{
"input": "7\n1000000000 1000000000 -1000000000 0 -1000000000 1000000000 -1000000000",
"output": "3 2 1 0 1 2 3 "
},
{
"input": "7\n1000000000 1000000000 -1000000000 1000000000 -1000000000 -1000000000 0",
"output": "6 5 4 3 2 1 0 "
},
{
"input": "7\n0 0 1000000000 1000000000 1000000000 1000000000 -1000000000",
"output": "0 0 1 2 3 4 5 "
},
{
"input": "7\n0 1000000000 1000000000 -1000000000 1000000000 1000000000 0",
"output": "0 1 2 3 2 1 0 "
},
{
"input": "7\n1000000000 -1000000000 -1000000000 1000000000 -1000000000 0 0",
"output": "5 4 3 2 1 0 0 "
},
{
"input": "7\n0 0 0 1000000000 -1000000000 -1000000000 1000000000",
"output": "0 0 0 1 2 3 4 "
},
{
"input": "7\n-1000000000 0 0 -1000000000 0 -1000000000 1000000000",
"output": "1 0 0 1 0 1 2 "
},
{
"input": "7\n1000000000 1000000000 1000000000 -1000000000 0 0 0",
"output": "4 3 2 1 0 0 0 "
},
{
"input": "7\n0 0 0 0 -1000000000 -1000000000 1000000000",
"output": "0 0 0 0 1 2 3 "
},
{
"input": "7\n0 -1000000000 0 0 0 -1000000000 1000000000",
"output": "0 1 0 0 0 1 2 "
},
{
"input": "7\n1000000000 1000000000 1000000000 0 0 0 0",
"output": "3 2 1 0 0 0 0 "
},
{
"input": "7\n0 0 0 0 0 -1000000000 1000000000",
"output": "0 0 0 0 0 1 2 "
},
{
"input": "7\n0 -1000000000 0 0 0 0 -1000000000",
"output": "0 1 0 0 0 0 1 "
},
{
"input": "7\n-1000000000 1000000000 0 0 0 0 0",
"output": "2 1 0 0 0 0 0 "
},
{
"input": "7\n0 0 0 0 0 0 -1000000000",
"output": "0 0 0 0 0 0 1 "
},
{
"input": "7\n0 0 0 0 0 1000000000 0",
"output": "0 0 0 0 0 1 0 "
},
{
"input": "7\n1000000000 0 0 0 0 0 0",
"output": "1 0 0 0 0 0 0 "
},
{
"input": "7\n0 0 0 0 0 0 0",
"output": "0 0 0 0 0 0 0 "
},
{
"input": "7\n0 0 0 0 0 0 0",
"output": "0 0 0 0 0 0 0 "
},
{
"input": "7\n0 0 0 0 0 0 0",
"output": "0 0 0 0 0 0 0 "
},
{
"input": "8\n0 -1000000000 -1000000000 1000000000 1000000000 1000000000 1000000000 -1000000000",
"output": "0 1 2 3 4 5 6 7 "
},
{
"input": "8\n0 -1000000000 1000000000 1000000000 1000000000 -1000000000 1000000000 1000000000",
"output": "0 1 2 3 4 5 6 7 "
},
{
"input": "8\n1000000000 -1000000000 -1000000000 -1000000000 1000000000 1000000000 1000000000 0",
"output": "7 6 5 4 3 2 1 0 "
},
{
"input": "8\n0 0 -1000000000 -1000000000 1000000000 1000000000 1000000000 -1000000000",
"output": "0 0 1 2 3 4 5 6 "
},
{
"input": "8\n1000000000 0 0 -1000000000 -1000000000 1000000000 -1000000000 -1000000000",
"output": "1 0 0 1 2 3 4 5 "
},
{
"input": "8\n1000000000 -1000000000 1000000000 -1000000000 -1000000000 -1000000000 0 0",
"output": "6 5 4 3 2 1 0 0 "
},
{
"input": "8\n0 0 0 1000000000 1000000000 -1000000000 -1000000000 -1000000000",
"output": "0 0 0 1 2 3 4 5 "
},
{
"input": "8\n-1000000000 0 0 1000000000 1000000000 0 -1000000000 1000000000",
"output": "1 0 0 1 1 0 1 2 "
},
{
"input": "8\n1000000000 1000000000 1000000000 -1000000000 -1000000000 0 0 0",
"output": "5 4 3 2 1 0 0 0 "
},
{
"input": "8\n0 0 0 0 1000000000 1000000000 1000000000 -1000000000",
"output": "0 0 0 0 1 2 3 4 "
},
{
"input": "8\n1000000000 0 1000000000 -1000000000 0 -1000000000 0 0",
"output": "1 0 1 1 0 1 0 0 "
},
{
"input": "8\n-1000000000 -1000000000 -1000000000 -1000000000 0 0 0 0",
"output": "4 3 2 1 0 0 0 0 "
},
{
"input": "8\n0 0 0 0 0 1000000000 1000000000 -1000000000",
"output": "0 0 0 0 0 1 2 3 "
},
{
"input": "8\n-1000000000 0 -1000000000 0 0 1000000000 0 0",
"output": "1 0 1 0 0 1 0 0 "
},
{
"input": "8\n1000000000 1000000000 1000000000 0 0 0 0 0",
"output": "3 2 1 0 0 0 0 0 "
},
{
"input": "8\n0 0 0 0 0 0 -1000000000 -1000000000",
"output": "0 0 0 0 0 0 1 2 "
},
{
"input": "8\n0 0 0 1000000000 -1000000000 0 0 0",
"output": "0 0 0 1 1 0 0 0 "
},
{
"input": "8\n1000000000 1000000000 0 0 0 0 0 0",
"output": "2 1 0 0 0 0 0 0 "
},
{
"input": "8\n0 0 0 0 0 0 0 -1000000000",
"output": "0 0 0 0 0 0 0 1 "
},
{
"input": "8\n0 1000000000 0 0 0 0 0 0",
"output": "0 1 0 0 0 0 0 0 "
},
{
"input": "8\n1000000000 0 0 0 0 0 0 0",
"output": "1 0 0 0 0 0 0 0 "
},
{
"input": "8\n0 0 0 0 0 0 0 0",
"output": "0 0 0 0 0 0 0 0 "
},
{
"input": "8\n0 0 0 0 0 0 0 0",
"output": "0 0 0 0 0 0 0 0 "
},
{
"input": "8\n0 0 0 0 0 0 0 0",
"output": "0 0 0 0 0 0 0 0 "
}
] | 1,493,393,619
| 1,719
|
Python 3
|
OK
|
TESTS
| 164
| 639
| 23,244,800
|
n = int(input())
l = list(map(int,input().split()))
zeroes = []
for i in range(len(l)):
if l[i]==0:
zeroes.append(i)
zero = -1
for i in range(n):
zeroes.append(zeroes[-1])
s = ""
for i in range(len(l)):
if i > zeroes[zero+1]:
zero += 1
if l[i]==0:
s +=" 0"
else:
try:
s += " "+str(min(abs(i-zeroes[zero]),abs(i-zeroes[zero+1]),abs(i-zeroes[zero+2])))
except:
s += " "+str(min(abs(zeroes[zero+1]-i),abs(i-zeroes[zero])))
print(s[1:])
|
Title: Distances to Zero
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given the array of integer numbers *a*0,<=*a*1,<=...,<=*a**n*<=-<=1. For each element find the distance to the nearest zero (to the element which equals to zero). There is at least one zero element in the given array.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=2·105) — length of the array *a*. The second line contains integer elements of the array separated by single spaces (<=-<=109<=≤<=*a**i*<=≤<=109).
Output Specification:
Print the sequence *d*0,<=*d*1,<=...,<=*d**n*<=-<=1, where *d**i* is the difference of indices between *i* and nearest *j* such that *a**j*<==<=0. It is possible that *i*<==<=*j*.
Demo Input:
['9\n2 1 0 3 0 0 3 2 4\n', '5\n0 1 2 3 4\n', '7\n5 6 0 1 -2 3 4\n']
Demo Output:
['2 1 0 1 0 0 1 2 3 ', '0 1 2 3 4 ', '2 1 0 1 2 3 4 ']
Note:
none
|
```python
n = int(input())
l = list(map(int,input().split()))
zeroes = []
for i in range(len(l)):
if l[i]==0:
zeroes.append(i)
zero = -1
for i in range(n):
zeroes.append(zeroes[-1])
s = ""
for i in range(len(l)):
if i > zeroes[zero+1]:
zero += 1
if l[i]==0:
s +=" 0"
else:
try:
s += " "+str(min(abs(i-zeroes[zero]),abs(i-zeroes[zero+1]),abs(i-zeroes[zero+2])))
except:
s += " "+str(min(abs(zeroes[zero+1]-i),abs(i-zeroes[zero])))
print(s[1:])
```
| 3
|
|
891
|
A
|
Pride
|
PROGRAMMING
| 1,500
|
[
"brute force",
"dp",
"greedy",
"math",
"number theory"
] | null | null |
You have an array *a* with length *n*, you can perform operations. Each operation is like this: choose two adjacent elements from *a*, say *x* and *y*, and replace one of them with *gcd*(*x*,<=*y*), where *gcd* denotes the [greatest common divisor](https://en.wikipedia.org/wiki/Greatest_common_divisor).
What is the minimum number of operations you need to make all of the elements equal to 1?
|
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=2000) — the number of elements in the array.
The second line contains *n* space separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the array.
|
Print -1, if it is impossible to turn all numbers to 1. Otherwise, print the minimum number of operations needed to make all numbers equal to 1.
|
[
"5\n2 2 3 4 6\n",
"4\n2 4 6 8\n",
"3\n2 6 9\n"
] |
[
"5\n",
"-1\n",
"4\n"
] |
In the first sample you can turn all numbers to 1 using the following 5 moves:
- [2, 2, 3, 4, 6]. - [2, 1, 3, 4, 6] - [2, 1, 3, 1, 6] - [2, 1, 1, 1, 6] - [1, 1, 1, 1, 6] - [1, 1, 1, 1, 1]
We can prove that in this case it is not possible to make all numbers one using less than 5 moves.
| 500
|
[
{
"input": "5\n2 2 3 4 6",
"output": "5"
},
{
"input": "4\n2 4 6 8",
"output": "-1"
},
{
"input": "3\n2 6 9",
"output": "4"
},
{
"input": "15\n10 10 10 10 10 10 21 21 21 21 21 21 21 21 21",
"output": "15"
},
{
"input": "12\n10 10 14 14 14 14 14 14 14 14 21 21",
"output": "20"
},
{
"input": "5\n10 10 14 21 21",
"output": "6"
},
{
"input": "9\n10 10 10 10 10 14 14 21 21",
"output": "11"
},
{
"input": "9\n10 10 10 10 10 10 10 10 21",
"output": "9"
},
{
"input": "13\n10 10 10 15 15 15 15 15 15 15 15 21 21",
"output": "21"
},
{
"input": "15\n10 10 10 10 10 10 10 10 10 10 10 10 15 15 21",
"output": "17"
},
{
"input": "4\n1 1 1 1",
"output": "0"
},
{
"input": "1\n3",
"output": "-1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n1000000000 1000000000",
"output": "-1"
},
{
"input": "1\n1000000000",
"output": "-1"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "3\n42 15 35",
"output": "4"
},
{
"input": "3\n6 10 15",
"output": "4"
},
{
"input": "4\n2 1 1 1",
"output": "1"
},
{
"input": "5\n2 1 1 1 2",
"output": "2"
},
{
"input": "3\n30 14 21",
"output": "4"
},
{
"input": "3\n15 6 10",
"output": "4"
},
{
"input": "4\n1 1 1 2",
"output": "1"
},
{
"input": "5\n1 1 1 2 2",
"output": "2"
},
{
"input": "4\n2 6 9 1",
"output": "3"
},
{
"input": "6\n2 3 4 1 1 1",
"output": "3"
},
{
"input": "15\n2 6 6 6 3 3 3 15 5 5 5 7 5 5 5",
"output": "15"
},
{
"input": "5\n2 3 2 6 9",
"output": "5"
},
{
"input": "6\n6 15 10 6 15 10",
"output": "7"
}
] | 1,557,479,503
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 52
| 1,263
| 716,800
|
from functools import reduce
def gcd(a, b):
if b == 0:
return a
return gcd(b, a % b)
n = int(input())
a = list(map(int, input().split(" ")))
if a.count(1) > 0:
print(n - a.count(1))
exit(0)
c = reduce(gcd, a)
if (c != 1):
print(-1)
exit(0)
c = n
for i in range(0, n-1):
g = a[i]
for j in range(i+1, n):
g = gcd(g, a[j])
if g == 1:
c = min(c, j-i)
break
print(c+n-1)
|
Title: Pride
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have an array *a* with length *n*, you can perform operations. Each operation is like this: choose two adjacent elements from *a*, say *x* and *y*, and replace one of them with *gcd*(*x*,<=*y*), where *gcd* denotes the [greatest common divisor](https://en.wikipedia.org/wiki/Greatest_common_divisor).
What is the minimum number of operations you need to make all of the elements equal to 1?
Input Specification:
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=2000) — the number of elements in the array.
The second line contains *n* space separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the array.
Output Specification:
Print -1, if it is impossible to turn all numbers to 1. Otherwise, print the minimum number of operations needed to make all numbers equal to 1.
Demo Input:
['5\n2 2 3 4 6\n', '4\n2 4 6 8\n', '3\n2 6 9\n']
Demo Output:
['5\n', '-1\n', '4\n']
Note:
In the first sample you can turn all numbers to 1 using the following 5 moves:
- [2, 2, 3, 4, 6]. - [2, 1, 3, 4, 6] - [2, 1, 3, 1, 6] - [2, 1, 1, 1, 6] - [1, 1, 1, 1, 6] - [1, 1, 1, 1, 1]
We can prove that in this case it is not possible to make all numbers one using less than 5 moves.
|
```python
from functools import reduce
def gcd(a, b):
if b == 0:
return a
return gcd(b, a % b)
n = int(input())
a = list(map(int, input().split(" ")))
if a.count(1) > 0:
print(n - a.count(1))
exit(0)
c = reduce(gcd, a)
if (c != 1):
print(-1)
exit(0)
c = n
for i in range(0, n-1):
g = a[i]
for j in range(i+1, n):
g = gcd(g, a[j])
if g == 1:
c = min(c, j-i)
break
print(c+n-1)
```
| 3
|
|
591
|
A
|
Wizards' Duel
|
PROGRAMMING
| 900
|
[
"implementation",
"math"
] | null | null |
Harry Potter and He-Who-Must-Not-Be-Named engaged in a fight to the death once again. This time they are located at opposite ends of the corridor of length *l*. Two opponents simultaneously charge a deadly spell in the enemy. We know that the impulse of Harry's magic spell flies at a speed of *p* meters per second, and the impulse of You-Know-Who's magic spell flies at a speed of *q* meters per second.
The impulses are moving through the corridor toward each other, and at the time of the collision they turn round and fly back to those who cast them without changing their original speeds. Then, as soon as the impulse gets back to it's caster, the wizard reflects it and sends again towards the enemy, without changing the original speed of the impulse.
Since Harry has perfectly mastered the basics of magic, he knows that after the second collision both impulses will disappear, and a powerful explosion will occur exactly in the place of their collision. However, the young wizard isn't good at math, so he asks you to calculate the distance from his position to the place of the second meeting of the spell impulses, provided that the opponents do not change positions during the whole fight.
|
The first line of the input contains a single integer *l* (1<=≤<=*l*<=≤<=1<=000) — the length of the corridor where the fight takes place.
The second line contains integer *p*, the third line contains integer *q* (1<=≤<=*p*,<=*q*<=≤<=500) — the speeds of magical impulses for Harry Potter and He-Who-Must-Not-Be-Named, respectively.
|
Print a single real number — the distance from the end of the corridor, where Harry is located, to the place of the second meeting of the spell impulses. Your answer will be considered correct if its absolute or relative error will not exceed 10<=-<=4.
Namely: let's assume that your answer equals *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if .
|
[
"100\n50\n50\n",
"199\n60\n40\n"
] |
[
"50\n",
"119.4\n"
] |
In the first sample the speeds of the impulses are equal, so both of their meetings occur exactly in the middle of the corridor.
| 500
|
[
{
"input": "100\n50\n50",
"output": "50"
},
{
"input": "199\n60\n40",
"output": "119.4"
},
{
"input": "1\n1\n1",
"output": "0.5"
},
{
"input": "1\n1\n500",
"output": "0.001996007984"
},
{
"input": "1\n500\n1",
"output": "0.998003992"
},
{
"input": "1\n500\n500",
"output": "0.5"
},
{
"input": "1000\n1\n1",
"output": "500"
},
{
"input": "1000\n1\n500",
"output": "1.996007984"
},
{
"input": "1000\n500\n1",
"output": "998.003992"
},
{
"input": "1000\n500\n500",
"output": "500"
},
{
"input": "101\n11\n22",
"output": "33.66666667"
},
{
"input": "987\n1\n3",
"output": "246.75"
},
{
"input": "258\n25\n431",
"output": "14.14473684"
},
{
"input": "979\n39\n60",
"output": "385.6666667"
},
{
"input": "538\n479\n416",
"output": "287.9351955"
},
{
"input": "583\n112\n248",
"output": "181.3777778"
},
{
"input": "978\n467\n371",
"output": "545.0190931"
},
{
"input": "980\n322\n193",
"output": "612.7378641"
},
{
"input": "871\n401\n17",
"output": "835.576555"
},
{
"input": "349\n478\n378",
"output": "194.885514"
},
{
"input": "425\n458\n118",
"output": "337.9340278"
},
{
"input": "919\n323\n458",
"output": "380.0729834"
},
{
"input": "188\n59\n126",
"output": "59.95675676"
},
{
"input": "644\n428\n484",
"output": "302.2280702"
},
{
"input": "253\n80\n276",
"output": "56.85393258"
},
{
"input": "745\n152\n417",
"output": "199.0158172"
},
{
"input": "600\n221\n279",
"output": "265.2"
},
{
"input": "690\n499\n430",
"output": "370.6243272"
},
{
"input": "105\n68\n403",
"output": "15.15923567"
},
{
"input": "762\n462\n371",
"output": "422.6218487"
},
{
"input": "903\n460\n362",
"output": "505.3284672"
},
{
"input": "886\n235\n95",
"output": "630.9393939"
},
{
"input": "655\n203\n18",
"output": "601.6515837"
},
{
"input": "718\n29\n375",
"output": "51.53960396"
},
{
"input": "296\n467\n377",
"output": "163.7819905"
},
{
"input": "539\n61\n56",
"output": "281.017094"
},
{
"input": "133\n53\n124",
"output": "39.82485876"
},
{
"input": "998\n224\n65",
"output": "773.5363322"
},
{
"input": "961\n173\n47",
"output": "755.6954545"
},
{
"input": "285\n468\n62",
"output": "251.6603774"
},
{
"input": "496\n326\n429",
"output": "214.1668874"
},
{
"input": "627\n150\n285",
"output": "216.2068966"
},
{
"input": "961\n443\n50",
"output": "863.535497"
},
{
"input": "623\n422\n217",
"output": "411.4334898"
},
{
"input": "678\n295\n29",
"output": "617.3148148"
}
] | 1,696,414,132
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 45
| 93
| 0
|
l = int(input())
p = int(input())
q = int(input())
s = l/(p+q)
print(p*s)
|
Title: Wizards' Duel
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Harry Potter and He-Who-Must-Not-Be-Named engaged in a fight to the death once again. This time they are located at opposite ends of the corridor of length *l*. Two opponents simultaneously charge a deadly spell in the enemy. We know that the impulse of Harry's magic spell flies at a speed of *p* meters per second, and the impulse of You-Know-Who's magic spell flies at a speed of *q* meters per second.
The impulses are moving through the corridor toward each other, and at the time of the collision they turn round and fly back to those who cast them without changing their original speeds. Then, as soon as the impulse gets back to it's caster, the wizard reflects it and sends again towards the enemy, without changing the original speed of the impulse.
Since Harry has perfectly mastered the basics of magic, he knows that after the second collision both impulses will disappear, and a powerful explosion will occur exactly in the place of their collision. However, the young wizard isn't good at math, so he asks you to calculate the distance from his position to the place of the second meeting of the spell impulses, provided that the opponents do not change positions during the whole fight.
Input Specification:
The first line of the input contains a single integer *l* (1<=≤<=*l*<=≤<=1<=000) — the length of the corridor where the fight takes place.
The second line contains integer *p*, the third line contains integer *q* (1<=≤<=*p*,<=*q*<=≤<=500) — the speeds of magical impulses for Harry Potter and He-Who-Must-Not-Be-Named, respectively.
Output Specification:
Print a single real number — the distance from the end of the corridor, where Harry is located, to the place of the second meeting of the spell impulses. Your answer will be considered correct if its absolute or relative error will not exceed 10<=-<=4.
Namely: let's assume that your answer equals *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if .
Demo Input:
['100\n50\n50\n', '199\n60\n40\n']
Demo Output:
['50\n', '119.4\n']
Note:
In the first sample the speeds of the impulses are equal, so both of their meetings occur exactly in the middle of the corridor.
|
```python
l = int(input())
p = int(input())
q = int(input())
s = l/(p+q)
print(p*s)
```
| 3
|
|
239
|
A
|
Two Bags of Potatoes
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation",
"math"
] | null | null |
Valera had two bags of potatoes, the first of these bags contains *x* (*x*<=≥<=1) potatoes, and the second — *y* (*y*<=≥<=1) potatoes. Valera — very scattered boy, so the first bag of potatoes (it contains *x* potatoes) Valera lost. Valera remembers that the total amount of potatoes (*x*<=+<=*y*) in the two bags, firstly, was not gerater than *n*, and, secondly, was divisible by *k*.
Help Valera to determine how many potatoes could be in the first bag. Print all such possible numbers in ascending order.
|
The first line of input contains three integers *y*, *k*, *n* (1<=≤<=*y*,<=*k*,<=*n*<=≤<=109; <=≤<=105).
|
Print the list of whitespace-separated integers — all possible values of *x* in ascending order. You should print each possible value of *x* exactly once.
If there are no such values of *x* print a single integer -1.
|
[
"10 1 10\n",
"10 6 40\n"
] |
[
"-1\n",
"2 8 14 20 26 \n"
] |
none
| 500
|
[
{
"input": "10 1 10",
"output": "-1"
},
{
"input": "10 6 40",
"output": "2 8 14 20 26 "
},
{
"input": "10 1 20",
"output": "1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "1 10000 1000000000",
"output": "9999 19999 29999 39999 49999 59999 69999 79999 89999 99999 109999 119999 129999 139999 149999 159999 169999 179999 189999 199999 209999 219999 229999 239999 249999 259999 269999 279999 289999 299999 309999 319999 329999 339999 349999 359999 369999 379999 389999 399999 409999 419999 429999 439999 449999 459999 469999 479999 489999 499999 509999 519999 529999 539999 549999 559999 569999 579999 589999 599999 609999 619999 629999 639999 649999 659999 669999 679999 689999 699999 709999 719999 729999 739999 7499..."
},
{
"input": "84817 1 33457",
"output": "-1"
},
{
"input": "21 37 99",
"output": "16 53 "
},
{
"input": "78 7 15",
"output": "-1"
},
{
"input": "74 17 27",
"output": "-1"
},
{
"input": "79 23 43",
"output": "-1"
},
{
"input": "32 33 3",
"output": "-1"
},
{
"input": "55 49 44",
"output": "-1"
},
{
"input": "64 59 404",
"output": "54 113 172 231 290 "
},
{
"input": "61 69 820",
"output": "8 77 146 215 284 353 422 491 560 629 698 "
},
{
"input": "17 28 532",
"output": "11 39 67 95 123 151 179 207 235 263 291 319 347 375 403 431 459 487 515 "
},
{
"input": "46592 52 232",
"output": "-1"
},
{
"input": "1541 58 648",
"output": "-1"
},
{
"input": "15946 76 360",
"output": "-1"
},
{
"input": "30351 86 424",
"output": "-1"
},
{
"input": "1 2 37493",
"output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 101 103 105 107 109 111 113 115 117 119 121 123 125 127 129 131 133 135 137 139 141 143 145 147 149 151 153 155 157 159 161 163 165 167 169 171 173 175 177 179 181 183 185 187 189 191 193 195 197 199 201 203 205 207 209 211 213 215 217 219 221 223 225 227 229 231 233 235 237 239 241 243 245 247 249 251 253 255 257 259 261 263 265 267 269 271 273 275 277 279 281 28..."
},
{
"input": "1 3 27764",
"output": "2 5 8 11 14 17 20 23 26 29 32 35 38 41 44 47 50 53 56 59 62 65 68 71 74 77 80 83 86 89 92 95 98 101 104 107 110 113 116 119 122 125 128 131 134 137 140 143 146 149 152 155 158 161 164 167 170 173 176 179 182 185 188 191 194 197 200 203 206 209 212 215 218 221 224 227 230 233 236 239 242 245 248 251 254 257 260 263 266 269 272 275 278 281 284 287 290 293 296 299 302 305 308 311 314 317 320 323 326 329 332 335 338 341 344 347 350 353 356 359 362 365 368 371 374 377 380 383 386 389 392 395 398 401 404 407 410..."
},
{
"input": "10 4 9174",
"output": "2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 102 106 110 114 118 122 126 130 134 138 142 146 150 154 158 162 166 170 174 178 182 186 190 194 198 202 206 210 214 218 222 226 230 234 238 242 246 250 254 258 262 266 270 274 278 282 286 290 294 298 302 306 310 314 318 322 326 330 334 338 342 346 350 354 358 362 366 370 374 378 382 386 390 394 398 402 406 410 414 418 422 426 430 434 438 442 446 450 454 458 462 466 470 474 478 482 486 490 494 498 502 506 510 514 518 522 526 530 534 53..."
},
{
"input": "33 7 4971",
"output": "2 9 16 23 30 37 44 51 58 65 72 79 86 93 100 107 114 121 128 135 142 149 156 163 170 177 184 191 198 205 212 219 226 233 240 247 254 261 268 275 282 289 296 303 310 317 324 331 338 345 352 359 366 373 380 387 394 401 408 415 422 429 436 443 450 457 464 471 478 485 492 499 506 513 520 527 534 541 548 555 562 569 576 583 590 597 604 611 618 625 632 639 646 653 660 667 674 681 688 695 702 709 716 723 730 737 744 751 758 765 772 779 786 793 800 807 814 821 828 835 842 849 856 863 870 877 884 891 898 905 912 919..."
},
{
"input": "981 1 3387",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "386 1 2747",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "123 2 50000",
"output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 101 103 105 107 109 111 113 115 117 119 121 123 125 127 129 131 133 135 137 139 141 143 145 147 149 151 153 155 157 159 161 163 165 167 169 171 173 175 177 179 181 183 185 187 189 191 193 195 197 199 201 203 205 207 209 211 213 215 217 219 221 223 225 227 229 231 233 235 237 239 241 243 245 247 249 251 253 255 257 259 261 263 265 267 269 271 273 275 277 279 281 28..."
},
{
"input": "3123 100 10000000",
"output": "77 177 277 377 477 577 677 777 877 977 1077 1177 1277 1377 1477 1577 1677 1777 1877 1977 2077 2177 2277 2377 2477 2577 2677 2777 2877 2977 3077 3177 3277 3377 3477 3577 3677 3777 3877 3977 4077 4177 4277 4377 4477 4577 4677 4777 4877 4977 5077 5177 5277 5377 5477 5577 5677 5777 5877 5977 6077 6177 6277 6377 6477 6577 6677 6777 6877 6977 7077 7177 7277 7377 7477 7577 7677 7777 7877 7977 8077 8177 8277 8377 8477 8577 8677 8777 8877 8977 9077 9177 9277 9377 9477 9577 9677 9777 9877 9977 10077 10177 10277 1037..."
},
{
"input": "2 10000 1000000000",
"output": "9998 19998 29998 39998 49998 59998 69998 79998 89998 99998 109998 119998 129998 139998 149998 159998 169998 179998 189998 199998 209998 219998 229998 239998 249998 259998 269998 279998 289998 299998 309998 319998 329998 339998 349998 359998 369998 379998 389998 399998 409998 419998 429998 439998 449998 459998 469998 479998 489998 499998 509998 519998 529998 539998 549998 559998 569998 579998 589998 599998 609998 619998 629998 639998 649998 659998 669998 679998 689998 699998 709998 719998 729998 739998 7499..."
},
{
"input": "3 10000 1000000000",
"output": "9997 19997 29997 39997 49997 59997 69997 79997 89997 99997 109997 119997 129997 139997 149997 159997 169997 179997 189997 199997 209997 219997 229997 239997 249997 259997 269997 279997 289997 299997 309997 319997 329997 339997 349997 359997 369997 379997 389997 399997 409997 419997 429997 439997 449997 459997 469997 479997 489997 499997 509997 519997 529997 539997 549997 559997 569997 579997 589997 599997 609997 619997 629997 639997 649997 659997 669997 679997 689997 699997 709997 719997 729997 739997 7499..."
},
{
"input": "12312223 10000 1000000000",
"output": "7777 17777 27777 37777 47777 57777 67777 77777 87777 97777 107777 117777 127777 137777 147777 157777 167777 177777 187777 197777 207777 217777 227777 237777 247777 257777 267777 277777 287777 297777 307777 317777 327777 337777 347777 357777 367777 377777 387777 397777 407777 417777 427777 437777 447777 457777 467777 477777 487777 497777 507777 517777 527777 537777 547777 557777 567777 577777 587777 597777 607777 617777 627777 637777 647777 657777 667777 677777 687777 697777 707777 717777 727777 737777 7477..."
},
{
"input": "500000000 1000000000 1000000000",
"output": "500000000 "
},
{
"input": "1 1000000000 1000000000",
"output": "999999999 "
},
{
"input": "10 6 11",
"output": "-1"
},
{
"input": "2 100 10",
"output": "-1"
},
{
"input": "1 100000007 1000000000",
"output": "100000006 200000013 300000020 400000027 500000034 600000041 700000048 800000055 900000062 "
},
{
"input": "1 999999999 1000000000",
"output": "999999998 "
},
{
"input": "100000000 1000000000 1000000000",
"output": "900000000 "
},
{
"input": "11 2 12",
"output": "1 "
},
{
"input": "31 10 39",
"output": "-1"
},
{
"input": "48 6 50",
"output": "-1"
},
{
"input": "500000000 500000000 1000000000",
"output": "500000000 "
},
{
"input": "1 1000000000 999999999",
"output": "-1"
},
{
"input": "4 2 10",
"output": "2 4 6 "
},
{
"input": "1000000000 1 1",
"output": "-1"
},
{
"input": "1000000000 1 100000",
"output": "-1"
},
{
"input": "1000000000 1 10",
"output": "-1"
},
{
"input": "10 5 14",
"output": "-1"
},
{
"input": "500000000 499999999 1000000000",
"output": "499999998 "
},
{
"input": "1 999999997 1000000000",
"output": "999999996 "
}
] | 1,609,789,035
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 48
| 654
| 6,656,000
|
def STR(): return list(input())
def INT(): return int(input())
def MAP(): return map(int, input().split())
def MAP2():return map(float,input().split())
def LIST(): return list(map(int, input().split()))
def STRING(): return input()
import string
import sys
from heapq import heappop , heappush
from bisect import *
from collections import deque , Counter
from math import *
from itertools import permutations , accumulate
dx = [-1 , 1 , 0 , 0 ]
dy = [0 , 0 , 1 , - 1]
#visited = [[False for i in range(m)] for j in range(n)]
#sys.stdin = open(r'input.txt' , 'r')
#sys.stdout = open(r'output.txt' , 'w')
#for tt in range(INT()):
y , k , n = MAP()
x = k
d = [x]
while x <= n:
x+=k
d.append(x)
#print(x)
#print(d)
ans = []
for i in d :
if i > y and i <= n :
z = i - y
ans.append(z)
if len(ans) == 0 :
print('-1')
exit(0)
ans.sort()
print(*ans)
|
Title: Two Bags of Potatoes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera had two bags of potatoes, the first of these bags contains *x* (*x*<=≥<=1) potatoes, and the second — *y* (*y*<=≥<=1) potatoes. Valera — very scattered boy, so the first bag of potatoes (it contains *x* potatoes) Valera lost. Valera remembers that the total amount of potatoes (*x*<=+<=*y*) in the two bags, firstly, was not gerater than *n*, and, secondly, was divisible by *k*.
Help Valera to determine how many potatoes could be in the first bag. Print all such possible numbers in ascending order.
Input Specification:
The first line of input contains three integers *y*, *k*, *n* (1<=≤<=*y*,<=*k*,<=*n*<=≤<=109; <=≤<=105).
Output Specification:
Print the list of whitespace-separated integers — all possible values of *x* in ascending order. You should print each possible value of *x* exactly once.
If there are no such values of *x* print a single integer -1.
Demo Input:
['10 1 10\n', '10 6 40\n']
Demo Output:
['-1\n', '2 8 14 20 26 \n']
Note:
none
|
```python
def STR(): return list(input())
def INT(): return int(input())
def MAP(): return map(int, input().split())
def MAP2():return map(float,input().split())
def LIST(): return list(map(int, input().split()))
def STRING(): return input()
import string
import sys
from heapq import heappop , heappush
from bisect import *
from collections import deque , Counter
from math import *
from itertools import permutations , accumulate
dx = [-1 , 1 , 0 , 0 ]
dy = [0 , 0 , 1 , - 1]
#visited = [[False for i in range(m)] for j in range(n)]
#sys.stdin = open(r'input.txt' , 'r')
#sys.stdout = open(r'output.txt' , 'w')
#for tt in range(INT()):
y , k , n = MAP()
x = k
d = [x]
while x <= n:
x+=k
d.append(x)
#print(x)
#print(d)
ans = []
for i in d :
if i > y and i <= n :
z = i - y
ans.append(z)
if len(ans) == 0 :
print('-1')
exit(0)
ans.sort()
print(*ans)
```
| 3
|
|
71
|
A
|
Way Too Long Words
|
PROGRAMMING
| 800
|
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500
|
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,673,018,530
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 20
| 62
| 0
|
t=int(input())
for _ in range(t):
s=input()
n=len(s)
if n>10:
print(s[0]+str(n-2)+s[n-1])
else:
print(s)
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
t=int(input())
for _ in range(t):
s=input()
n=len(s)
if n>10:
print(s[0]+str(n-2)+s[n-1])
else:
print(s)
```
| 3.969
|
279
|
B
|
Books
|
PROGRAMMING
| 1,400
|
[
"binary search",
"brute force",
"implementation",
"two pointers"
] | null | null |
When Valera has got some free time, he goes to the library to read some books. Today he's got *t* free minutes to read. That's why Valera took *n* books in the library and for each book he estimated the time he is going to need to read it. Let's number the books by integers from 1 to *n*. Valera needs *a**i* minutes to read the *i*-th book.
Valera decided to choose an arbitrary book with number *i* and read the books one by one, starting from this book. In other words, he will first read book number *i*, then book number *i*<=+<=1, then book number *i*<=+<=2 and so on. He continues the process until he either runs out of the free time or finishes reading the *n*-th book. Valera reads each book up to the end, that is, he doesn't start reading the book if he doesn't have enough free time to finish reading it.
Print the maximum number of books Valera can read.
|
The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=105; 1<=≤<=*t*<=≤<=109) — the number of books and the number of free minutes Valera's got. The second line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104), where number *a**i* shows the number of minutes that the boy needs to read the *i*-th book.
|
Print a single integer — the maximum number of books Valera can read.
|
[
"4 5\n3 1 2 1\n",
"3 3\n2 2 3\n"
] |
[
"3\n",
"1\n"
] |
none
| 1,000
|
[
{
"input": "4 5\n3 1 2 1",
"output": "3"
},
{
"input": "3 3\n2 2 3",
"output": "1"
},
{
"input": "1 3\n5",
"output": "0"
},
{
"input": "1 10\n4",
"output": "1"
},
{
"input": "2 10\n6 4",
"output": "2"
},
{
"input": "6 10\n2 3 4 2 1 1",
"output": "4"
},
{
"input": "7 13\n6 8 14 9 4 11 10",
"output": "2"
},
{
"input": "10 15\n10 9 1 1 5 10 5 3 7 2",
"output": "3"
},
{
"input": "20 30\n8 1 2 6 9 4 1 9 9 10 4 7 8 9 5 7 1 8 7 4",
"output": "6"
},
{
"input": "30 60\n16 13 22 38 13 35 17 17 20 38 12 19 9 22 20 3 35 34 34 21 35 40 22 3 27 19 12 4 8 19",
"output": "4"
},
{
"input": "100 100\n75 92 18 6 81 67 7 92 100 65 82 32 50 67 85 31 80 91 84 63 39 52 92 81 1 98 24 12 43 48 17 86 51 72 48 95 45 50 12 66 19 79 49 89 34 1 97 75 20 33 96 27 42 23 73 71 93 1 85 19 66 14 17 61 20 39 36 33 42 61 56 64 23 91 80 99 40 74 13 18 98 85 74 39 62 84 46 74 50 23 38 11 79 14 9 25 66 100 25 52",
"output": "3"
},
{
"input": "10 1\n4418 7528 8170 1736 1317 3205 8183 4995 8039 4708",
"output": "0"
},
{
"input": "50 2\n124 214 63 73 996 760 38 571 451 300 970 1 706 937 837 494 619 88 851 411 957 990 842 613 821 649 627 34 693 678 734 116 816 985 705 940 499 493 922 967 854 439 112 644 961 438 189 572 655 550",
"output": "1"
}
] | 1,681,034,849
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 38
| 312
| 6,451,200
|
n,k = map(int,input().split())
P = list(map(int,input().split()))
L,R,Sum,ans =0,0,0,0
for i in range(0,len(P)):
Sum+=P[R]
while(Sum>k):
Sum-=P[L]
L+=1
ans = max(ans,R-L+1)
R+=1
print(ans)
|
Title: Books
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
When Valera has got some free time, he goes to the library to read some books. Today he's got *t* free minutes to read. That's why Valera took *n* books in the library and for each book he estimated the time he is going to need to read it. Let's number the books by integers from 1 to *n*. Valera needs *a**i* minutes to read the *i*-th book.
Valera decided to choose an arbitrary book with number *i* and read the books one by one, starting from this book. In other words, he will first read book number *i*, then book number *i*<=+<=1, then book number *i*<=+<=2 and so on. He continues the process until he either runs out of the free time or finishes reading the *n*-th book. Valera reads each book up to the end, that is, he doesn't start reading the book if he doesn't have enough free time to finish reading it.
Print the maximum number of books Valera can read.
Input Specification:
The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=105; 1<=≤<=*t*<=≤<=109) — the number of books and the number of free minutes Valera's got. The second line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104), where number *a**i* shows the number of minutes that the boy needs to read the *i*-th book.
Output Specification:
Print a single integer — the maximum number of books Valera can read.
Demo Input:
['4 5\n3 1 2 1\n', '3 3\n2 2 3\n']
Demo Output:
['3\n', '1\n']
Note:
none
|
```python
n,k = map(int,input().split())
P = list(map(int,input().split()))
L,R,Sum,ans =0,0,0,0
for i in range(0,len(P)):
Sum+=P[R]
while(Sum>k):
Sum-=P[L]
L+=1
ans = max(ans,R-L+1)
R+=1
print(ans)
```
| 3
|
|
79
|
A
|
Bus Game
|
PROGRAMMING
| 1,200
|
[
"greedy"
] |
A. Bus Game
|
2
|
256
|
After Fox Ciel won an onsite round of a programming contest, she took a bus to return to her castle. The fee of the bus was 220 yen. She met Rabbit Hanako in the bus. They decided to play the following game because they got bored in the bus.
- Initially, there is a pile that contains *x* 100-yen coins and *y* 10-yen coins. - They take turns alternatively. Ciel takes the first turn. - In each turn, they must take exactly 220 yen from the pile. In Ciel's turn, if there are multiple ways to take 220 yen, she will choose the way that contains the maximal number of 100-yen coins. In Hanako's turn, if there are multiple ways to take 220 yen, she will choose the way that contains the maximal number of 10-yen coins. - If Ciel or Hanako can't take exactly 220 yen from the pile, she loses.
Determine the winner of the game.
|
The first line contains two integers *x* (0<=≤<=*x*<=≤<=106) and *y* (0<=≤<=*y*<=≤<=106), separated by a single space.
|
If Ciel wins, print "Ciel". Otherwise, print "Hanako".
|
[
"2 2\n",
"3 22\n"
] |
[
"Ciel\n",
"Hanako\n"
] |
In the first turn (Ciel's turn), she will choose 2 100-yen coins and 2 10-yen coins. In the second turn (Hanako's turn), she will choose 1 100-yen coin and 12 10-yen coins. In the third turn (Ciel's turn), she can't pay exactly 220 yen, so Ciel will lose.
| 500
|
[
{
"input": "2 2",
"output": "Ciel"
},
{
"input": "3 22",
"output": "Hanako"
},
{
"input": "0 22",
"output": "Ciel"
},
{
"input": "1000 1000",
"output": "Ciel"
},
{
"input": "0 0",
"output": "Hanako"
},
{
"input": "0 21",
"output": "Hanako"
},
{
"input": "1 11",
"output": "Hanako"
},
{
"input": "1 12",
"output": "Ciel"
},
{
"input": "2 1",
"output": "Hanako"
},
{
"input": "2 23",
"output": "Ciel"
},
{
"input": "2 24",
"output": "Hanako"
},
{
"input": "3 1",
"output": "Hanako"
},
{
"input": "3 2",
"output": "Ciel"
},
{
"input": "3 13",
"output": "Ciel"
},
{
"input": "3 14",
"output": "Hanako"
},
{
"input": "4 1",
"output": "Hanako"
},
{
"input": "4 2",
"output": "Ciel"
},
{
"input": "4 25",
"output": "Hanako"
},
{
"input": "4 26",
"output": "Ciel"
},
{
"input": "5 1",
"output": "Hanako"
},
{
"input": "5 2",
"output": "Ciel"
},
{
"input": "5 15",
"output": "Hanako"
},
{
"input": "5 16",
"output": "Ciel"
},
{
"input": "5 23",
"output": "Ciel"
},
{
"input": "5 24",
"output": "Hanako"
},
{
"input": "6 1",
"output": "Hanako"
},
{
"input": "6 2",
"output": "Ciel"
},
{
"input": "6 13",
"output": "Ciel"
},
{
"input": "6 14",
"output": "Hanako"
},
{
"input": "6 23",
"output": "Ciel"
},
{
"input": "6 24",
"output": "Hanako"
},
{
"input": "7 1",
"output": "Hanako"
},
{
"input": "7 2",
"output": "Ciel"
},
{
"input": "7 13",
"output": "Ciel"
},
{
"input": "7 14",
"output": "Hanako"
},
{
"input": "7 25",
"output": "Hanako"
},
{
"input": "7 26",
"output": "Ciel"
},
{
"input": "8 1",
"output": "Hanako"
},
{
"input": "8 2",
"output": "Ciel"
},
{
"input": "8 15",
"output": "Hanako"
},
{
"input": "8 16",
"output": "Ciel"
},
{
"input": "8 25",
"output": "Hanako"
},
{
"input": "8 26",
"output": "Ciel"
},
{
"input": "9 1",
"output": "Hanako"
},
{
"input": "9 2",
"output": "Ciel"
},
{
"input": "9 15",
"output": "Hanako"
},
{
"input": "9 16",
"output": "Ciel"
},
{
"input": "9 23",
"output": "Ciel"
},
{
"input": "9 24",
"output": "Hanako"
},
{
"input": "10 12",
"output": "Ciel"
},
{
"input": "10 13",
"output": "Ciel"
},
{
"input": "10 22",
"output": "Ciel"
},
{
"input": "10 23",
"output": "Ciel"
},
{
"input": "11 12",
"output": "Ciel"
},
{
"input": "11 13",
"output": "Ciel"
},
{
"input": "11 24",
"output": "Hanako"
},
{
"input": "11 25",
"output": "Hanako"
},
{
"input": "12 14",
"output": "Hanako"
},
{
"input": "12 15",
"output": "Hanako"
},
{
"input": "12 24",
"output": "Hanako"
},
{
"input": "12 25",
"output": "Hanako"
},
{
"input": "0 1000000",
"output": "Hanako"
},
{
"input": "1000000 0",
"output": "Hanako"
},
{
"input": "1000000 1000000",
"output": "Ciel"
},
{
"input": "178087 42116",
"output": "Ciel"
},
{
"input": "378897 104123",
"output": "Ciel"
},
{
"input": "61207 166129",
"output": "Hanako"
},
{
"input": "743519 228136",
"output": "Ciel"
},
{
"input": "425829 771644",
"output": "Ciel"
},
{
"input": "626640 833651",
"output": "Ciel"
},
{
"input": "308950 895657",
"output": "Hanako"
},
{
"input": "991262 957664",
"output": "Ciel"
},
{
"input": "192071 19670",
"output": "Hanako"
},
{
"input": "874382 81677",
"output": "Hanako"
},
{
"input": "202081 745873",
"output": "Hanako"
},
{
"input": "233663 723781",
"output": "Hanako"
},
{
"input": "783744 701689",
"output": "Hanako"
},
{
"input": "333825 679597",
"output": "Hanako"
},
{
"input": "365407 657504",
"output": "Hanako"
},
{
"input": "915488 635412",
"output": "Hanako"
},
{
"input": "947070 613320",
"output": "Hanako"
},
{
"input": "497151 591228",
"output": "Hanako"
},
{
"input": "528732 87635",
"output": "Ciel"
},
{
"input": "78813 65543",
"output": "Hanako"
},
{
"input": "6 4",
"output": "Hanako"
},
{
"input": "3 5",
"output": "Ciel"
},
{
"input": "4 24",
"output": "Hanako"
},
{
"input": "2 14",
"output": "Ciel"
},
{
"input": "2 26",
"output": "Hanako"
},
{
"input": "5 26",
"output": "Ciel"
},
{
"input": "5 5",
"output": "Hanako"
},
{
"input": "359 479",
"output": "Hanako"
},
{
"input": "1 20",
"output": "Ciel"
},
{
"input": "11 0",
"output": "Hanako"
},
{
"input": "3 0",
"output": "Hanako"
},
{
"input": "0 30",
"output": "Ciel"
},
{
"input": "0 35",
"output": "Ciel"
},
{
"input": "100 99",
"output": "Ciel"
},
{
"input": "3 4",
"output": "Ciel"
}
] | 1,553,776,107
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 99
| 280
| 0
|
hundred, ten = [int(x) for x in input().split()]
total = 100*hundred + 10*ten
#reduce by number of rounds where Ciel can take 2 100-yen and 2 10-yen, and Hanako can take 22 10-yen
skipped = min(hundred//2,ten//24)
hundred = hundred - 2*skipped
ten = ten - 24*skipped
while True:
win = 0
if hundred >= 2 and ten >= 2:
hundred = hundred - 2
ten = ten - 2
elif hundred >= 1 and ten >= 12:
hundred = hundred - 1
ten = ten - 12
elif ten >= 22:
ten = ten - 22
else:
break
win = 1
if ten >= 22:
ten = ten - 22
elif hundred >= 1 and ten >= 12:
hundred = hundred - 1
ten = ten - 12
elif hundred >= 2 and ten >= 2:
hundred = hundred - 2
ten = ten - 2
else:
break
if win == 0:
print ("Hanako")
else:
print ("Ciel")
|
Title: Bus Game
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
After Fox Ciel won an onsite round of a programming contest, she took a bus to return to her castle. The fee of the bus was 220 yen. She met Rabbit Hanako in the bus. They decided to play the following game because they got bored in the bus.
- Initially, there is a pile that contains *x* 100-yen coins and *y* 10-yen coins. - They take turns alternatively. Ciel takes the first turn. - In each turn, they must take exactly 220 yen from the pile. In Ciel's turn, if there are multiple ways to take 220 yen, she will choose the way that contains the maximal number of 100-yen coins. In Hanako's turn, if there are multiple ways to take 220 yen, she will choose the way that contains the maximal number of 10-yen coins. - If Ciel or Hanako can't take exactly 220 yen from the pile, she loses.
Determine the winner of the game.
Input Specification:
The first line contains two integers *x* (0<=≤<=*x*<=≤<=106) and *y* (0<=≤<=*y*<=≤<=106), separated by a single space.
Output Specification:
If Ciel wins, print "Ciel". Otherwise, print "Hanako".
Demo Input:
['2 2\n', '3 22\n']
Demo Output:
['Ciel\n', 'Hanako\n']
Note:
In the first turn (Ciel's turn), she will choose 2 100-yen coins and 2 10-yen coins. In the second turn (Hanako's turn), she will choose 1 100-yen coin and 12 10-yen coins. In the third turn (Ciel's turn), she can't pay exactly 220 yen, so Ciel will lose.
|
```python
hundred, ten = [int(x) for x in input().split()]
total = 100*hundred + 10*ten
#reduce by number of rounds where Ciel can take 2 100-yen and 2 10-yen, and Hanako can take 22 10-yen
skipped = min(hundred//2,ten//24)
hundred = hundred - 2*skipped
ten = ten - 24*skipped
while True:
win = 0
if hundred >= 2 and ten >= 2:
hundred = hundred - 2
ten = ten - 2
elif hundred >= 1 and ten >= 12:
hundred = hundred - 1
ten = ten - 12
elif ten >= 22:
ten = ten - 22
else:
break
win = 1
if ten >= 22:
ten = ten - 22
elif hundred >= 1 and ten >= 12:
hundred = hundred - 1
ten = ten - 12
elif hundred >= 2 and ten >= 2:
hundred = hundred - 2
ten = ten - 2
else:
break
if win == 0:
print ("Hanako")
else:
print ("Ciel")
```
| 3.93
|
612
|
B
|
HDD is Outdated Technology
|
PROGRAMMING
| 1,200
|
[
"implementation",
"math"
] | null | null |
HDD hard drives group data by sectors. All files are split to fragments and each of them are written in some sector of hard drive. Note the fragments can be written in sectors in arbitrary order.
One of the problems of HDD hard drives is the following: the magnetic head should move from one sector to another to read some file.
Find the time need to read file split to *n* fragments. The *i*-th sector contains the *f**i*-th fragment of the file (1<=≤<=*f**i*<=≤<=*n*). Note different sectors contains the different fragments. At the start the magnetic head is in the position that contains the first fragment. The file are reading in the following manner: at first the first fragment is read, then the magnetic head moves to the sector that contains the second fragment, then the second fragment is read and so on until the *n*-th fragment is read. The fragments are read in the order from the first to the *n*-th.
It takes |*a*<=-<=*b*| time units to move the magnetic head from the sector *a* to the sector *b*. Reading a fragment takes no time.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of fragments.
The second line contains *n* different integers *f**i* (1<=≤<=*f**i*<=≤<=*n*) — the number of the fragment written in the *i*-th sector.
|
Print the only integer — the number of time units needed to read the file.
|
[
"3\n3 1 2\n",
"5\n1 3 5 4 2\n"
] |
[
"3\n",
"10\n"
] |
In the second example the head moves in the following way:
- 1->2 means movement from the sector 1 to the sector 5, i.e. it takes 4 time units - 2->3 means movement from the sector 5 to the sector 2, i.e. it takes 3 time units - 3->4 means movement from the sector 2 to the sector 4, i.e. it takes 2 time units - 4->5 means movement from the sector 4 to the sector 3, i.e. it takes 1 time units
So the answer to the second example is 4 + 3 + 2 + 1 = 10.
| 0
|
[
{
"input": "3\n3 1 2",
"output": "3"
},
{
"input": "5\n1 3 5 4 2",
"output": "10"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "10\n8 2 10 3 4 6 1 7 9 5",
"output": "40"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "9"
},
{
"input": "10\n1 3 5 7 9 10 8 6 4 2",
"output": "45"
},
{
"input": "100\n11 9 35 34 51 74 16 67 26 21 14 80 84 79 7 61 28 3 53 43 42 5 56 36 69 30 22 88 1 27 65 91 46 31 59 50 17 96 25 18 64 55 78 2 63 24 95 48 93 13 38 76 89 94 15 90 45 81 52 87 83 73 44 49 23 82 85 75 86 33 47 19 58 97 37 20 40 10 92 4 6 68 77 54 71 12 62 60 100 39 41 99 72 29 57 8 70 32 66 98",
"output": "3580"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "99"
},
{
"input": "100\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 100 98 96 94 92 90 88 86 84 82 80 78 76 74 72 70 68 66 64 62 60 58 56 54 52 50 48 46 44 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2",
"output": "4950"
}
] | 1,636,027,470
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 24
| 234
| 22,528,000
|
n = int(input())
values = list(map(int,input().split()))
hm = {}
for i, v in enumerate(values):
hm[v] = i
ans = 0
for i in range(1,n):
ans += abs(hm[i+1]-hm[i])
print(ans)
|
Title: HDD is Outdated Technology
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
HDD hard drives group data by sectors. All files are split to fragments and each of them are written in some sector of hard drive. Note the fragments can be written in sectors in arbitrary order.
One of the problems of HDD hard drives is the following: the magnetic head should move from one sector to another to read some file.
Find the time need to read file split to *n* fragments. The *i*-th sector contains the *f**i*-th fragment of the file (1<=≤<=*f**i*<=≤<=*n*). Note different sectors contains the different fragments. At the start the magnetic head is in the position that contains the first fragment. The file are reading in the following manner: at first the first fragment is read, then the magnetic head moves to the sector that contains the second fragment, then the second fragment is read and so on until the *n*-th fragment is read. The fragments are read in the order from the first to the *n*-th.
It takes |*a*<=-<=*b*| time units to move the magnetic head from the sector *a* to the sector *b*. Reading a fragment takes no time.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of fragments.
The second line contains *n* different integers *f**i* (1<=≤<=*f**i*<=≤<=*n*) — the number of the fragment written in the *i*-th sector.
Output Specification:
Print the only integer — the number of time units needed to read the file.
Demo Input:
['3\n3 1 2\n', '5\n1 3 5 4 2\n']
Demo Output:
['3\n', '10\n']
Note:
In the second example the head moves in the following way:
- 1->2 means movement from the sector 1 to the sector 5, i.e. it takes 4 time units - 2->3 means movement from the sector 5 to the sector 2, i.e. it takes 3 time units - 3->4 means movement from the sector 2 to the sector 4, i.e. it takes 2 time units - 4->5 means movement from the sector 4 to the sector 3, i.e. it takes 1 time units
So the answer to the second example is 4 + 3 + 2 + 1 = 10.
|
```python
n = int(input())
values = list(map(int,input().split()))
hm = {}
for i, v in enumerate(values):
hm[v] = i
ans = 0
for i in range(1,n):
ans += abs(hm[i+1]-hm[i])
print(ans)
```
| 3
|
|
409
|
H
|
A + B Strikes Back
|
PROGRAMMING
| 1,500
|
[
"*special",
"brute force",
"constructive algorithms",
"dsu",
"implementation"
] | null | null |
A + B is often used as an example of the easiest problem possible to show some contest platform. However, some scientists have observed that sometimes this problem is not so easy to get accepted. Want to try?
|
The input contains two integers *a* and *b* (0<=≤<=*a*,<=*b*<=≤<=103), separated by a single space.
|
Output the sum of the given integers.
|
[
"5 14\n",
"381 492\n"
] |
[
"19\n",
"873\n"
] |
none
| 0
|
[
{
"input": "5 14",
"output": "19"
},
{
"input": "381 492",
"output": "873"
},
{
"input": "536 298",
"output": "834"
},
{
"input": "143 522",
"output": "665"
},
{
"input": "433 126",
"output": "559"
},
{
"input": "723 350",
"output": "1073"
},
{
"input": "632 264",
"output": "896"
},
{
"input": "923 488",
"output": "1411"
},
{
"input": "522 92",
"output": "614"
},
{
"input": "953 553",
"output": "1506"
},
{
"input": "242 86",
"output": "328"
},
{
"input": "151 691",
"output": "842"
},
{
"input": "441 915",
"output": "1356"
},
{
"input": "740 519",
"output": "1259"
},
{
"input": "339 433",
"output": "772"
},
{
"input": "629 657",
"output": "1286"
},
{
"input": "538 261",
"output": "799"
},
{
"input": "828 485",
"output": "1313"
},
{
"input": "117 399",
"output": "516"
},
{
"input": "399 280",
"output": "679"
}
] | 1,658,573,100
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 46
| 0
|
a, b = map(int, input().split(' '))
p = a + b
print(p)
|
Title: A + B Strikes Back
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A + B is often used as an example of the easiest problem possible to show some contest platform. However, some scientists have observed that sometimes this problem is not so easy to get accepted. Want to try?
Input Specification:
The input contains two integers *a* and *b* (0<=≤<=*a*,<=*b*<=≤<=103), separated by a single space.
Output Specification:
Output the sum of the given integers.
Demo Input:
['5 14\n', '381 492\n']
Demo Output:
['19\n', '873\n']
Note:
none
|
```python
a, b = map(int, input().split(' '))
p = a + b
print(p)
```
| 3
|
|
41
|
A
|
Translation
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Translation
|
2
|
256
|
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
|
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
|
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
|
[
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,684,506,962
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 92
| 0
|
a = input()
b = input()
q = 0
if len(a) == len(b):
for i in range(len(a)):
if a[i] != b[len(a) - 1 - i]:
q += 1
break
if q == 1:
print("NO")
else:
print("YES")
else:
print("NO")
|
Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
a = input()
b = input()
q = 0
if len(a) == len(b):
for i in range(len(a)):
if a[i] != b[len(a) - 1 - i]:
q += 1
break
if q == 1:
print("NO")
else:
print("YES")
else:
print("NO")
```
| 3.977
|
842
|
B
|
Gleb And Pizza
|
PROGRAMMING
| 1,100
|
[
"geometry"
] | null | null |
Gleb ordered pizza home. When the courier delivered the pizza, he was very upset, because several pieces of sausage lay on the crust, and he does not really like the crust.
The pizza is a circle of radius *r* and center at the origin. Pizza consists of the main part — circle of radius *r*<=-<=*d* with center at the origin, and crust around the main part of the width *d*. Pieces of sausage are also circles. The radius of the *i* -th piece of the sausage is *r**i*, and the center is given as a pair (*x**i*, *y**i*).
Gleb asks you to help determine the number of pieces of sausage caught on the crust. A piece of sausage got on the crust, if it completely lies on the crust.
|
First string contains two integer numbers *r* and *d* (0<=≤<=*d*<=<<=*r*<=≤<=500) — the radius of pizza and the width of crust.
Next line contains one integer number *n* — the number of pieces of sausage (1<=≤<=*n*<=≤<=105).
Each of next *n* lines contains three integer numbers *x**i*, *y**i* and *r**i* (<=-<=500<=≤<=*x**i*,<=*y**i*<=≤<=500, 0<=≤<=*r**i*<=≤<=500), where *x**i* and *y**i* are coordinates of the center of *i*-th peace of sausage, *r**i* — radius of *i*-th peace of sausage.
|
Output the number of pieces of sausage that lay on the crust.
|
[
"8 4\n7\n7 8 1\n-7 3 2\n0 2 1\n0 -2 2\n-3 -3 1\n0 6 2\n5 3 1\n",
"10 8\n4\n0 0 9\n0 0 10\n1 0 1\n1 0 2\n"
] |
[
"2\n",
"0\n"
] |
Below is a picture explaining the first example. Circles of green color denote pieces of sausage lying on the crust.
| 1,000
|
[
{
"input": "8 4\n7\n7 8 1\n-7 3 2\n0 2 1\n0 -2 2\n-3 -3 1\n0 6 2\n5 3 1",
"output": "2"
},
{
"input": "10 8\n4\n0 0 9\n0 0 10\n1 0 1\n1 0 2",
"output": "0"
},
{
"input": "1 0\n1\n1 1 0",
"output": "0"
},
{
"input": "3 0\n5\n3 0 0\n0 3 0\n-3 0 0\n0 -3 0\n3 0 1",
"output": "4"
},
{
"input": "9 0\n5\n8 1 0\n8 2 0\n8 3 0\n-8 3 0\n-8 2 0",
"output": "0"
},
{
"input": "10 2\n11\n1 1 0\n2 2 3\n3 3 0\n4 4 0\n5 5 0\n6 6 0\n7 7 4\n8 8 7\n9 9 3\n10 10 100\n9 0 1",
"output": "2"
},
{
"input": "5 3\n1\n500 500 10",
"output": "0"
}
] | 1,594,629,029
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 34
| 920
| 34,406,400
|
from math import sqrt
dist = lambda p: sqrt(sum([d*d for d in p]))
inCrust = lambda l,r,rl,rr: (l-r)>=rl and (l+r)<=rr
rr,d = list(map(int,input().split())) #500
xyrl = [list(map(int,input().split())) for _ in range(int(input()))]
print(sum([inCrust(dist(xyr[:2]),xyr[2],rr-d,rr) for xyr in xyrl]))
|
Title: Gleb And Pizza
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Gleb ordered pizza home. When the courier delivered the pizza, he was very upset, because several pieces of sausage lay on the crust, and he does not really like the crust.
The pizza is a circle of radius *r* and center at the origin. Pizza consists of the main part — circle of radius *r*<=-<=*d* with center at the origin, and crust around the main part of the width *d*. Pieces of sausage are also circles. The radius of the *i* -th piece of the sausage is *r**i*, and the center is given as a pair (*x**i*, *y**i*).
Gleb asks you to help determine the number of pieces of sausage caught on the crust. A piece of sausage got on the crust, if it completely lies on the crust.
Input Specification:
First string contains two integer numbers *r* and *d* (0<=≤<=*d*<=<<=*r*<=≤<=500) — the radius of pizza and the width of crust.
Next line contains one integer number *n* — the number of pieces of sausage (1<=≤<=*n*<=≤<=105).
Each of next *n* lines contains three integer numbers *x**i*, *y**i* and *r**i* (<=-<=500<=≤<=*x**i*,<=*y**i*<=≤<=500, 0<=≤<=*r**i*<=≤<=500), where *x**i* and *y**i* are coordinates of the center of *i*-th peace of sausage, *r**i* — radius of *i*-th peace of sausage.
Output Specification:
Output the number of pieces of sausage that lay on the crust.
Demo Input:
['8 4\n7\n7 8 1\n-7 3 2\n0 2 1\n0 -2 2\n-3 -3 1\n0 6 2\n5 3 1\n', '10 8\n4\n0 0 9\n0 0 10\n1 0 1\n1 0 2\n']
Demo Output:
['2\n', '0\n']
Note:
Below is a picture explaining the first example. Circles of green color denote pieces of sausage lying on the crust.
|
```python
from math import sqrt
dist = lambda p: sqrt(sum([d*d for d in p]))
inCrust = lambda l,r,rl,rr: (l-r)>=rl and (l+r)<=rr
rr,d = list(map(int,input().split())) #500
xyrl = [list(map(int,input().split())) for _ in range(int(input()))]
print(sum([inCrust(dist(xyr[:2]),xyr[2],rr-d,rr) for xyr in xyrl]))
```
| 3
|
|
478
|
B
|
Random Teams
|
PROGRAMMING
| 1,300
|
[
"combinatorics",
"constructive algorithms",
"greedy",
"math"
] | null | null |
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends.
Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
|
The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively.
|
The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
|
[
"5 1\n",
"3 2\n",
"6 3\n"
] |
[
"10 10\n",
"1 1\n",
"3 6\n"
] |
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends.
In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one.
In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
| 1,000
|
[
{
"input": "5 1",
"output": "10 10"
},
{
"input": "3 2",
"output": "1 1"
},
{
"input": "6 3",
"output": "3 6"
},
{
"input": "5 3",
"output": "2 3"
},
{
"input": "10 2",
"output": "20 36"
},
{
"input": "10 6",
"output": "4 10"
},
{
"input": "1000000000 1",
"output": "499999999500000000 499999999500000000"
},
{
"input": "5000000 12",
"output": "1041664166668 12499942500066"
},
{
"input": "1833 195",
"output": "7722 1342341"
},
{
"input": "1000000000 1000000000",
"output": "0 0"
},
{
"input": "1000000000 1000000",
"output": "499500000000 499000500499500000"
},
{
"input": "1000000000 32170",
"output": "15541930838100 499967831017438365"
},
{
"input": "1000000 1000",
"output": "499500000 499000999500"
},
{
"input": "1234 1123",
"output": "111 6216"
},
{
"input": "599222887 298488",
"output": "601178656545 179355218158217800"
},
{
"input": "999999999 500000000",
"output": "499999999 124999999750000000"
},
{
"input": "1000000000 384842119",
"output": "845473643 189209609585784021"
},
{
"input": "1000000000 384842119",
"output": "845473643 189209609585784021"
},
{
"input": "1000000000 2",
"output": "249999999500000000 499999998500000001"
},
{
"input": "1000000000 999999999",
"output": "1 1"
},
{
"input": "38447 383",
"output": "1910550 724453080"
},
{
"input": "100000000 99999799",
"output": "201 20301"
},
{
"input": "1 1",
"output": "0 0"
},
{
"input": "2 1",
"output": "1 1"
},
{
"input": "2 2",
"output": "0 0"
},
{
"input": "10 10",
"output": "0 0"
}
] | 1,651,936,565
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 26
| 62
| 0
|
n, m = map(int, input().split())
q = n // m
r = n % m
mn = m * q * (q - 1) // 2 + r * q
mx = (n - m + 1) * (n - m) // 2
print(mn, mx)
|
Title: Random Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends.
Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
Input Specification:
The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively.
Output Specification:
The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
Demo Input:
['5 1\n', '3 2\n', '6 3\n']
Demo Output:
['10 10\n', '1 1\n', '3 6\n']
Note:
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends.
In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one.
In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
|
```python
n, m = map(int, input().split())
q = n // m
r = n % m
mn = m * q * (q - 1) // 2 + r * q
mx = (n - m + 1) * (n - m) // 2
print(mn, mx)
```
| 3
|
|
721
|
A
|
One-dimensional Japanese Crossword
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=×<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)).
Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=×<=*n*), which he wants to encrypt in the same way as in japanese crossword.
Help Adaltik find the numbers encrypting the row he drew.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W' — to white square in the row that Adaltik drew).
|
The first line should contain a single integer *k* — the number of integers encrypting the row, e.g. the number of groups of black squares in the row.
The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right.
|
[
"3\nBBW\n",
"5\nBWBWB\n",
"4\nWWWW\n",
"4\nBBBB\n",
"13\nWBBBBWWBWBBBW\n"
] |
[
"1\n2 ",
"3\n1 1 1 ",
"0\n",
"1\n4 ",
"3\n4 1 3 "
] |
The last sample case correspond to the picture in the statement.
| 500
|
[
{
"input": "3\nBBW",
"output": "1\n2 "
},
{
"input": "5\nBWBWB",
"output": "3\n1 1 1 "
},
{
"input": "4\nWWWW",
"output": "0"
},
{
"input": "4\nBBBB",
"output": "1\n4 "
},
{
"input": "13\nWBBBBWWBWBBBW",
"output": "3\n4 1 3 "
},
{
"input": "1\nB",
"output": "1\n1 "
},
{
"input": "2\nBB",
"output": "1\n2 "
},
{
"input": "100\nWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWB",
"output": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "1\nW",
"output": "0"
},
{
"input": "2\nWW",
"output": "0"
},
{
"input": "2\nWB",
"output": "1\n1 "
},
{
"input": "2\nBW",
"output": "1\n1 "
},
{
"input": "3\nBBB",
"output": "1\n3 "
},
{
"input": "3\nBWB",
"output": "2\n1 1 "
},
{
"input": "3\nWBB",
"output": "1\n2 "
},
{
"input": "3\nWWB",
"output": "1\n1 "
},
{
"input": "3\nWBW",
"output": "1\n1 "
},
{
"input": "3\nBWW",
"output": "1\n1 "
},
{
"input": "3\nWWW",
"output": "0"
},
{
"input": "100\nBBBWWWWWWBBWWBBWWWBBWBBBBBBBBBBBWBBBWBBWWWBBWWBBBWBWWBBBWWBBBWBBBBBWWWBWWBBWWWWWWBWBBWWBWWWBWBWWWWWB",
"output": "21\n3 2 2 2 11 3 2 2 3 1 3 3 5 1 2 1 2 1 1 1 1 "
},
{
"input": "5\nBBBWB",
"output": "2\n3 1 "
},
{
"input": "5\nBWWWB",
"output": "2\n1 1 "
},
{
"input": "5\nWWWWB",
"output": "1\n1 "
},
{
"input": "5\nBWWWW",
"output": "1\n1 "
},
{
"input": "5\nBBBWW",
"output": "1\n3 "
},
{
"input": "5\nWWBBB",
"output": "1\n3 "
},
{
"input": "10\nBBBBBWWBBB",
"output": "2\n5 3 "
},
{
"input": "10\nBBBBWBBWBB",
"output": "3\n4 2 2 "
},
{
"input": "20\nBBBBBWWBWBBWBWWBWBBB",
"output": "6\n5 1 2 1 1 3 "
},
{
"input": "20\nBBBWWWWBBWWWBWBWWBBB",
"output": "5\n3 2 1 1 3 "
},
{
"input": "20\nBBBBBBBBWBBBWBWBWBBB",
"output": "5\n8 3 1 1 3 "
},
{
"input": "20\nBBBWBWBWWWBBWWWWBWBB",
"output": "6\n3 1 1 2 1 2 "
},
{
"input": "40\nBBBBBBWWWWBWBWWWBWWWWWWWWWWWBBBBBBBBBBBB",
"output": "5\n6 1 1 1 12 "
},
{
"input": "40\nBBBBBWBWWWBBWWWBWBWWBBBBWWWWBWBWBBBBBBBB",
"output": "9\n5 1 2 1 1 4 1 1 8 "
},
{
"input": "50\nBBBBBBBBBBBWWWWBWBWWWWBBBBBBBBWWWWWWWBWWWWBWBBBBBB",
"output": "7\n11 1 1 8 1 1 6 "
},
{
"input": "50\nWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW",
"output": "0"
},
{
"input": "50\nBBBBBWWWWWBWWWBWWWWWBWWWBWWWWWWBBWBBWWWWBWWWWWWWBW",
"output": "9\n5 1 1 1 1 2 2 1 1 "
},
{
"input": "50\nWWWWBWWBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWBWWWWWWWBBBBB",
"output": "6\n1 1 1 1 1 5 "
},
{
"input": "50\nBBBBBWBWBWWBWBWWWWWWBWBWBWWWWWWWWWWWWWBWBWWWWBWWWB",
"output": "12\n5 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n50 "
},
{
"input": "100\nBBBBBBBBBBBWBWWWWBWWBBWBBWWWWWWWWWWBWBWWBWWWWWWWWWWWBBBWWBBWWWWWBWBWWWWBWWWWWWWWWWWBWWWWWBBBBBBBBBBB",
"output": "15\n11 1 1 2 2 1 1 1 3 2 1 1 1 1 11 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n100 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBWBWBWWWWWBWWWWWWWWWWWWWWBBWWWBWWWWBWWBWWWWWWBWWWWWWWWWWWWWBWBBBBBBBBBBBBBBBBBBBB",
"output": "11\n20 1 1 1 2 1 1 1 1 1 20 "
},
{
"input": "100\nBBBBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWWWWWBWBWWWWWWBBWWWWWWWWWWWWBWWWWBWWWWWWWWWWWWBWWWWWWWBWWWWWWWBBBBBB",
"output": "11\n4 1 1 1 1 2 1 1 1 1 6 "
},
{
"input": "5\nBWBWB",
"output": "3\n1 1 1 "
},
{
"input": "10\nWWBWWWBWBB",
"output": "3\n1 1 2 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n50 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "2\n17 31 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "2\n24 42 "
},
{
"input": "90\nWWBWWBWBBWBBWWBWBWBBBWBWBBBWBWBWBWBWBWBWBWBBBBBWBBWWWWBWBBWBWWBBBWBWBWWBWBWBWBWWWWWWBWBBBB",
"output": "30\n1 1 2 2 1 1 3 1 3 1 1 1 1 1 1 1 5 2 1 2 1 3 1 1 1 1 1 1 1 4 "
},
{
"input": "100\nBWWWBWBWBBBBBWBWWBWBWWWBWBWBWWBBWWBBBWBBBWWBWBWWBBBBWBWBBBWBWBBWWWWWWBWWBBBBWBWBWWBWBWWWBWBWWBWBWWWB",
"output": "31\n1 1 1 5 1 1 1 1 1 1 2 3 3 1 1 4 1 3 1 2 1 4 1 1 1 1 1 1 1 1 1 "
},
{
"input": "90\nWBWBBBBBBWWWBBWWBWWWBBWWBWWWBWBBWBWBBWWWWBWBWBBWBBWBWWWBBWBBWWWWBWBBWWWBBBWBBWBWBBBBWWBWWB",
"output": "25\n1 6 2 1 2 1 1 2 1 2 1 1 2 2 1 2 2 1 2 3 2 1 4 1 1 "
},
{
"input": "80\nBBWWBBBWBBWWWWBBWBWBBWWWWWBWBBWWBWBWBWBWBWWBWWBWWWBWBBWBBWBBWBBBWWBBBBBBBWBBBWBB",
"output": "23\n2 3 2 2 1 2 1 2 1 1 1 1 1 1 1 1 2 2 2 3 7 3 2 "
},
{
"input": "65\nWWWWBWWWBBBBBWWWWWWBBBWWBBBBWWWWWWWWBBBWWWWBWBWWBBWWWWBWWWBBWBBBB",
"output": "11\n1 5 3 4 3 1 1 2 1 2 4 "
}
] | 1,642,324,816
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 54
| 93
| 0
|
n=int(input())
s=input().split('W')
m=[]
for i in range(len(s)):
if len(s[i])>0:
m.append(len(s[i]))
print(len(m))
print(*m)
|
Title: One-dimensional Japanese Crossword
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=×<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)).
Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=×<=*n*), which he wants to encrypt in the same way as in japanese crossword.
Help Adaltik find the numbers encrypting the row he drew.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W' — to white square in the row that Adaltik drew).
Output Specification:
The first line should contain a single integer *k* — the number of integers encrypting the row, e.g. the number of groups of black squares in the row.
The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right.
Demo Input:
['3\nBBW\n', '5\nBWBWB\n', '4\nWWWW\n', '4\nBBBB\n', '13\nWBBBBWWBWBBBW\n']
Demo Output:
['1\n2 ', '3\n1 1 1 ', '0\n', '1\n4 ', '3\n4 1 3 ']
Note:
The last sample case correspond to the picture in the statement.
|
```python
n=int(input())
s=input().split('W')
m=[]
for i in range(len(s)):
if len(s[i])>0:
m.append(len(s[i]))
print(len(m))
print(*m)
```
| 3
|
|
379
|
A
|
New Year Candles
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
|
The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000).
|
Print a single integer — the number of hours Vasily can light up the room for.
|
[
"4 2\n",
"6 3\n"
] |
[
"7\n",
"8\n"
] |
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
| 500
|
[
{
"input": "4 2",
"output": "7"
},
{
"input": "6 3",
"output": "8"
},
{
"input": "1000 1000",
"output": "1001"
},
{
"input": "123 5",
"output": "153"
},
{
"input": "1000 2",
"output": "1999"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "2 2",
"output": "3"
},
{
"input": "3 2",
"output": "5"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "999 2",
"output": "1997"
},
{
"input": "1000 3",
"output": "1499"
},
{
"input": "1000 4",
"output": "1333"
},
{
"input": "1 1000",
"output": "1"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "10 4",
"output": "13"
},
{
"input": "4 3",
"output": "5"
},
{
"input": "91 5",
"output": "113"
},
{
"input": "777 17",
"output": "825"
},
{
"input": "100 4",
"output": "133"
},
{
"input": "5 3",
"output": "7"
},
{
"input": "6 4",
"output": "7"
},
{
"input": "26 8",
"output": "29"
},
{
"input": "9 4",
"output": "11"
},
{
"input": "20 3",
"output": "29"
},
{
"input": "17 3",
"output": "25"
}
] | 1,688,903,450
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 46
| 0
|
a,b = map(int,input().split())
time = 0
ost = 0
while a > 0 :
time += a
ost += a
a = 0
a += ost // b
ost = ost % b
print(time)
|
Title: New Year Candles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
Input Specification:
The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000).
Output Specification:
Print a single integer — the number of hours Vasily can light up the room for.
Demo Input:
['4 2\n', '6 3\n']
Demo Output:
['7\n', '8\n']
Note:
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
|
```python
a,b = map(int,input().split())
time = 0
ost = 0
while a > 0 :
time += a
ost += a
a = 0
a += ost // b
ost = ost % b
print(time)
```
| 3
|
|
263
|
A
|
Beautiful Matrix
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix:
1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=<<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=<<=5).
You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
|
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
|
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
|
[
"0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n",
"0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n"
] |
[
"3\n",
"1\n"
] |
none
| 500
|
[
{
"input": "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "0"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1",
"output": "4"
},
{
"input": "0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0",
"output": "4"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0",
"output": "3"
}
] | 1,698,246,134
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 92
| 0
|
# Read the input matrix
matrix = []
for i in range(5):
row = list(map(int, input().split()))
matrix.append(row)
# Find the row and column indices of the number 1
row_index = -1
col_index = -1
for i in range(5):
for j in range(5):
if matrix[i][j] == 1:
row_index = i
col_index = j
break
if row_index != -1:
break
# Calculate the number of moves needed to move the 1 to the center of the matrix
moves = abs(row_index - 2) + abs(col_index - 2)
# Output the number of moves
print(moves)
|
Title: Beautiful Matrix
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix:
1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=<<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=<<=5).
You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
Input Specification:
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
Output Specification:
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
Demo Input:
['0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n', '0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n']
Demo Output:
['3\n', '1\n']
Note:
none
|
```python
# Read the input matrix
matrix = []
for i in range(5):
row = list(map(int, input().split()))
matrix.append(row)
# Find the row and column indices of the number 1
row_index = -1
col_index = -1
for i in range(5):
for j in range(5):
if matrix[i][j] == 1:
row_index = i
col_index = j
break
if row_index != -1:
break
# Calculate the number of moves needed to move the 1 to the center of the matrix
moves = abs(row_index - 2) + abs(col_index - 2)
# Output the number of moves
print(moves)
```
| 3
|
|
139
|
A
|
Petr and Book
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
One Sunday Petr went to a bookshop and bought a new book on sports programming. The book had exactly *n* pages.
Petr decided to start reading it starting from the next day, that is, from Monday. Petr's got a very tight schedule and for each day of the week he knows how many pages he will be able to read on that day. Some days are so busy that Petr will have no time to read whatsoever. However, we know that he will be able to read at least one page a week.
Assuming that Petr will not skip days and will read as much as he can every day, determine on which day of the week he will read the last page of the book.
|
The first input line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of pages in the book.
The second line contains seven non-negative space-separated integers that do not exceed 1000 — those integers represent how many pages Petr can read on Monday, Tuesday, Wednesday, Thursday, Friday, Saturday and Sunday correspondingly. It is guaranteed that at least one of those numbers is larger than zero.
|
Print a single number — the number of the day of the week, when Petr will finish reading the book. The days of the week are numbered starting with one in the natural order: Monday, Tuesday, Wednesday, Thursday, Friday, Saturday, Sunday.
|
[
"100\n15 20 20 15 10 30 45\n",
"2\n1 0 0 0 0 0 0\n"
] |
[
"6\n",
"1\n"
] |
Note to the first sample:
By the end of Monday and therefore, by the beginning of Tuesday Petr has 85 pages left. He has 65 pages left by Wednesday, 45 by Thursday, 30 by Friday, 20 by Saturday and on Saturday Petr finishes reading the book (and he also has time to read 10 pages of something else).
Note to the second sample:
On Monday of the first week Petr will read the first page. On Monday of the second week Petr will read the second page and will finish reading the book.
| 500
|
[
{
"input": "100\n15 20 20 15 10 30 45",
"output": "6"
},
{
"input": "2\n1 0 0 0 0 0 0",
"output": "1"
},
{
"input": "100\n100 200 100 200 300 400 500",
"output": "1"
},
{
"input": "3\n1 1 1 1 1 1 1",
"output": "3"
},
{
"input": "1\n1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "20\n5 3 7 2 1 6 4",
"output": "6"
},
{
"input": "10\n5 1 1 1 1 1 5",
"output": "6"
},
{
"input": "50\n10 1 10 1 10 1 10",
"output": "1"
},
{
"input": "77\n11 11 11 11 11 11 10",
"output": "1"
},
{
"input": "1\n1000 1000 1000 1000 1000 1000 1000",
"output": "1"
},
{
"input": "1000\n100 100 100 100 100 100 100",
"output": "3"
},
{
"input": "999\n10 20 10 20 30 20 10",
"output": "3"
},
{
"input": "433\n109 58 77 10 39 125 15",
"output": "7"
},
{
"input": "1\n0 0 0 0 0 0 1",
"output": "7"
},
{
"input": "5\n1 0 1 0 1 0 1",
"output": "1"
},
{
"input": "997\n1 1 0 0 1 0 1",
"output": "1"
},
{
"input": "1000\n1 1 1 1 1 1 1",
"output": "6"
},
{
"input": "1000\n1000 1000 1000 1000 1000 1000 1000",
"output": "1"
},
{
"input": "1000\n1 0 0 0 0 0 0",
"output": "1"
},
{
"input": "1000\n0 0 0 0 0 0 1",
"output": "7"
},
{
"input": "1000\n1 0 0 1 0 0 1",
"output": "1"
},
{
"input": "509\n105 23 98 0 7 0 155",
"output": "2"
},
{
"input": "7\n1 1 1 1 1 1 1",
"output": "7"
},
{
"input": "2\n1 1 0 0 0 0 0",
"output": "2"
},
{
"input": "1\n0 0 0 0 0 1 0",
"output": "6"
},
{
"input": "10\n0 0 0 0 0 0 1",
"output": "7"
},
{
"input": "5\n0 0 0 0 0 6 0",
"output": "6"
},
{
"input": "3\n0 1 0 0 0 0 0",
"output": "2"
},
{
"input": "10\n0 0 0 0 0 0 10",
"output": "7"
},
{
"input": "28\n1 2 3 4 5 6 7",
"output": "7"
},
{
"input": "100\n5 5 5 5 5 5 5",
"output": "6"
},
{
"input": "4\n1 0 0 0 0 0 1",
"output": "7"
},
{
"input": "2\n0 0 0 0 0 0 1",
"output": "7"
},
{
"input": "7\n0 0 0 0 0 0 7",
"output": "7"
},
{
"input": "7\n2 1 1 1 1 1 0",
"output": "6"
},
{
"input": "2\n0 0 1 1 0 0 0",
"output": "4"
},
{
"input": "6\n1 1 1 1 1 1 0",
"output": "6"
},
{
"input": "5\n1 1 1 0 0 1 1",
"output": "7"
},
{
"input": "100\n10 20 30 10 10 10 10",
"output": "7"
},
{
"input": "1\n0 0 0 1 0 0 0",
"output": "4"
},
{
"input": "70\n10 10 10 10 10 10 10",
"output": "7"
},
{
"input": "22\n1 2 3 4 5 6 10",
"output": "7"
},
{
"input": "5\n0 0 0 1 0 0 0",
"output": "4"
},
{
"input": "2\n0 0 0 1 0 0 0",
"output": "4"
},
{
"input": "6\n1 0 0 0 0 0 2",
"output": "7"
},
{
"input": "10\n1 2 2 1 2 1 1",
"output": "7"
},
{
"input": "5\n0 0 0 0 0 0 10",
"output": "7"
},
{
"input": "4\n0 1 1 0 0 0 0",
"output": "3"
},
{
"input": "100\n0 0 0 0 0 1 0",
"output": "6"
}
] | 1,644,554,143
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 49
| 92
| 0
|
n = int(input())
day = -1
l = list(map(int,input().split()))
while n>0:
day = (day+1)%7
n-=l[day]
print(day+1)
|
Title: Petr and Book
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One Sunday Petr went to a bookshop and bought a new book on sports programming. The book had exactly *n* pages.
Petr decided to start reading it starting from the next day, that is, from Monday. Petr's got a very tight schedule and for each day of the week he knows how many pages he will be able to read on that day. Some days are so busy that Petr will have no time to read whatsoever. However, we know that he will be able to read at least one page a week.
Assuming that Petr will not skip days and will read as much as he can every day, determine on which day of the week he will read the last page of the book.
Input Specification:
The first input line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of pages in the book.
The second line contains seven non-negative space-separated integers that do not exceed 1000 — those integers represent how many pages Petr can read on Monday, Tuesday, Wednesday, Thursday, Friday, Saturday and Sunday correspondingly. It is guaranteed that at least one of those numbers is larger than zero.
Output Specification:
Print a single number — the number of the day of the week, when Petr will finish reading the book. The days of the week are numbered starting with one in the natural order: Monday, Tuesday, Wednesday, Thursday, Friday, Saturday, Sunday.
Demo Input:
['100\n15 20 20 15 10 30 45\n', '2\n1 0 0 0 0 0 0\n']
Demo Output:
['6\n', '1\n']
Note:
Note to the first sample:
By the end of Monday and therefore, by the beginning of Tuesday Petr has 85 pages left. He has 65 pages left by Wednesday, 45 by Thursday, 30 by Friday, 20 by Saturday and on Saturday Petr finishes reading the book (and he also has time to read 10 pages of something else).
Note to the second sample:
On Monday of the first week Petr will read the first page. On Monday of the second week Petr will read the second page and will finish reading the book.
|
```python
n = int(input())
day = -1
l = list(map(int,input().split()))
while n>0:
day = (day+1)%7
n-=l[day]
print(day+1)
```
| 3
|
|
263
|
A
|
Beautiful Matrix
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix:
1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=<<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=<<=5).
You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
|
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
|
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
|
[
"0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n",
"0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n"
] |
[
"3\n",
"1\n"
] |
none
| 500
|
[
{
"input": "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "0"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1",
"output": "4"
},
{
"input": "0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0",
"output": "4"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0",
"output": "3"
}
] | 1,696,325,325
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 25
| 122
| 0
|
column = 0
row = 0
for i in range(5):
new_str = input().split(" ")
for j in range(len(new_str)):
if new_str[j] == '1':
column = j
row = i
break
ans = abs(2 - row) + abs(2 - column)
print(ans)
|
Title: Beautiful Matrix
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix:
1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=<<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=<<=5).
You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
Input Specification:
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
Output Specification:
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
Demo Input:
['0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n', '0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n']
Demo Output:
['3\n', '1\n']
Note:
none
|
```python
column = 0
row = 0
for i in range(5):
new_str = input().split(" ")
for j in range(len(new_str)):
if new_str[j] == '1':
column = j
row = i
break
ans = abs(2 - row) + abs(2 - column)
print(ans)
```
| 3
|
|
38
|
A
|
Army
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Army
|
2
|
256
|
The Berland Armed Forces System consists of *n* ranks that are numbered using natural numbers from 1 to *n*, where 1 is the lowest rank and *n* is the highest rank.
One needs exactly *d**i* years to rise from rank *i* to rank *i*<=+<=1. Reaching a certain rank *i* having not reached all the previous *i*<=-<=1 ranks is impossible.
Vasya has just reached a new rank of *a*, but he dreams of holding the rank of *b*. Find for how many more years Vasya should serve in the army until he can finally realize his dream.
|
The first input line contains an integer *n* (2<=≤<=*n*<=≤<=100). The second line contains *n*<=-<=1 integers *d**i* (1<=≤<=*d**i*<=≤<=100). The third input line contains two integers *a* and *b* (1<=≤<=*a*<=<<=*b*<=≤<=*n*). The numbers on the lines are space-separated.
|
Print the single number which is the number of years that Vasya needs to rise from rank *a* to rank *b*.
|
[
"3\n5 6\n1 2\n",
"3\n5 6\n1 3\n"
] |
[
"5\n",
"11\n"
] |
none
| 0
|
[
{
"input": "3\n5 6\n1 2",
"output": "5"
},
{
"input": "3\n5 6\n1 3",
"output": "11"
},
{
"input": "2\n55\n1 2",
"output": "55"
},
{
"input": "3\n85 78\n1 3",
"output": "163"
},
{
"input": "4\n63 4 49\n2 3",
"output": "4"
},
{
"input": "5\n93 83 42 56\n2 5",
"output": "181"
},
{
"input": "6\n22 9 87 89 57\n1 6",
"output": "264"
},
{
"input": "7\n52 36 31 23 74 78\n2 7",
"output": "242"
},
{
"input": "8\n82 14 24 5 91 49 94\n3 8",
"output": "263"
},
{
"input": "9\n12 40 69 39 59 21 59 5\n4 6",
"output": "98"
},
{
"input": "10\n95 81 32 59 71 30 50 61 100\n1 6",
"output": "338"
},
{
"input": "15\n89 55 94 4 15 69 19 60 91 77 3 94 91 62\n3 14",
"output": "617"
},
{
"input": "20\n91 1 41 51 95 67 92 35 23 70 44 91 57 50 21 8 9 71 40\n8 17",
"output": "399"
},
{
"input": "25\n70 95 21 84 97 39 12 98 53 24 78 29 84 65 70 22 100 17 69 27 62 48 35 80\n8 23",
"output": "846"
},
{
"input": "30\n35 69 50 44 19 56 86 56 98 24 21 2 61 24 85 30 2 22 57 35 59 84 12 77 92 53 50 92 9\n1 16",
"output": "730"
},
{
"input": "35\n2 34 47 15 27 61 6 88 67 20 53 65 29 68 77 5 78 86 44 98 32 81 91 79 54 84 95 23 65 97 22 33 42 87\n8 35",
"output": "1663"
},
{
"input": "40\n32 88 59 36 95 45 28 78 73 30 97 13 13 47 48 100 43 21 22 45 88 25 15 13 63 25 72 92 29 5 25 11 50 5 54 51 48 84 23\n7 26",
"output": "862"
},
{
"input": "45\n83 74 73 95 10 31 100 26 29 15 80 100 22 70 31 88 9 56 19 70 2 62 48 30 27 47 52 50 94 44 21 94 23 85 15 3 95 72 43 62 94 89 68 88\n17 40",
"output": "1061"
},
{
"input": "50\n28 8 16 29 19 82 70 51 96 84 74 72 17 69 12 21 37 21 39 3 18 66 19 49 86 96 94 93 2 90 96 84 59 88 58 15 61 33 55 22 35 54 51 29 64 68 29 38 40\n23 28",
"output": "344"
},
{
"input": "60\n24 28 25 21 43 71 64 73 71 90 51 83 69 43 75 43 78 72 56 61 99 7 23 86 9 16 16 94 23 74 18 56 20 72 13 31 75 34 35 86 61 49 4 72 84 7 65 70 66 52 21 38 6 43 69 40 73 46 5\n28 60",
"output": "1502"
},
{
"input": "70\n69 95 34 14 67 61 6 95 94 44 28 94 73 66 39 13 19 71 73 71 28 48 26 22 32 88 38 95 43 59 88 77 80 55 17 95 40 83 67 1 38 95 58 63 56 98 49 2 41 4 73 8 78 41 64 71 60 71 41 61 67 4 4 19 97 14 39 20 27\n9 41",
"output": "1767"
},
{
"input": "80\n65 15 43 6 43 98 100 16 69 98 4 54 25 40 2 35 12 23 38 29 10 89 30 6 4 8 7 96 64 43 11 49 89 38 20 59 54 85 46 16 16 89 60 54 28 37 32 34 67 9 78 30 50 87 58 53 99 48 77 3 5 6 19 99 16 20 31 10 80 76 82 56 56 83 72 81 84 60 28\n18 24",
"output": "219"
},
{
"input": "90\n61 35 100 99 67 87 42 90 44 4 81 65 29 63 66 56 53 22 55 87 39 30 34 42 27 80 29 97 85 28 81 22 50 22 24 75 67 86 78 79 94 35 13 97 48 76 68 66 94 13 82 1 22 85 5 36 86 73 65 97 43 56 35 26 87 25 74 47 81 67 73 75 99 75 53 38 70 21 66 78 38 17 57 40 93 57 68 55 1\n12 44",
"output": "1713"
},
{
"input": "95\n37 74 53 96 65 84 65 72 95 45 6 77 91 35 58 50 51 51 97 30 51 20 79 81 92 10 89 34 40 76 71 54 26 34 73 72 72 28 53 19 95 64 97 10 44 15 12 38 5 63 96 95 86 8 36 96 45 53 81 5 18 18 47 97 65 9 33 53 41 86 37 53 5 40 15 76 83 45 33 18 26 5 19 90 46 40 100 42 10 90 13 81 40 53\n6 15",
"output": "570"
},
{
"input": "96\n51 32 95 75 23 54 70 89 67 3 1 51 4 100 97 30 9 35 56 38 54 77 56 98 43 17 60 43 72 46 87 61 100 65 81 22 74 38 16 96 5 10 54 22 23 22 10 91 9 54 49 82 29 73 33 98 75 8 4 26 24 90 71 42 90 24 94 74 94 10 41 98 56 63 18 43 56 21 26 64 74 33 22 38 67 66 38 60 64 76 53 10 4 65 76\n21 26",
"output": "328"
},
{
"input": "97\n18 90 84 7 33 24 75 55 86 10 96 72 16 64 37 9 19 71 62 97 5 34 85 15 46 72 82 51 52 16 55 68 27 97 42 72 76 97 32 73 14 56 11 86 2 81 59 95 60 93 1 22 71 37 77 100 6 16 78 47 78 62 94 86 16 91 56 46 47 35 93 44 7 86 70 10 29 45 67 62 71 61 74 39 36 92 24 26 65 14 93 92 15 28 79 59\n6 68",
"output": "3385"
},
{
"input": "98\n32 47 26 86 43 42 79 72 6 68 40 46 29 80 24 89 29 7 21 56 8 92 13 33 50 79 5 7 84 85 24 23 1 80 51 21 26 55 96 51 24 2 68 98 81 88 57 100 64 84 54 10 14 2 74 1 89 71 1 20 84 85 17 31 42 58 69 67 48 60 97 90 58 10 21 29 2 21 60 61 68 89 77 39 57 18 61 44 67 100 33 74 27 40 83 29 6\n8 77",
"output": "3319"
},
{
"input": "99\n46 5 16 66 53 12 84 89 26 27 35 68 41 44 63 17 88 43 80 15 59 1 42 50 53 34 75 16 16 55 92 30 28 11 12 71 27 65 11 28 86 47 24 10 60 47 7 53 16 75 6 49 56 66 70 3 20 78 75 41 38 57 89 23 16 74 30 39 1 32 49 84 9 33 25 95 75 45 54 59 17 17 29 40 79 96 47 11 69 86 73 56 91 4 87 47 31 24\n23 36",
"output": "514"
},
{
"input": "100\n63 65 21 41 95 23 3 4 12 23 95 50 75 63 58 34 71 27 75 31 23 94 96 74 69 34 43 25 25 55 44 19 43 86 68 17 52 65 36 29 72 96 84 25 84 23 71 54 6 7 71 7 21 100 99 58 93 35 62 47 36 70 68 9 75 13 35 70 76 36 62 22 52 51 2 87 66 41 54 35 78 62 30 35 65 44 74 93 78 37 96 70 26 32 71 27 85 85 63\n43 92",
"output": "2599"
},
{
"input": "51\n85 38 22 38 42 36 55 24 36 80 49 15 66 91 88 61 46 82 1 61 89 92 6 56 28 8 46 80 56 90 91 38 38 17 69 64 57 68 13 44 45 38 8 72 61 39 87 2 73 88\n15 27",
"output": "618"
},
{
"input": "2\n3\n1 2",
"output": "3"
},
{
"input": "5\n6 8 22 22\n2 3",
"output": "8"
},
{
"input": "6\n3 12 27 28 28\n3 4",
"output": "27"
},
{
"input": "9\n1 2 2 2 2 3 3 5\n3 7",
"output": "9"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1\n6 8",
"output": "2"
},
{
"input": "20\n1 1 1 1 1 1 1 1 2 2 2 2 2 3 3 3 3 3 3\n5 17",
"output": "23"
},
{
"input": "25\n1 1 1 4 5 6 8 11 11 11 11 12 13 14 14 14 15 16 16 17 17 17 19 19\n4 8",
"output": "23"
},
{
"input": "35\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2\n30 31",
"output": "2"
},
{
"input": "45\n1 1 1 1 2 2 2 2 2 2 2 3 3 3 3 3 3 4 5 5 5 5 6 6 6 6 6 6 6 7 7 7 7 8 8 8 9 9 9 9 9 10 10 10\n42 45",
"output": "30"
},
{
"input": "50\n1 8 8 13 14 15 15 16 19 21 22 24 26 31 32 37 45 47 47 47 50 50 51 54 55 56 58 61 61 61 63 63 64 66 66 67 67 70 71 80 83 84 85 92 92 94 95 95 100\n4 17",
"output": "285"
},
{
"input": "60\n1 2 4 4 4 6 6 8 9 10 10 13 14 18 20 20 21 22 23 23 26 29 30 32 33 34 35 38 40 42 44 44 46 48 52 54 56 56 60 60 66 67 68 68 69 73 73 74 80 80 81 81 82 84 86 86 87 89 89\n56 58",
"output": "173"
},
{
"input": "70\n1 2 3 3 4 5 5 7 7 7 8 8 8 8 9 9 10 12 12 12 12 13 16 16 16 16 16 16 17 17 18 18 20 20 21 23 24 25 25 26 29 29 29 29 31 32 32 34 35 36 36 37 37 38 39 39 40 40 40 40 41 41 42 43 44 44 44 45 45\n62 65",
"output": "126"
},
{
"input": "80\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 4 4 4 4 5 5 5 5 5 5 5 6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 12 12\n17 65",
"output": "326"
},
{
"input": "90\n1 1 3 5 8 9 10 11 11 11 11 12 13 14 15 15 15 16 16 19 19 20 22 23 24 25 25 28 29 29 30 31 33 34 35 37 37 38 41 43 43 44 45 47 51 54 55 56 58 58 59 59 60 62 66 67 67 67 68 68 69 70 71 72 73 73 76 77 77 78 78 78 79 79 79 82 83 84 85 85 87 87 89 93 93 93 95 99 99\n28 48",
"output": "784"
},
{
"input": "95\n2 2 3 3 4 6 6 7 7 7 9 10 12 12 12 12 13 14 15 16 17 18 20 20 20 20 21 21 21 21 22 22 22 22 22 23 23 23 25 26 26 27 27 27 28 29 29 30 30 31 32 33 34 36 37 37 38 39 39 39 42 43 43 43 45 47 48 50 50 51 52 53 54 54 54 55 55 55 58 59 60 61 61 61 61 62 62 63 64 65 66 67 67 67\n64 93",
"output": "1636"
},
{
"input": "96\n1 1 2 3 3 5 8 9 9 10 10 10 11 11 11 11 11 12 13 13 13 14 15 15 16 16 17 17 17 17 18 18 20 20 20 21 21 21 23 24 24 25 25 26 27 27 27 27 29 29 29 30 30 30 32 32 32 32 32 32 33 33 34 34 34 35 35 35 36 36 37 37 37 38 39 40 41 41 41 41 42 42 43 43 45 45 45 46 46 47 47 49 50 52 52\n76 96",
"output": "898"
},
{
"input": "98\n2 3 4 4 5 7 8 10 10 10 11 11 12 12 12 12 13 14 15 15 16 16 18 19 19 20 21 21 21 21 22 23 24 25 26 26 27 27 27 27 29 29 30 30 31 31 37 40 40 40 41 41 41 42 43 44 44 44 46 46 47 49 49 50 50 50 51 53 55 55 56 56 56 56 56 57 57 58 59 60 60 60 62 62 63 64 64 64 65 66 66 67 68 70 70 71 71\n8 90",
"output": "3016"
},
{
"input": "99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n66 95",
"output": "29"
},
{
"input": "100\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 10 10 10 10 11 11 11 11 12 12 12 13 13 13 13 13 13 13 13 13 13 14 14 14 14 14 14 15 15 15 15 15 15 16 16 16 17 17\n39 52",
"output": "82"
},
{
"input": "51\n5 7 9 16 19 25 26 29 29 30 31 32 32 41 43 44 47 49 50 50 51 52 54 55 56 63 64 66 67 70 74 74 77 78 79 80 80 85 86 87 89 89 90 92 93 94 94 95 95 97\n3 44",
"output": "2268"
}
] | 1,531,135,907
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 50
| 218
| 0
|
n = int(input())
d = list(map(int,input().split()))
d = [0]+d
a,b = list(map(int,input().split()))
dc = [sum(d[:i]) for i in range(1, n+1)]
print(dc[b-1]-dc[a-1])
|
Title: Army
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The Berland Armed Forces System consists of *n* ranks that are numbered using natural numbers from 1 to *n*, where 1 is the lowest rank and *n* is the highest rank.
One needs exactly *d**i* years to rise from rank *i* to rank *i*<=+<=1. Reaching a certain rank *i* having not reached all the previous *i*<=-<=1 ranks is impossible.
Vasya has just reached a new rank of *a*, but he dreams of holding the rank of *b*. Find for how many more years Vasya should serve in the army until he can finally realize his dream.
Input Specification:
The first input line contains an integer *n* (2<=≤<=*n*<=≤<=100). The second line contains *n*<=-<=1 integers *d**i* (1<=≤<=*d**i*<=≤<=100). The third input line contains two integers *a* and *b* (1<=≤<=*a*<=<<=*b*<=≤<=*n*). The numbers on the lines are space-separated.
Output Specification:
Print the single number which is the number of years that Vasya needs to rise from rank *a* to rank *b*.
Demo Input:
['3\n5 6\n1 2\n', '3\n5 6\n1 3\n']
Demo Output:
['5\n', '11\n']
Note:
none
|
```python
n = int(input())
d = list(map(int,input().split()))
d = [0]+d
a,b = list(map(int,input().split()))
dc = [sum(d[:i]) for i in range(1, n+1)]
print(dc[b-1]-dc[a-1])
```
| 3.9455
|
88
|
A
|
Chord
|
PROGRAMMING
| 1,200
|
[
"brute force",
"implementation"
] |
A. Chord
|
2
|
256
|
Vasya studies music.
He has learned lots of interesting stuff. For example, he knows that there are 12 notes: C, C#, D, D#, E, F, F#, G, G#, A, B, H. He also knows that the notes are repeated cyclically: after H goes C again, and before C stands H. We will consider the C note in the row's beginning and the C note after the H similar and we will identify them with each other. The distance between the notes along the musical scale is measured in tones: between two consecutive notes there's exactly one semitone, that is, 0.5 tone. The distance is taken from the lowest tone to the uppest one, that is, the distance between C and E is 4 semitones and between E and C is 8 semitones
Vasya also knows what a chord is. A chord is an unordered set of no less than three notes. However, for now Vasya only works with triads, that is with the chords that consist of exactly three notes. He can already distinguish between two types of triads — major and minor.
Let's define a major triad. Let the triad consist of notes *X*, *Y* and *Z*. If we can order the notes so as the distance along the musical scale between *X* and *Y* equals 4 semitones and the distance between *Y* and *Z* is 3 semitones, then the triad is major. The distance between *X* and *Z*, accordingly, equals 7 semitones.
A minor triad is different in that the distance between *X* and *Y* should be 3 semitones and between *Y* and *Z* — 4 semitones.
For example, the triad "C E G" is major: between C and E are 4 semitones, and between E and G are 3 semitones. And the triplet "C# B F" is minor, because if we order the notes as "B C# F", than between B and C# will be 3 semitones, and between C# and F — 4 semitones.
Help Vasya classify the triad the teacher has given to him.
|
The only line contains 3 space-separated notes in the above-given notation.
|
Print "major" if the chord is major, "minor" if it is minor, and "strange" if the teacher gave Vasya some weird chord which is neither major nor minor. Vasya promises you that the answer will always be unambiguous. That is, there are no chords that are both major and minor simultaneously.
|
[
"C E G\n",
"C# B F\n",
"A B H\n"
] |
[
"major\n",
"minor\n",
"strange\n"
] |
none
| 500
|
[
{
"input": "C E G",
"output": "major"
},
{
"input": "C# B F",
"output": "minor"
},
{
"input": "A B H",
"output": "strange"
},
{
"input": "G H E",
"output": "minor"
},
{
"input": "D# B G",
"output": "major"
},
{
"input": "D# B F#",
"output": "minor"
},
{
"input": "F H E",
"output": "strange"
},
{
"input": "B F# G",
"output": "strange"
},
{
"input": "F# H C",
"output": "strange"
},
{
"input": "C# F C",
"output": "strange"
},
{
"input": "G# C# E",
"output": "minor"
},
{
"input": "D# H G#",
"output": "minor"
},
{
"input": "C F A",
"output": "major"
},
{
"input": "H E G#",
"output": "major"
},
{
"input": "G D# B",
"output": "major"
},
{
"input": "E C G",
"output": "major"
},
{
"input": "G# C# F",
"output": "major"
},
{
"input": "D# C G#",
"output": "major"
},
{
"input": "C# F B",
"output": "minor"
},
{
"input": "D# C G",
"output": "minor"
},
{
"input": "A D F",
"output": "minor"
},
{
"input": "F# H D",
"output": "minor"
},
{
"input": "D A F",
"output": "minor"
},
{
"input": "D A F#",
"output": "major"
},
{
"input": "C# B F",
"output": "minor"
},
{
"input": "A C F",
"output": "major"
},
{
"input": "D F# H",
"output": "minor"
},
{
"input": "H G# D#",
"output": "minor"
},
{
"input": "A D F#",
"output": "major"
},
{
"input": "H E G#",
"output": "major"
},
{
"input": "D# B F#",
"output": "minor"
},
{
"input": "D# H F#",
"output": "major"
},
{
"input": "A D F#",
"output": "major"
},
{
"input": "B G D#",
"output": "major"
},
{
"input": "E A C#",
"output": "major"
},
{
"input": "D H G",
"output": "major"
},
{
"input": "H D F#",
"output": "minor"
},
{
"input": "G D# C",
"output": "minor"
},
{
"input": "H D G",
"output": "major"
},
{
"input": "E C G",
"output": "major"
},
{
"input": "D# A E",
"output": "strange"
},
{
"input": "A F E",
"output": "strange"
},
{
"input": "C E F",
"output": "strange"
},
{
"input": "A B C",
"output": "strange"
},
{
"input": "E F D#",
"output": "strange"
},
{
"input": "C G# G#",
"output": "strange"
},
{
"input": "F D# G#",
"output": "strange"
},
{
"input": "B G D#",
"output": "major"
},
{
"input": "E E G#",
"output": "strange"
},
{
"input": "A G H",
"output": "strange"
},
{
"input": "F E A",
"output": "strange"
},
{
"input": "D B E",
"output": "strange"
},
{
"input": "G# C# D",
"output": "strange"
},
{
"input": "D# D# F#",
"output": "strange"
},
{
"input": "H B G",
"output": "strange"
},
{
"input": "D C B",
"output": "strange"
},
{
"input": "D B B",
"output": "strange"
},
{
"input": "C A H",
"output": "strange"
},
{
"input": "F# H F#",
"output": "strange"
},
{
"input": "A F F#",
"output": "strange"
},
{
"input": "C D C",
"output": "strange"
},
{
"input": "G F# A",
"output": "strange"
},
{
"input": "C C# D",
"output": "strange"
},
{
"input": "C A E",
"output": "minor"
},
{
"input": "A H B",
"output": "strange"
},
{
"input": "B E F#",
"output": "strange"
},
{
"input": "G# G# A",
"output": "strange"
},
{
"input": "B C# C#",
"output": "strange"
},
{
"input": "C G D#",
"output": "minor"
},
{
"input": "C B D#",
"output": "strange"
},
{
"input": "F H F",
"output": "strange"
},
{
"input": "E G# C",
"output": "strange"
},
{
"input": "F# F# F#",
"output": "strange"
},
{
"input": "F C F",
"output": "strange"
},
{
"input": "A F D",
"output": "minor"
}
] | 1,590,084,238
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 75
| 218
| 307,200
|
s = input().split()
chords = ['C', 'C#', 'D', 'D#', 'E', 'F', 'F#', 'G', 'G#', 'A', 'B', 'H']
c1 = chords.index(s[0])
c2 = chords.index(s[1])
c3 = chords.index(s[2])
#print(c1,c2,c3)
printed = False
possibilities = [[c1,c2,c3],[c2,c1,c3],[c1,c3,c2],[c2,c3,c1],[c3,c1,c2],[c3,c2,c1]]
for t in possibilities:
#print(t)
if (t[0]+4)%12 == t[1] and (t[0] + 7)%12 == t[2] :
print('major')
printed = True
break
if (t[0]+3)%12 == t[1] and (t[0] + 7)%12 == t[2]:
print('minor')
printed = True
break
if not printed:
print('strange')
|
Title: Chord
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya studies music.
He has learned lots of interesting stuff. For example, he knows that there are 12 notes: C, C#, D, D#, E, F, F#, G, G#, A, B, H. He also knows that the notes are repeated cyclically: after H goes C again, and before C stands H. We will consider the C note in the row's beginning and the C note after the H similar and we will identify them with each other. The distance between the notes along the musical scale is measured in tones: between two consecutive notes there's exactly one semitone, that is, 0.5 tone. The distance is taken from the lowest tone to the uppest one, that is, the distance between C and E is 4 semitones and between E and C is 8 semitones
Vasya also knows what a chord is. A chord is an unordered set of no less than three notes. However, for now Vasya only works with triads, that is with the chords that consist of exactly three notes. He can already distinguish between two types of triads — major and minor.
Let's define a major triad. Let the triad consist of notes *X*, *Y* and *Z*. If we can order the notes so as the distance along the musical scale between *X* and *Y* equals 4 semitones and the distance between *Y* and *Z* is 3 semitones, then the triad is major. The distance between *X* and *Z*, accordingly, equals 7 semitones.
A minor triad is different in that the distance between *X* and *Y* should be 3 semitones and between *Y* and *Z* — 4 semitones.
For example, the triad "C E G" is major: between C and E are 4 semitones, and between E and G are 3 semitones. And the triplet "C# B F" is minor, because if we order the notes as "B C# F", than between B and C# will be 3 semitones, and between C# and F — 4 semitones.
Help Vasya classify the triad the teacher has given to him.
Input Specification:
The only line contains 3 space-separated notes in the above-given notation.
Output Specification:
Print "major" if the chord is major, "minor" if it is minor, and "strange" if the teacher gave Vasya some weird chord which is neither major nor minor. Vasya promises you that the answer will always be unambiguous. That is, there are no chords that are both major and minor simultaneously.
Demo Input:
['C E G\n', 'C# B F\n', 'A B H\n']
Demo Output:
['major\n', 'minor\n', 'strange\n']
Note:
none
|
```python
s = input().split()
chords = ['C', 'C#', 'D', 'D#', 'E', 'F', 'F#', 'G', 'G#', 'A', 'B', 'H']
c1 = chords.index(s[0])
c2 = chords.index(s[1])
c3 = chords.index(s[2])
#print(c1,c2,c3)
printed = False
possibilities = [[c1,c2,c3],[c2,c1,c3],[c1,c3,c2],[c2,c3,c1],[c3,c1,c2],[c3,c2,c1]]
for t in possibilities:
#print(t)
if (t[0]+4)%12 == t[1] and (t[0] + 7)%12 == t[2] :
print('major')
printed = True
break
if (t[0]+3)%12 == t[1] and (t[0] + 7)%12 == t[2]:
print('minor')
printed = True
break
if not printed:
print('strange')
```
| 3.944928
|
129
|
A
|
Cookies
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
|
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
|
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
|
[
"1\n1\n",
"10\n1 2 2 3 4 4 4 2 2 2\n",
"11\n2 2 2 2 2 2 2 2 2 2 99\n"
] |
[
"1\n",
"8\n",
"1\n"
] |
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
| 500
|
[
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 2 2 3 4 4 4 2 2 2",
"output": "8"
},
{
"input": "11\n2 2 2 2 2 2 2 2 2 2 99",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n2 2",
"output": "2"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "7\n7 7 7 7 7 7 7",
"output": "7"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "4"
},
{
"input": "100\n1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2",
"output": "50"
},
{
"input": "99\n99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99",
"output": "49"
},
{
"input": "82\n43 44 96 33 23 42 33 66 53 87 8 90 43 91 40 88 51 18 48 62 59 10 22 20 54 6 13 63 2 56 31 52 98 42 54 32 26 77 9 24 33 91 16 30 39 34 78 82 73 90 12 15 67 76 30 18 44 86 84 98 65 54 100 79 28 34 40 56 11 43 72 35 86 59 89 40 30 33 7 19 44 15",
"output": "50"
},
{
"input": "17\n50 14 17 77 74 74 38 76 41 27 45 29 66 98 38 73 38",
"output": "7"
},
{
"input": "94\n81 19 90 99 26 11 86 44 78 36 80 59 99 90 78 72 71 20 94 56 42 40 71 84 10 85 10 70 52 27 39 55 90 16 48 25 7 79 99 100 38 10 99 56 3 4 78 9 16 57 14 40 52 54 57 70 30 86 56 84 97 60 59 69 49 66 23 92 90 46 86 73 53 47 1 83 14 20 24 66 13 45 41 14 86 75 55 88 48 95 82 24 47 87",
"output": "39"
},
{
"input": "88\n64 95 12 90 40 65 98 45 52 54 79 7 81 25 98 19 68 82 41 53 35 50 5 22 32 21 8 39 8 6 72 27 81 30 12 79 21 42 60 2 66 87 46 93 62 78 52 71 76 32 78 94 86 85 55 15 34 76 41 20 32 26 94 81 89 45 74 49 11 40 40 39 49 46 80 85 90 23 80 40 86 58 70 26 48 93 23 53",
"output": "37"
},
{
"input": "84\n95 9 43 43 13 84 60 90 1 8 97 99 54 34 59 83 33 15 51 26 40 12 66 65 19 30 29 78 92 60 25 13 19 84 71 73 12 24 54 49 16 41 11 40 57 59 34 40 39 9 71 83 1 77 79 53 94 47 78 55 77 85 29 52 80 90 53 77 97 97 27 79 28 23 83 25 26 22 49 86 63 56 3 32",
"output": "51"
},
{
"input": "47\n61 97 76 94 91 22 2 68 62 73 90 47 16 79 44 71 98 68 43 6 53 52 40 27 68 67 43 96 14 91 60 61 96 24 97 13 32 65 85 96 81 77 34 18 23 14 80",
"output": "21"
},
{
"input": "69\n71 1 78 74 58 89 30 6 100 90 22 61 11 59 14 74 27 25 78 61 45 19 25 33 37 4 52 43 53 38 9 100 56 67 69 38 76 91 63 60 93 52 28 61 9 98 8 14 57 63 89 64 98 51 36 66 36 86 13 82 50 91 52 64 86 78 78 83 81",
"output": "37"
},
{
"input": "52\n38 78 36 75 19 3 56 1 39 97 24 79 84 16 93 55 96 64 12 24 1 86 80 29 12 32 36 36 73 39 76 65 53 98 30 20 28 8 86 43 70 22 75 69 62 65 81 25 53 40 71 59",
"output": "28"
},
{
"input": "74\n81 31 67 97 26 75 69 81 11 13 13 74 77 88 52 20 52 64 66 75 72 28 41 54 26 75 41 91 75 15 18 36 13 83 63 61 14 48 53 63 19 67 35 48 23 65 73 100 44 55 92 88 99 17 73 25 83 7 31 89 12 80 98 39 42 75 14 29 81 35 77 87 33 94",
"output": "47"
},
{
"input": "44\n46 56 31 31 37 71 94 2 14 100 45 72 36 72 80 3 38 54 42 98 50 32 31 42 62 31 45 50 95 100 18 17 64 22 18 25 52 56 70 57 43 40 81 28",
"output": "15"
},
{
"input": "22\n28 57 40 74 51 4 45 84 99 12 95 14 92 60 47 81 84 51 31 91 59 42",
"output": "11"
},
{
"input": "59\n73 45 94 76 41 49 65 13 74 66 36 25 47 75 40 23 92 72 11 32 32 8 81 26 68 56 41 8 76 47 96 55 70 11 84 14 83 18 70 22 30 39 28 100 48 11 92 45 78 69 86 1 54 90 98 91 13 17 35",
"output": "33"
},
{
"input": "63\n20 18 44 94 68 57 16 43 74 55 68 24 21 95 76 84 50 50 47 86 86 12 58 55 28 72 86 18 34 45 81 88 3 72 41 9 60 90 81 93 12 6 9 6 2 41 1 7 9 29 81 14 64 80 20 36 67 54 7 5 35 81 22",
"output": "37"
},
{
"input": "28\n49 84 48 19 44 91 11 82 96 95 88 90 71 82 87 25 31 23 18 13 98 45 26 65 35 12 31 14",
"output": "15"
},
{
"input": "61\n34 18 28 64 28 45 9 77 77 20 63 92 79 16 16 100 86 2 91 91 57 15 31 95 10 88 84 5 82 83 53 98 59 17 97 80 76 80 81 3 91 81 87 93 61 46 10 49 6 22 21 75 63 89 21 81 30 19 67 38 77",
"output": "35"
},
{
"input": "90\n41 90 43 1 28 75 90 50 3 70 76 64 81 63 25 69 83 82 29 91 59 66 21 61 7 55 72 49 38 69 72 20 64 58 30 81 61 29 96 14 39 5 100 20 29 98 75 29 44 78 97 45 26 77 73 59 22 99 41 6 3 96 71 20 9 18 96 18 90 62 34 78 54 5 41 6 73 33 2 54 26 21 18 6 45 57 43 73 95 75",
"output": "42"
},
{
"input": "45\n93 69 4 27 20 14 71 48 79 3 32 26 49 30 57 88 13 56 49 61 37 32 47 41 41 70 45 68 82 18 8 6 25 20 15 13 71 99 28 6 52 34 19 59 26",
"output": "23"
},
{
"input": "33\n29 95 48 49 91 10 83 71 47 25 66 36 51 12 34 10 54 74 41 96 89 26 89 1 42 33 1 62 9 32 49 65 78",
"output": "15"
},
{
"input": "34\n98 24 42 36 41 82 28 58 89 34 77 70 76 44 74 54 66 100 13 79 4 88 21 1 11 45 91 29 87 100 29 54 82 78",
"output": "13"
},
{
"input": "29\n91 84 26 84 9 63 52 9 65 56 90 2 36 7 67 33 91 14 65 38 53 36 81 83 85 14 33 95 51",
"output": "17"
},
{
"input": "100\n2 88 92 82 87 100 78 28 84 43 78 32 43 33 97 19 15 52 29 84 57 72 54 13 99 28 82 79 40 70 34 92 91 53 9 88 27 43 14 92 72 37 26 37 20 95 19 34 49 64 33 37 34 27 80 79 9 54 99 68 25 4 68 73 46 66 24 78 3 87 26 52 50 84 4 95 23 83 39 58 86 36 33 16 98 2 84 19 53 12 69 60 10 11 78 17 79 92 77 59",
"output": "45"
},
{
"input": "100\n2 95 45 73 9 54 20 97 57 82 88 26 18 71 25 27 75 54 31 11 58 85 69 75 72 91 76 5 25 80 45 49 4 73 8 81 81 38 5 12 53 77 7 96 90 35 28 80 73 94 19 69 96 17 94 49 69 9 32 19 5 12 46 29 26 40 59 59 6 95 82 50 72 2 45 69 12 5 72 29 39 72 23 96 81 28 28 56 68 58 37 41 30 1 90 84 15 24 96 43",
"output": "53"
},
{
"input": "100\n27 72 35 91 13 10 35 45 24 55 83 84 63 96 29 79 34 67 63 92 48 83 18 77 28 27 49 66 29 88 55 15 6 58 14 67 94 36 77 7 7 64 61 52 71 18 36 99 76 6 50 67 16 13 41 7 89 73 61 51 78 22 78 32 76 100 3 31 89 71 63 53 15 85 77 54 89 33 68 74 3 23 57 5 43 89 75 35 9 86 90 11 31 46 48 37 74 17 77 8",
"output": "40"
},
{
"input": "100\n69 98 69 88 11 49 55 8 25 91 17 81 47 26 15 73 96 71 18 42 42 61 48 14 92 78 35 72 4 27 62 75 83 79 17 16 46 80 96 90 82 54 37 69 85 21 67 70 96 10 46 63 21 59 56 92 54 88 77 30 75 45 44 29 86 100 51 11 65 69 66 56 82 63 27 1 51 51 13 10 3 55 26 85 34 16 87 72 13 100 81 71 90 95 86 50 83 55 55 54",
"output": "53"
},
{
"input": "100\n34 35 99 64 2 66 78 93 20 48 12 79 19 10 87 7 42 92 60 79 5 2 24 89 57 48 63 92 74 4 16 51 7 12 90 48 87 17 18 73 51 58 97 97 25 38 15 97 96 73 67 91 6 75 14 13 87 79 75 3 15 55 35 95 71 45 10 13 20 37 82 26 2 22 13 83 97 84 39 79 43 100 54 59 98 8 61 34 7 65 75 44 24 77 73 88 34 95 44 77",
"output": "55"
},
{
"input": "100\n15 86 3 1 51 26 74 85 37 87 64 58 10 6 57 26 30 47 85 65 24 72 50 40 12 35 91 47 91 60 47 87 95 34 80 91 26 3 36 39 14 86 28 70 51 44 28 21 72 79 57 61 16 71 100 94 57 67 36 74 24 21 89 85 25 2 97 67 76 53 76 80 97 64 35 13 8 32 21 52 62 61 67 14 74 73 66 44 55 76 24 3 43 42 99 61 36 80 38 66",
"output": "52"
},
{
"input": "100\n45 16 54 54 80 94 74 93 75 85 58 95 79 30 81 2 84 4 57 23 92 64 78 1 50 36 13 27 56 54 10 77 87 1 5 38 85 74 94 82 30 45 72 83 82 30 81 82 82 3 69 82 7 92 39 60 94 42 41 5 3 17 67 21 79 44 79 96 28 3 53 68 79 89 63 83 1 44 4 31 84 15 73 77 19 66 54 6 73 1 67 24 91 11 86 45 96 82 20 89",
"output": "51"
},
{
"input": "100\n84 23 50 32 90 71 92 43 58 70 6 82 7 55 85 19 70 89 12 26 29 56 74 30 2 27 4 39 63 67 91 81 11 33 75 10 82 88 39 43 43 80 68 35 55 67 53 62 73 65 86 74 43 51 14 48 42 92 83 57 22 33 24 99 5 27 78 96 7 28 11 15 8 38 85 67 5 92 24 96 57 59 14 95 91 4 9 18 45 33 74 83 64 85 14 51 51 94 29 2",
"output": "53"
},
{
"input": "100\n77 56 56 45 73 55 32 37 39 50 30 95 79 21 44 34 51 43 86 91 39 30 85 15 35 93 100 14 57 31 80 79 38 40 88 4 91 54 7 95 76 26 62 84 17 33 67 47 6 82 69 51 17 2 59 24 11 12 31 90 12 11 55 38 72 49 30 50 42 46 5 97 9 9 30 45 86 23 19 82 40 42 5 40 35 98 35 32 60 60 5 28 84 35 21 49 68 53 68 23",
"output": "48"
},
{
"input": "100\n78 38 79 61 45 86 83 83 86 90 74 69 2 84 73 39 2 5 20 71 24 80 54 89 58 34 77 40 39 62 2 47 28 53 97 75 88 98 94 96 33 71 44 90 47 36 19 89 87 98 90 87 5 85 34 79 82 3 42 88 89 63 35 7 89 30 40 48 12 41 56 76 83 60 80 80 39 56 77 4 72 96 30 55 57 51 7 19 11 1 66 1 91 87 11 62 95 85 79 25",
"output": "48"
},
{
"input": "100\n5 34 23 20 76 75 19 51 17 82 60 13 83 6 65 16 20 43 66 54 87 10 87 73 50 24 16 98 33 28 80 52 54 82 26 92 14 13 84 92 94 29 61 21 60 20 48 94 24 20 75 70 58 27 68 45 86 89 29 8 67 38 83 48 18 100 11 22 46 84 52 97 70 19 50 75 3 7 52 53 72 41 18 31 1 38 49 53 11 64 99 76 9 87 48 12 100 32 44 71",
"output": "58"
},
{
"input": "100\n76 89 68 78 24 72 73 95 98 72 58 15 2 5 56 32 9 65 50 70 94 31 29 54 89 52 31 93 43 56 26 35 72 95 51 55 78 70 11 92 17 5 54 94 81 31 78 95 73 91 95 37 59 9 53 48 65 55 84 8 45 97 64 37 96 34 36 53 66 17 72 48 99 23 27 18 92 84 44 73 60 78 53 29 68 99 19 39 61 40 69 6 77 12 47 29 15 4 8 45",
"output": "53"
},
{
"input": "100\n82 40 31 53 8 50 85 93 3 84 54 17 96 59 51 42 18 19 35 84 79 31 17 46 54 82 72 49 35 73 26 89 61 73 3 50 12 29 25 77 88 21 58 24 22 89 96 54 82 29 96 56 77 16 1 68 90 93 20 23 57 22 31 18 92 90 51 14 50 72 31 54 12 50 66 62 2 34 17 45 68 50 87 97 23 71 1 72 17 82 42 15 20 78 4 49 66 59 10 17",
"output": "54"
},
{
"input": "100\n32 82 82 24 39 53 48 5 29 24 9 37 91 37 91 95 1 97 84 52 12 56 93 47 22 20 14 17 40 22 79 34 24 2 69 30 69 29 3 89 21 46 60 92 39 29 18 24 49 18 40 22 60 13 77 50 39 64 50 70 99 8 66 31 90 38 20 54 7 21 5 56 41 68 69 20 54 89 69 62 9 53 43 89 81 97 15 2 52 78 89 65 16 61 59 42 56 25 32 52",
"output": "49"
},
{
"input": "100\n72 54 23 24 97 14 99 87 15 25 7 23 17 87 72 31 71 87 34 82 51 77 74 85 62 38 24 7 84 48 98 21 29 71 70 84 25 58 67 92 18 44 32 9 81 15 53 29 63 18 86 16 7 31 38 99 70 32 89 16 23 11 66 96 69 82 97 59 6 9 49 80 85 19 6 9 52 51 85 74 53 46 73 55 31 63 78 61 34 80 77 65 87 77 92 52 89 8 52 31",
"output": "44"
},
{
"input": "100\n56 88 8 19 7 15 11 54 35 50 19 57 63 72 51 43 50 19 57 90 40 100 8 92 11 96 30 32 59 65 93 47 62 3 50 41 30 50 72 83 61 46 83 60 20 46 33 1 5 18 83 22 34 16 41 95 63 63 7 59 55 95 91 29 64 60 64 81 45 45 10 9 88 37 69 85 21 82 41 76 42 34 47 78 51 83 65 100 13 22 59 76 63 1 26 86 36 94 99 74",
"output": "46"
},
{
"input": "100\n27 89 67 60 62 80 43 50 28 88 72 5 94 11 63 91 18 78 99 3 71 26 12 97 74 62 23 24 22 3 100 72 98 7 94 32 12 75 61 88 42 48 10 14 45 9 48 56 73 76 70 70 79 90 35 39 96 37 81 11 19 65 99 39 23 79 34 61 35 74 90 37 73 23 46 21 94 84 73 58 11 89 13 9 10 85 42 78 73 32 53 39 49 90 43 5 28 31 97 75",
"output": "53"
},
{
"input": "100\n33 24 97 96 1 14 99 51 13 65 67 20 46 88 42 44 20 49 5 89 98 83 15 40 74 83 58 3 10 79 34 2 69 28 37 100 55 52 14 8 44 94 97 89 6 42 11 28 30 33 55 56 20 57 52 25 75 1 87 42 62 41 37 12 54 85 95 80 42 36 94 96 28 76 54 36 4 17 26 24 62 15 17 79 84 36 92 78 74 91 96 77 54 92 81 91 62 98 37 37",
"output": "43"
},
{
"input": "100\n86 24 61 15 11 85 1 31 47 36 23 36 59 34 3 27 16 29 82 28 58 52 52 66 71 61 98 39 60 20 67 41 67 90 73 29 92 17 70 95 58 98 58 32 21 73 46 56 87 72 80 75 40 27 94 31 59 92 93 37 14 99 96 21 97 23 81 91 52 52 96 94 92 28 38 29 52 16 57 27 17 24 91 21 79 55 96 98 95 94 23 78 79 12 77 35 32 75 100 82",
"output": "51"
},
{
"input": "100\n88 85 41 37 69 21 7 69 36 5 92 26 64 75 22 46 67 20 70 22 62 66 38 24 47 49 68 30 90 31 67 86 86 82 9 51 43 45 48 42 73 44 31 94 45 60 54 66 20 87 11 94 34 32 87 66 56 28 75 39 37 90 72 93 55 72 31 42 30 71 87 61 4 12 12 81 23 61 56 98 71 32 30 33 96 63 92 16 8 78 47 91 47 54 49 3 81 82 41 5",
"output": "47"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "5\n1 1 3 2 2",
"output": "3"
}
] | 1,602,573,524
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 52
| 216
| 0
|
n,a=int(input()),list(map(int,input().split()))
even=list(filter(lambda x:x%2==0,a))
odd=n-len(even)
if odd%2!=0:
print(odd)
else:
print(len(even))
|
Title: Cookies
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
Input Specification:
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
Output Specification:
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
Demo Input:
['1\n1\n', '10\n1 2 2 3 4 4 4 2 2 2\n', '11\n2 2 2 2 2 2 2 2 2 2 99\n']
Demo Output:
['1\n', '8\n', '1\n']
Note:
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
|
```python
n,a=int(input()),list(map(int,input().split()))
even=list(filter(lambda x:x%2==0,a))
odd=n-len(even)
if odd%2!=0:
print(odd)
else:
print(len(even))
```
| 3
|
|
868
|
C
|
Qualification Rounds
|
PROGRAMMING
| 1,500
|
[
"bitmasks",
"brute force",
"constructive algorithms",
"dp"
] | null | null |
Snark and Philip are preparing the problemset for the upcoming pre-qualification round for semi-quarter-finals. They have a bank of *n* problems, and they want to select any non-empty subset of it as a problemset.
*k* experienced teams are participating in the contest. Some of these teams already know some of the problems. To make the contest interesting for them, each of the teams should know at most half of the selected problems.
Determine if Snark and Philip can make an interesting problemset!
|
The first line contains two integers *n*, *k* (1<=≤<=*n*<=≤<=105, 1<=≤<=*k*<=≤<=4) — the number of problems and the number of experienced teams.
Each of the next *n* lines contains *k* integers, each equal to 0 or 1. The *j*-th number in the *i*-th line is 1 if *j*-th team knows *i*-th problem and 0 otherwise.
|
Print "YES" (quotes for clarity), if it is possible to make an interesting problemset, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES").
|
[
"5 3\n1 0 1\n1 1 0\n1 0 0\n1 0 0\n1 0 0\n",
"3 2\n1 0\n1 1\n0 1\n"
] |
[
"NO\n",
"YES\n"
] |
In the first example you can't make any interesting problemset, because the first team knows all problems.
In the second example you can choose the first and the third problems.
| 1,000
|
[
{
"input": "5 3\n1 0 1\n1 1 0\n1 0 0\n1 0 0\n1 0 0",
"output": "NO"
},
{
"input": "3 2\n1 0\n1 1\n0 1",
"output": "YES"
},
{
"input": "10 2\n1 0\n1 0\n0 0\n1 1\n0 0\n1 1\n0 0\n1 1\n0 1\n0 1",
"output": "YES"
},
{
"input": "10 3\n1 0 0\n0 1 1\n1 0 0\n0 1 0\n0 0 1\n1 0 1\n0 1 1\n1 0 0\n1 1 0\n0 0 0",
"output": "YES"
},
{
"input": "10 4\n1 0 1 0\n1 0 0 1\n1 1 0 1\n1 0 1 1\n1 1 0 1\n1 0 1 0\n0 0 0 0\n0 0 1 0\n1 0 1 0\n0 0 1 1",
"output": "YES"
},
{
"input": "2 2\n0 0\n1 0",
"output": "YES"
},
{
"input": "3 3\n1 0 1\n1 0 0\n1 1 1",
"output": "NO"
},
{
"input": "4 4\n0 0 0 0\n1 1 0 0\n1 1 1 1\n1 0 1 1",
"output": "YES"
},
{
"input": "4 1\n1\n1\n0\n0",
"output": "YES"
},
{
"input": "1 4\n0 0 0 0",
"output": "YES"
},
{
"input": "3 3\n0 0 1\n0 1 1\n1 0 0",
"output": "YES"
},
{
"input": "2 3\n0 0 1\n1 0 0",
"output": "YES"
},
{
"input": "1 1\n0",
"output": "YES"
},
{
"input": "2 4\n0 1 1 1\n1 0 0 0",
"output": "YES"
},
{
"input": "2 4\n1 0 1 0\n0 1 0 1",
"output": "YES"
},
{
"input": "2 4\n1 0 0 0\n0 0 0 1",
"output": "YES"
},
{
"input": "2 3\n0 1 0\n0 0 1",
"output": "YES"
},
{
"input": "3 4\n1 0 1 0\n0 1 0 1\n1 1 1 1",
"output": "YES"
},
{
"input": "3 4\n0 0 1 1\n1 1 1 0\n1 1 0 1",
"output": "NO"
},
{
"input": "4 4\n0 0 0 1\n0 0 0 1\n0 0 1 0\n0 0 1 0",
"output": "YES"
},
{
"input": "2 4\n1 1 0 0\n0 0 1 1",
"output": "YES"
},
{
"input": "2 4\n1 0 0 0\n0 1 0 0",
"output": "YES"
},
{
"input": "2 3\n1 0 0\n0 0 1",
"output": "YES"
},
{
"input": "3 4\n1 0 1 0\n0 1 1 1\n1 0 0 0",
"output": "YES"
},
{
"input": "1 2\n0 0",
"output": "YES"
},
{
"input": "6 3\n0 1 1\n1 0 1\n1 1 1\n0 1 0\n1 0 1\n1 1 0",
"output": "YES"
},
{
"input": "1 4\n0 0 1 1",
"output": "NO"
},
{
"input": "3 3\n1 0 0\n0 1 0\n0 0 1",
"output": "YES"
},
{
"input": "3 4\n1 0 0 0\n1 1 0 0\n0 1 1 1",
"output": "YES"
},
{
"input": "3 2\n0 0\n0 0\n0 0",
"output": "YES"
},
{
"input": "2 4\n1 0 0 0\n1 0 1 1",
"output": "NO"
},
{
"input": "2 4\n0 0 0 1\n1 0 0 0",
"output": "YES"
},
{
"input": "2 4\n1 0 0 0\n0 1 1 1",
"output": "YES"
},
{
"input": "4 4\n1 1 1 1\n0 0 0 1\n0 0 1 1\n1 0 1 1",
"output": "NO"
},
{
"input": "6 3\n1 0 0\n1 1 1\n1 1 1\n0 1 0\n0 1 0\n1 0 0",
"output": "YES"
},
{
"input": "4 4\n0 1 0 0\n1 1 1 1\n1 1 1 1\n1 0 1 1",
"output": "YES"
},
{
"input": "1 3\n0 0 0",
"output": "YES"
},
{
"input": "3 3\n1 0 0\n0 1 0\n0 0 0",
"output": "YES"
},
{
"input": "2 4\n0 1 1 0\n0 0 0 0",
"output": "YES"
},
{
"input": "1 4\n0 0 0 1",
"output": "NO"
},
{
"input": "4 4\n0 0 0 1\n0 0 0 1\n0 0 1 1\n1 1 1 0",
"output": "YES"
},
{
"input": "2 3\n1 0 0\n0 1 1",
"output": "YES"
},
{
"input": "3 2\n0 1\n0 1\n1 0",
"output": "YES"
},
{
"input": "4 3\n1 1 0\n1 1 1\n0 0 1\n0 0 1",
"output": "YES"
},
{
"input": "2 1\n0\n0",
"output": "YES"
},
{
"input": "2 4\n1 1 1 0\n0 0 0 1",
"output": "YES"
},
{
"input": "5 4\n1 1 1 0\n1 1 0 1\n1 0 1 1\n0 1 1 1\n1 1 0 0",
"output": "NO"
},
{
"input": "3 4\n0 1 1 0\n0 1 0 1\n0 0 1 1",
"output": "NO"
},
{
"input": "1 1\n1",
"output": "NO"
},
{
"input": "3 4\n1 0 0 0\n1 0 0 0\n0 1 1 1",
"output": "YES"
},
{
"input": "2 3\n1 1 0\n0 0 1",
"output": "YES"
},
{
"input": "3 3\n0 0 1\n1 1 1\n1 1 0",
"output": "YES"
},
{
"input": "4 4\n0 1 1 1\n1 0 1 0\n1 1 0 1\n1 0 1 0",
"output": "NO"
},
{
"input": "3 3\n1 0 0\n0 0 0\n1 0 0",
"output": "YES"
},
{
"input": "3 4\n1 1 0 0\n1 1 0 0\n0 0 1 1",
"output": "YES"
},
{
"input": "2 4\n1 0 0 1\n0 0 1 0",
"output": "YES"
},
{
"input": "2 4\n0 0 1 1\n1 1 0 0",
"output": "YES"
},
{
"input": "2 3\n0 0 1\n0 1 0",
"output": "YES"
},
{
"input": "2 3\n1 0 0\n0 1 0",
"output": "YES"
},
{
"input": "3 2\n1 0\n0 1\n0 1",
"output": "YES"
},
{
"input": "3 4\n1 1 0 1\n0 0 1 1\n1 0 1 0",
"output": "NO"
},
{
"input": "3 4\n0 0 1 1\n0 1 1 0\n1 1 0 0",
"output": "YES"
},
{
"input": "3 4\n0 0 0 1\n0 0 0 1\n1 1 1 0",
"output": "YES"
},
{
"input": "3 4\n1 1 1 0\n1 1 0 1\n0 0 1 0",
"output": "YES"
},
{
"input": "8 4\n0 0 0 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n1 1 1 0",
"output": "YES"
},
{
"input": "3 4\n1 0 1 1\n1 1 1 0\n0 1 0 1",
"output": "NO"
},
{
"input": "2 4\n1 1 0 0\n0 0 0 1",
"output": "YES"
},
{
"input": "10 4\n1 0 1 0\n1 0 1 0\n0 1 1 1\n1 0 1 1\n1 1 0 1\n1 0 0 1\n0 1 1 1\n0 0 0 1\n1 1 1 1\n1 0 1 0",
"output": "YES"
},
{
"input": "2 4\n0 1 0 0\n0 0 1 1",
"output": "YES"
},
{
"input": "3 3\n1 1 0\n1 0 1\n0 1 1",
"output": "NO"
},
{
"input": "3 3\n1 1 0\n0 0 1\n1 1 1",
"output": "YES"
},
{
"input": "4 4\n1 1 0 0\n1 0 1 0\n0 1 1 0\n0 0 1 1",
"output": "YES"
},
{
"input": "4 4\n1 0 0 0\n1 0 0 1\n1 0 0 1\n0 1 1 1",
"output": "YES"
},
{
"input": "4 3\n1 0 0\n1 0 0\n1 0 0\n0 1 1",
"output": "YES"
},
{
"input": "2 4\n0 0 1 0\n0 1 0 0",
"output": "YES"
},
{
"input": "1 2\n0 1",
"output": "NO"
},
{
"input": "3 4\n1 1 1 0\n0 0 1 1\n1 1 0 0",
"output": "YES"
},
{
"input": "3 4\n0 0 1 1\n0 1 0 1\n1 0 1 0",
"output": "YES"
},
{
"input": "2 3\n1 0 1\n0 1 0",
"output": "YES"
},
{
"input": "2 4\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "3 4\n0 1 0 1\n0 1 1 0\n1 0 0 1",
"output": "YES"
},
{
"input": "3 4\n0 1 1 0\n1 1 0 0\n0 0 1 1",
"output": "YES"
},
{
"input": "2 4\n1 0 1 0\n0 0 0 1",
"output": "YES"
},
{
"input": "2 3\n0 1 0\n1 0 0",
"output": "YES"
},
{
"input": "4 4\n0 0 1 1\n0 1 1 0\n1 1 0 0\n1 0 0 1",
"output": "YES"
},
{
"input": "10 4\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n1 1 0 0",
"output": "YES"
},
{
"input": "3 3\n1 1 0\n0 1 1\n1 0 1",
"output": "NO"
},
{
"input": "2 3\n0 0 1\n1 1 0",
"output": "YES"
},
{
"input": "4 4\n0 0 0 1\n0 0 1 1\n1 1 0 1\n1 1 1 0",
"output": "YES"
},
{
"input": "3 4\n0 0 1 1\n1 0 1 0\n0 1 0 1",
"output": "YES"
},
{
"input": "5 4\n1 1 1 0\n1 1 0 1\n1 0 1 1\n0 1 1 1\n0 0 1 1",
"output": "NO"
},
{
"input": "3 4\n1 0 0 0\n1 1 0 0\n0 1 1 0",
"output": "YES"
}
] | 1,638,953,264
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 143
| 732
| 4,812,800
|
n, k = map(int, input().split())
k21 = (1 << k) - 1
inn = [0] * (1 << k)
for i in range(n):
inn[int("".join(input().split()), 2)] = 1
if inn[0]:
print("YES")
exit()
a = []
for i, x in enumerate(inn):
if x:
a.append(i)
for i in range(1, len(a)):
for j in range(i):
if a[i] & a[j] == 0:
print("YES")
exit()
print("NO")
|
Title: Qualification Rounds
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Snark and Philip are preparing the problemset for the upcoming pre-qualification round for semi-quarter-finals. They have a bank of *n* problems, and they want to select any non-empty subset of it as a problemset.
*k* experienced teams are participating in the contest. Some of these teams already know some of the problems. To make the contest interesting for them, each of the teams should know at most half of the selected problems.
Determine if Snark and Philip can make an interesting problemset!
Input Specification:
The first line contains two integers *n*, *k* (1<=≤<=*n*<=≤<=105, 1<=≤<=*k*<=≤<=4) — the number of problems and the number of experienced teams.
Each of the next *n* lines contains *k* integers, each equal to 0 or 1. The *j*-th number in the *i*-th line is 1 if *j*-th team knows *i*-th problem and 0 otherwise.
Output Specification:
Print "YES" (quotes for clarity), if it is possible to make an interesting problemset, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES").
Demo Input:
['5 3\n1 0 1\n1 1 0\n1 0 0\n1 0 0\n1 0 0\n', '3 2\n1 0\n1 1\n0 1\n']
Demo Output:
['NO\n', 'YES\n']
Note:
In the first example you can't make any interesting problemset, because the first team knows all problems.
In the second example you can choose the first and the third problems.
|
```python
n, k = map(int, input().split())
k21 = (1 << k) - 1
inn = [0] * (1 << k)
for i in range(n):
inn[int("".join(input().split()), 2)] = 1
if inn[0]:
print("YES")
exit()
a = []
for i, x in enumerate(inn):
if x:
a.append(i)
for i in range(1, len(a)):
for j in range(i):
if a[i] & a[j] == 0:
print("YES")
exit()
print("NO")
```
| 3
|
|
864
|
B
|
Polycarp and Letters
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation",
"strings"
] | null | null |
Polycarp loves lowercase letters and dislikes uppercase ones. Once he got a string *s* consisting only of lowercase and uppercase Latin letters.
Let *A* be a set of positions in the string. Let's call it pretty if following conditions are met:
- letters on positions from *A* in the string are all distinct and lowercase; - there are no uppercase letters in the string which are situated between positions from *A* (i.e. there is no such *j* that *s*[*j*] is an uppercase letter, and *a*1<=<<=*j*<=<<=*a*2 for some *a*1 and *a*2 from *A*).
Write a program that will determine the maximum number of elements in a pretty set of positions.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=200) — length of string *s*.
The second line contains a string *s* consisting of lowercase and uppercase Latin letters.
|
Print maximum number of elements in pretty set of positions for string *s*.
|
[
"11\naaaaBaabAbA\n",
"12\nzACaAbbaazzC\n",
"3\nABC\n"
] |
[
"2\n",
"3\n",
"0\n"
] |
In the first example the desired positions might be 6 and 8 or 7 and 8. Positions 6 and 7 contain letters 'a', position 8 contains letter 'b'. The pair of positions 1 and 8 is not suitable because there is an uppercase letter 'B' between these position.
In the second example desired positions can be 7, 8 and 11. There are other ways to choose pretty set consisting of three elements.
In the third example the given string *s* does not contain any lowercase letters, so the answer is 0.
| 1,000
|
[
{
"input": "11\naaaaBaabAbA",
"output": "2"
},
{
"input": "12\nzACaAbbaazzC",
"output": "3"
},
{
"input": "3\nABC",
"output": "0"
},
{
"input": "1\na",
"output": "1"
},
{
"input": "2\naz",
"output": "2"
},
{
"input": "200\nXbTJZqcbpYuZQEoUrbxlPXAPCtVLrRExpQzxzqzcqsqzsiisswqitswzCtJQxOavicSdBIodideVRKHPojCNHmbnrLgwJlwOpyrJJIhrUePszxSjJGeUgTtOfewPQnPVWhZAtogRPrJLwyShNQaeNsvrJwjuuBOMPCeSckBMISQzGngfOmeyfDObncyeNsihYVtQbSEh",
"output": "8"
},
{
"input": "2\nAZ",
"output": "0"
},
{
"input": "28\nAabcBabcCBNMaaaaabbbbbcccccc",
"output": "3"
},
{
"input": "200\nrsgraosldglhdoorwhkrsehjpuxrjuwgeanjgezhekprzarelduuaxdnspzjuooguuwnzkowkuhzduakdrzpnslauejhrrkalwpurpuuswdgeadlhjwzjgegwpknepazwwleulppwrlgrgedlwdzuodzropsrrkxusjnuzshdkjrxxpgzanzdrpnggdwxarpwohxdepJ",
"output": "17"
},
{
"input": "1\nk",
"output": "1"
},
{
"input": "1\nH",
"output": "0"
},
{
"input": "2\nzG",
"output": "1"
},
{
"input": "2\ngg",
"output": "1"
},
{
"input": "2\nai",
"output": "2"
},
{
"input": "20\npEjVrKWLIFCZjIHgggVU",
"output": "1"
},
{
"input": "20\niFSiiigiYFSKmDnMGcgM",
"output": "2"
},
{
"input": "20\nedxedxxxCQiIVmYEUtLi",
"output": "3"
},
{
"input": "20\nprnchweyabjvzkoqiltm",
"output": "20"
},
{
"input": "35\nQLDZNKFXKVSVLUVHRTDPQYMSTDXBELXBOTS",
"output": "0"
},
{
"input": "35\nbvZWiitgxodztelnYUyljYGnCoWluXTvBLp",
"output": "10"
},
{
"input": "35\nBTexnaeplecllxwlanarpcollawHLVMHIIF",
"output": "10"
},
{
"input": "35\nhhwxqysolegsthsvfcqiryenbujbrrScobu",
"output": "20"
},
{
"input": "26\npbgfqosklxjuzmdheyvawrictn",
"output": "26"
},
{
"input": "100\nchMRWwymTDuZDZuSTvUmmuxvSscnTasyjlwwodhzcoifeahnbmcifyeobbydwparebduoLDCgHlOsPtVRbYGGQXfnkdvrWKIwCRl",
"output": "20"
},
{
"input": "100\nhXYLXKUMBrGkjqQJTGbGWAfmztqqapdbjbhcualhypgnaieKXmhzGMnqXVlcPesskfaEVgvWQTTShRRnEtFahWDyuBzySMpugxCM",
"output": "19"
},
{
"input": "100\nucOgELrgjMrFOgtHzqgvUgtHngKJxdMFKBjfcCppciqmGZXXoiSZibgpadshyljqrwxbomzeutvnhTLGVckZUmyiFPLlwuLBFito",
"output": "23"
},
{
"input": "200\nWTCKAKLVGXSYFVMVJDUYERXNMVNTGWXUGRFCGMYXJQGLODYZTUIDENHYEGFKXFIEUILAMESAXAWZXVCZPJPEYUXBITHMTZOTMKWITGRSFHODKVJHPAHVVWTCTHIVAWAREQXWMPUWQSTPPJFHKGKELBTPUYDAVIUMGASPUEDIODRYXIWCORHOSLIBLOZUNJPHHMXEXOAY",
"output": "0"
},
{
"input": "200\neLCCuYMPPwQoNlCpPOtKWJaQJmWfHeZCKiMSpILHSKjFOYGpRMzMCfMXdDuQdBGNsCNrHIVJzEFfBZcNMwNcFjOFVJvEtUQmLbFNKVHgNDyFkFVQhUTUQDgXhMjJZgFSSiHhMKuTgZQYJqAqKBpHoHddddddddddddddddXSSYNKNnRrKuOjAVKZlRLzCjExPdHaDHBT",
"output": "1"
},
{
"input": "200\nitSYxgOLlwOoAkkkkkzzzzzzzzkzkzkzkkkkkzkzzkzUDJSKybRPBvaIDsNuWImPJvrHkKiMeYukWmtHtgZSyQsgYanZvXNbKXBlFLSUcqRnGWSriAvKxsTkDJfROqaKdzXhvJsPEDATueCraWOGEvRDWjPwXuiNpWsEnCuhDcKWOQxjBkdBqmFatWFkgKsbZuLtRGtY",
"output": "2"
},
{
"input": "200\noggqoqqogoqoggggoggqgooqggogogooogqqgggoqgggqoqogogggogggqgooqgqggqqqoqgqgoooqgqogqoggoqqgqoqgoooqoogooqoogqoqoqqgoqgoqgggogqqqoqoggoqoqqoqggqoggooqqqoqggoggqqqqqqqqqgogqgggggooogogqgggqogqgoqoqogoooq",
"output": "3"
},
{
"input": "200\nCtclUtUnmqFniaLqGRmMoUMeLyFfAgWxIZxdrBarcRQprSOGcdUYsmDbooSuOvBLgrYlgaIjJtFgcxJKHGkCXpYfVKmUbouuIqGstFrrwJzYQqjjqqppqqqqqpqqqjpjjpjqjXRYkfPhGAatOigFuItkKxkjCBLdiNMVGjmdWNMgOOvmaJEdGsWNoaERrINNKqKeQajv",
"output": "3"
},
{
"input": "200\nmeZNrhqtSTSmktGQnnNOTcnyAMTKSixxKQKiagrMqRYBqgbRlsbJhvtNeHVUuMCyZLCnsIixRYrYEAkfQOxSVqXkrPqeCZQksInzRsRKBgvIqlGVPxPQnypknSXjgMjsjElcqGsaJRbegJVAKtWcHoOnzHqzhoKReqBBsOhZYLaYJhmqOMQsizdCsQfjUDHcTtHoeYwu",
"output": "4"
},
{
"input": "200\nvFAYTHJLZaivWzSYmiuDBDUFACDSVbkImnVaXBpCgrbgmTfXKJfoglIkZxWPSeVSFPnHZDNUAqLyhjLXSuAqGLskBlDxjxGPJyGdwzlPfIekwsblIrkxzfhJeNoHywdfAGlJzqXOfQaKceSqViVFTRJEGfACnsFeSFpOYisIHJciqTMNAmgeXeublTvfWoPnddtvKIyF",
"output": "6"
},
{
"input": "200\ngnDdkqJjYvduVYDSsswZDvoCouyaYZTfhmpSakERWLhufZtthWsfbQdTGwhKYjEcrqWBOyxBbiFhdLlIjChLOPiOpYmcrJgDtXsJfmHtLrabyGKOfHQRukEtTzwoqBHfmyVXPebfcpGQacLkGWFwerszjdHpTBXGssYXmGHlcCBgBXyGJqxbVhvDffLyCrZnxonABEXV",
"output": "7"
},
{
"input": "200\nBmggKNRZBXPtJqlJaXLdKKQLDJvXpDuQGupiRQfDwCJCJvAlDDGpPZNOvXkrdKOFOEFBVfrsZjWyHPoKGzXmTAyPJGEmxCyCXpeAdTwbrMtWLmlmGNqxvuxmqpmtpuhrmxxtrquSLFYVlnSYgRJDYHWgHBbziBLZRwCIJNvbtsEdLLxmTbnjkoqSPAuzEeTYLlmejOUH",
"output": "9"
},
{
"input": "200\nMkuxcDWdcnqsrlTsejehQKrTwoOBRCUAywqSnZkDLRmVBDVoOqdZHbrInQQyeRFAjiYYmHGrBbWgWstCPfLPRdNVDXBdqFJsGQfSXbufsiogybEhKDlWfPazIuhpONwGzZWaQNwVnmhTqWdewaklgjwaumXYDGwjSeEcYXjkVtLiYSWULEnTFukIlWQGWsXwWRMJGTcI",
"output": "10"
},
{
"input": "200\nOgMBgYeuMJdjPtLybvwmGDrQEOhliaabEtwulzNEjsfnaznXUMoBbbxkLEwSQzcLrlJdjJCLGVNBxorghPxTYCoqniySJMcilpsqpBAbqdzqRUDVaYOgqGhGrxlIJkyYgkOdTUgRZwpgIkeZFXojLXpDilzirHVVadiHaMrxhzodzpdvhvrzdzxbhmhdpxqqpoDegfFQ",
"output": "11"
},
{
"input": "200\nOLaJOtwultZLiZPSYAVGIbYvbIuZkqFZXwfsqpsavCDmBMStAuUFLBVknWDXNzmiuUYIsUMGxtoadWlPYPqvqSvpYdOiJRxFzGGnnmstniltvitnrmyrblnqyruylummmlsqtqitlbulvtuitiqimuintbimqyurviuntqnnvslynlNYMpYVKYwKVTbIUVdlNGrcFZON",
"output": "12"
},
{
"input": "200\nGAcmlaqfjSAQLvXlkhxujXgSbxdFAwnoxDuldDvYmpUhTWJdcEQSdARLrozJzIgFVCkzPUztWIpaGfiKeqzoXinEjVuoKqyBHmtFjBWcRdBmyjviNlGAIkpikjAimmBgayfphrstfbjexjbttzfzfzaysxfyrjazfhtpghnbbeffjhxrjxpttesgzrnrfbgzzsRsCgmz",
"output": "15"
},
{
"input": "200\nYRvIopNqSTYDhViTqCLMwEbTTIdHkoeuBmAJWhgtOgVxlcHSsavDNzMfpwTghkBvYEtCYQxicLUxdgAcaCzOOgbQYsfnaTXFlFxbeEiGwdNvxwHzkTdKtWlqzalwniDDBDipkxfflpaqkfkgfezbkxdvzemlfohwtgytzzywmwhvzUgPlPdeAVqTPAUZbogQheRXetvT",
"output": "20"
},
{
"input": "200\nNcYVomemswLCUqVRSDKHCknlBmqeSWhVyRzQrnZaOANnTGqsRFMjpczllcEVebqpxdavzppvztxsnfmtcharzqlginndyjkawzurqkxJLXiXKNZTIIxhSQghDpjwzatEqnLMTLxwoEKpHytvWkKFDUcZjLShCiVdocxRvvJtbXHCDGpJvMwRKWLhcTFtswdLUHkbhfau",
"output": "25"
},
{
"input": "200\nDxNZuvkTkQEqdWIkLzcKAwfqvZQiptnTazydSCTIfGjDhLMrlPZiKEsqIdDhgKPAlEvXyzNwWtYorotgkcwydpabjqnzubaksdchucxtkmjzfretdmvlxgklyvicrtftvztsbiUaQorfNIYUOdwQDRsKpxLUiLknbLbinilpPXPTTwLAnXVpMHBaAcKWgDBeOFabPtXU",
"output": "26"
},
{
"input": "4\nabbc",
"output": "3"
},
{
"input": "3\naaa",
"output": "1"
},
{
"input": "3\naba",
"output": "2"
},
{
"input": "3\nabb",
"output": "2"
},
{
"input": "3\nbba",
"output": "2"
},
{
"input": "3\nAaa",
"output": "1"
},
{
"input": "3\nAba",
"output": "2"
},
{
"input": "3\naBa",
"output": "1"
},
{
"input": "3\naAa",
"output": "1"
},
{
"input": "3\naAb",
"output": "1"
},
{
"input": "3\nAaA",
"output": "1"
},
{
"input": "5\naBacd",
"output": "3"
},
{
"input": "5\naAabc",
"output": "3"
}
] | 1,624,728,271
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 55
| 77
| 0
|
n=int(input())
s=input()
x=-1
for i in range(n):
if ord(s[i])>=65 and ord(s[i])<=90:
x=i
break
if x==-1:
print(len(set(s)))
elif x+1==n:
print(len(set(s[:n-1])))
else:
h=len(set(s[:x]))
l,r=x+1,x
for i in range(x,n):
if ord(s[i])>=65 and ord(s[i])<=90:
t=len(set(s[l:i]))
if t>h:
h=t
l=i+1
t=len(set(s[l:]))
if t>h:
h=t
print(h)
|
Title: Polycarp and Letters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp loves lowercase letters and dislikes uppercase ones. Once he got a string *s* consisting only of lowercase and uppercase Latin letters.
Let *A* be a set of positions in the string. Let's call it pretty if following conditions are met:
- letters on positions from *A* in the string are all distinct and lowercase; - there are no uppercase letters in the string which are situated between positions from *A* (i.e. there is no such *j* that *s*[*j*] is an uppercase letter, and *a*1<=<<=*j*<=<<=*a*2 for some *a*1 and *a*2 from *A*).
Write a program that will determine the maximum number of elements in a pretty set of positions.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=200) — length of string *s*.
The second line contains a string *s* consisting of lowercase and uppercase Latin letters.
Output Specification:
Print maximum number of elements in pretty set of positions for string *s*.
Demo Input:
['11\naaaaBaabAbA\n', '12\nzACaAbbaazzC\n', '3\nABC\n']
Demo Output:
['2\n', '3\n', '0\n']
Note:
In the first example the desired positions might be 6 and 8 or 7 and 8. Positions 6 and 7 contain letters 'a', position 8 contains letter 'b'. The pair of positions 1 and 8 is not suitable because there is an uppercase letter 'B' between these position.
In the second example desired positions can be 7, 8 and 11. There are other ways to choose pretty set consisting of three elements.
In the third example the given string *s* does not contain any lowercase letters, so the answer is 0.
|
```python
n=int(input())
s=input()
x=-1
for i in range(n):
if ord(s[i])>=65 and ord(s[i])<=90:
x=i
break
if x==-1:
print(len(set(s)))
elif x+1==n:
print(len(set(s[:n-1])))
else:
h=len(set(s[:x]))
l,r=x+1,x
for i in range(x,n):
if ord(s[i])>=65 and ord(s[i])<=90:
t=len(set(s[l:i]))
if t>h:
h=t
l=i+1
t=len(set(s[l:]))
if t>h:
h=t
print(h)
```
| 3
|
|
231
|
A
|
Team
|
PROGRAMMING
| 800
|
[
"brute force",
"greedy"
] | null | null |
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
|
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
|
Print a single integer — the number of problems the friends will implement on the contest.
|
[
"3\n1 1 0\n1 1 1\n1 0 0\n",
"2\n1 0 0\n0 1 1\n"
] |
[
"2\n",
"1\n"
] |
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
| 500
|
[
{
"input": "3\n1 1 0\n1 1 1\n1 0 0",
"output": "2"
},
{
"input": "2\n1 0 0\n0 1 1",
"output": "1"
},
{
"input": "1\n1 0 0",
"output": "0"
},
{
"input": "2\n1 0 0\n1 1 1",
"output": "1"
},
{
"input": "5\n1 0 0\n0 1 0\n1 1 1\n0 0 1\n0 0 0",
"output": "1"
},
{
"input": "10\n0 1 0\n0 1 0\n1 1 0\n1 0 0\n0 0 1\n0 1 1\n1 1 1\n1 1 0\n0 0 0\n0 0 0",
"output": "4"
},
{
"input": "15\n0 1 0\n1 0 0\n1 1 0\n1 1 1\n0 1 0\n0 0 1\n1 0 1\n1 0 1\n1 0 1\n0 0 0\n1 1 1\n1 1 0\n0 1 1\n1 1 0\n1 1 1",
"output": "10"
},
{
"input": "50\n0 0 0\n0 1 1\n1 1 1\n0 1 0\n1 0 1\n1 1 1\n0 0 1\n1 0 0\n1 1 0\n1 0 1\n0 1 0\n0 0 1\n1 1 0\n0 1 0\n1 1 0\n0 0 0\n1 1 1\n1 0 1\n0 0 1\n1 1 0\n1 1 1\n0 1 1\n1 1 0\n0 0 0\n0 0 0\n1 1 1\n0 0 0\n1 1 1\n0 1 1\n0 0 1\n0 0 0\n0 0 0\n1 1 0\n1 1 0\n1 0 1\n1 0 0\n1 0 1\n1 0 1\n0 1 1\n1 1 0\n1 1 0\n0 1 0\n1 0 1\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n1 1 1\n0 1 1\n1 0 1",
"output": "29"
},
{
"input": "1\n1 1 1",
"output": "1"
},
{
"input": "8\n0 0 0\n0 0 1\n0 0 0\n0 1 1\n1 0 0\n1 0 1\n1 1 0\n1 1 1",
"output": "4"
},
{
"input": "16\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "16"
}
] | 1,696,326,911
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 21
| 154
| 1,638,400
|
rounds = int(input())
sum = 0
for index in range(rounds):
petya, vasya, tonya = [int(oneorzero) for oneorzero in input().split()]
if petya + vasya + tonya >= 2:
sum += 1
print(sum)
|
Title: Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
Output Specification:
Print a single integer — the number of problems the friends will implement on the contest.
Demo Input:
['3\n1 1 0\n1 1 1\n1 0 0\n', '2\n1 0 0\n0 1 1\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
|
```python
rounds = int(input())
sum = 0
for index in range(rounds):
petya, vasya, tonya = [int(oneorzero) for oneorzero in input().split()]
if petya + vasya + tonya >= 2:
sum += 1
print(sum)
```
| 3
|
|
595
|
A
|
Vitaly and Night
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment.
Vitaly sees a building of *n* floors and 2·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2·*j*<=-<=1 and 2·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on.
Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping.
|
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of floors in the house and the number of flats on each floor respectively.
Next *n* lines describe the floors from top to bottom and contain 2·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'.
|
Print a single integer — the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping.
|
[
"2 2\n0 0 0 1\n1 0 1 1\n",
"1 3\n1 1 0 1 0 0\n"
] |
[
"3\n",
"2\n"
] |
In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off.
In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off.
| 500
|
[
{
"input": "2 2\n0 0 0 1\n1 0 1 1",
"output": "3"
},
{
"input": "1 3\n1 1 0 1 0 0",
"output": "2"
},
{
"input": "3 3\n1 1 1 1 1 1\n1 1 0 1 1 0\n1 0 0 0 1 1",
"output": "8"
},
{
"input": "1 5\n1 0 1 1 1 0 1 1 1 1",
"output": "5"
},
{
"input": "1 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 0 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "99"
},
{
"input": "1 100\n0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "6"
},
{
"input": "1 100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "100"
},
{
"input": "100 1\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0",
"output": "8"
},
{
"input": "100 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "1 1\n0 0",
"output": "0"
},
{
"input": "1 1\n0 1",
"output": "1"
},
{
"input": "1 1\n1 0",
"output": "1"
},
{
"input": "1 1\n1 1",
"output": "1"
}
] | 1,586,445,534
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 124
| 204,800
|
def Flats():
n, m = list(map(int, input().split()))
apartment = []
for i in range(n):
apartment.extend(list(map(int, input().split())))
times = 0
for i in range(0, len(apartment), 2):
if 1 in apartment[i:i+2]:
times += 1
print(times)
Flats()
|
Title: Vitaly and Night
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment.
Vitaly sees a building of *n* floors and 2·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2·*j*<=-<=1 and 2·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on.
Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of floors in the house and the number of flats on each floor respectively.
Next *n* lines describe the floors from top to bottom and contain 2·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'.
Output Specification:
Print a single integer — the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping.
Demo Input:
['2 2\n0 0 0 1\n1 0 1 1\n', '1 3\n1 1 0 1 0 0\n']
Demo Output:
['3\n', '2\n']
Note:
In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off.
In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off.
|
```python
def Flats():
n, m = list(map(int, input().split()))
apartment = []
for i in range(n):
apartment.extend(list(map(int, input().split())))
times = 0
for i in range(0, len(apartment), 2):
if 1 in apartment[i:i+2]:
times += 1
print(times)
Flats()
```
| 3
|
|
41
|
A
|
Translation
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Translation
|
2
|
256
|
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
|
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
|
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
|
[
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,594,348,190
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 218
| 6,656,000
|
s = input()
t = input()
t_arr = list(t)
t_arr.reverse()
t_final = ''.join(t_arr)
if s == t_final:
print('YES')
else:
print('NO')
|
Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
s = input()
t = input()
t_arr = list(t)
t_arr.reverse()
t_final = ''.join(t_arr)
if s == t_final:
print('YES')
else:
print('NO')
```
| 3.933102
|
84
|
A
|
Toy Army
|
PROGRAMMING
| 900
|
[
"math",
"number theory"
] |
A. Toy Army
|
2
|
256
|
The hero of our story, Valera, and his best friend Arcady are still in school, and therefore they spend all the free time playing turn-based strategy "GAGA: Go And Go Again". The gameplay is as follows.
There are two armies on the playing field each of which consists of *n* men (*n* is always even). The current player specifies for each of her soldiers an enemy's soldier he will shoot (a target) and then all the player's soldiers shot simultaneously. This is a game world, and so each soldier shoots perfectly, that is he absolutely always hits the specified target. If an enemy soldier is hit, he will surely die. It may happen that several soldiers had been indicated the same target. Killed soldiers do not participate in the game anymore.
The game "GAGA" consists of three steps: first Valera makes a move, then Arcady, then Valera again and the game ends.
You are asked to calculate the maximum total number of soldiers that may be killed during the game.
|
The input data consist of a single integer *n* (2<=≤<=*n*<=≤<=108, *n* is even). Please note that before the game starts there are 2*n* soldiers on the fields.
|
Print a single number — a maximum total number of soldiers that could be killed in the course of the game in three turns.
|
[
"2\n",
"4\n"
] |
[
"3\n",
"6\n"
] |
The first sample test:
1) Valera's soldiers 1 and 2 shoot at Arcady's soldier 1.
2) Arcady's soldier 2 shoots at Valera's soldier 1.
3) Valera's soldier 1 shoots at Arcady's soldier 2.
There are 3 soldiers killed in total: Valera's soldier 1 and Arcady's soldiers 1 and 2.
| 500
|
[
{
"input": "2",
"output": "3"
},
{
"input": "4",
"output": "6"
},
{
"input": "6",
"output": "9"
},
{
"input": "8",
"output": "12"
},
{
"input": "10",
"output": "15"
},
{
"input": "140",
"output": "210"
},
{
"input": "500",
"output": "750"
},
{
"input": "1000",
"output": "1500"
},
{
"input": "2000",
"output": "3000"
},
{
"input": "50000",
"output": "75000"
},
{
"input": "10000",
"output": "15000"
},
{
"input": "25460",
"output": "38190"
},
{
"input": "54646",
"output": "81969"
},
{
"input": "59790",
"output": "89685"
},
{
"input": "578456",
"output": "867684"
},
{
"input": "56798056",
"output": "85197084"
},
{
"input": "8457980",
"output": "12686970"
},
{
"input": "5687986",
"output": "8531979"
},
{
"input": "10984932",
"output": "16477398"
},
{
"input": "99999994",
"output": "149999991"
},
{
"input": "99999996",
"output": "149999994"
},
{
"input": "99999998",
"output": "149999997"
},
{
"input": "100000000",
"output": "150000000"
}
] | 1,679,122,018
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 23
| 92
| 0
|
n=eval(input())
if n%2==0:
print(int(n/2*3))
else:
print(4*((n-1)%2)-2)
|
Title: Toy Army
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The hero of our story, Valera, and his best friend Arcady are still in school, and therefore they spend all the free time playing turn-based strategy "GAGA: Go And Go Again". The gameplay is as follows.
There are two armies on the playing field each of which consists of *n* men (*n* is always even). The current player specifies for each of her soldiers an enemy's soldier he will shoot (a target) and then all the player's soldiers shot simultaneously. This is a game world, and so each soldier shoots perfectly, that is he absolutely always hits the specified target. If an enemy soldier is hit, he will surely die. It may happen that several soldiers had been indicated the same target. Killed soldiers do not participate in the game anymore.
The game "GAGA" consists of three steps: first Valera makes a move, then Arcady, then Valera again and the game ends.
You are asked to calculate the maximum total number of soldiers that may be killed during the game.
Input Specification:
The input data consist of a single integer *n* (2<=≤<=*n*<=≤<=108, *n* is even). Please note that before the game starts there are 2*n* soldiers on the fields.
Output Specification:
Print a single number — a maximum total number of soldiers that could be killed in the course of the game in three turns.
Demo Input:
['2\n', '4\n']
Demo Output:
['3\n', '6\n']
Note:
The first sample test:
1) Valera's soldiers 1 and 2 shoot at Arcady's soldier 1.
2) Arcady's soldier 2 shoots at Valera's soldier 1.
3) Valera's soldier 1 shoots at Arcady's soldier 2.
There are 3 soldiers killed in total: Valera's soldier 1 and Arcady's soldiers 1 and 2.
|
```python
n=eval(input())
if n%2==0:
print(int(n/2*3))
else:
print(4*((n-1)%2)-2)
```
| 3.977
|
855
|
A
|
Tom Riddle's Diary
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"strings"
] | null | null |
Harry Potter is on a mission to destroy You-Know-Who's Horcruxes. The first Horcrux that he encountered in the Chamber of Secrets is Tom Riddle's diary. The diary was with Ginny and it forced her to open the Chamber of Secrets. Harry wants to know the different people who had ever possessed the diary to make sure they are not under its influence.
He has names of *n* people who possessed the diary in order. You need to tell, for each person, if he/she possessed the diary at some point before or not.
Formally, for a name *s**i* in the *i*-th line, output "YES" (without quotes) if there exists an index *j* such that *s**i*<==<=*s**j* and *j*<=<<=*i*, otherwise, output "NO" (without quotes).
|
First line of input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of names in the list.
Next *n* lines each contain a string *s**i*, consisting of lowercase English letters. The length of each string is between 1 and 100.
|
Output *n* lines each containing either "YES" or "NO" (without quotes), depending on whether this string was already present in the stream or not.
You can print each letter in any case (upper or lower).
|
[
"6\ntom\nlucius\nginny\nharry\nginny\nharry\n",
"3\na\na\na\n"
] |
[
"NO\nNO\nNO\nNO\nYES\nYES\n",
"NO\nYES\nYES\n"
] |
In test case 1, for *i* = 5 there exists *j* = 3 such that *s*<sub class="lower-index">*i*</sub> = *s*<sub class="lower-index">*j*</sub> and *j* < *i*, which means that answer for *i* = 5 is "YES".
| 500
|
[
{
"input": "6\ntom\nlucius\nginny\nharry\nginny\nharry",
"output": "NO\nNO\nNO\nNO\nYES\nYES"
},
{
"input": "3\na\na\na",
"output": "NO\nYES\nYES"
},
{
"input": "1\nzn",
"output": "NO"
},
{
"input": "9\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nhrtm\nssjqvixduertmotgagizamvfucfwtxqnhuowbqbzctgznivehelpcyigwrbbdsxnewfqvcf\nhyrtxvozpbveexfkgalmguozzakitjiwsduqxonb\nwcyxteiwtcyuztaguilqpbiwcwjaiq\nwcyxteiwtcyuztaguilqpbiwcwjaiq\nbdbivqzvhggth",
"output": "NO\nYES\nYES\nNO\nNO\nNO\nNO\nYES\nNO"
},
{
"input": "10\nkkiubdktydpdcbbttwpfdplhhjhrpqmpg\nkkiubdktydpdcbbttwpfdplhhjhrpqmpg\nmvutw\nqooeqoxzxwetlpecqiwgdbogiqqulttysyohwhzxzphvsfmnplizxoebzcvvfyppqbhxjksuzepuezqqzxlfmdanoeaoqmor\nmvutw\nvchawxjoreboqzuklifv\nvchawxjoreboqzuklifv\nnivijte\nrflybruq\nvchawxjoreboqzuklifv",
"output": "NO\nYES\nNO\nNO\nYES\nNO\nYES\nNO\nNO\nYES"
},
{
"input": "1\nz",
"output": "NO"
},
{
"input": "9\nl\ny\nm\nj\nn\nr\nj\nk\nf",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nNO"
},
{
"input": "14\nw\na\nh\np\nk\nw\ny\nv\ns\nf\nx\nd\nk\nr",
"output": "NO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO"
},
{
"input": "25\np\nk\nu\nl\nf\nt\nc\ns\nq\nd\nb\nq\no\ni\ni\nd\ni\nw\nn\ng\nw\nt\na\ne\ni",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nYES\nYES\nYES\nNO\nNO\nNO\nYES\nYES\nNO\nNO\nYES"
},
{
"input": "20\nd\nh\ng\no\np\ne\nt\nj\nv\ni\nt\nh\ns\ni\nw\nf\nx\na\nl\ni",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nYES\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nYES"
},
{
"input": "3\nbbbbbbb\nbbbbbbbbb\nbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "NO\nNO\nNO"
},
{
"input": "2\nab\nba",
"output": "NO\nNO"
},
{
"input": "6\ntom\nlucius\nginnys\nharpy\nginny\nharry",
"output": "NO\nNO\nNO\nNO\nNO\nNO"
},
{
"input": "2\nabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcde\nabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcde",
"output": "NO\nYES"
},
{
"input": "42\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na",
"output": "NO\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES"
}
] | 1,609,135,472
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 55
| 109
| 0
|
n=int(input())
alist=[]
for i in range(n):
name=str(input())
alist.append(name)
blist=[]
blist.append("NO")
for i in range(1,n):
if alist[i] in alist[0:i]:
blist.append("YES")
else:
blist.append("NO")
for i in blist:
print(i)
|
Title: Tom Riddle's Diary
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Harry Potter is on a mission to destroy You-Know-Who's Horcruxes. The first Horcrux that he encountered in the Chamber of Secrets is Tom Riddle's diary. The diary was with Ginny and it forced her to open the Chamber of Secrets. Harry wants to know the different people who had ever possessed the diary to make sure they are not under its influence.
He has names of *n* people who possessed the diary in order. You need to tell, for each person, if he/she possessed the diary at some point before or not.
Formally, for a name *s**i* in the *i*-th line, output "YES" (without quotes) if there exists an index *j* such that *s**i*<==<=*s**j* and *j*<=<<=*i*, otherwise, output "NO" (without quotes).
Input Specification:
First line of input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of names in the list.
Next *n* lines each contain a string *s**i*, consisting of lowercase English letters. The length of each string is between 1 and 100.
Output Specification:
Output *n* lines each containing either "YES" or "NO" (without quotes), depending on whether this string was already present in the stream or not.
You can print each letter in any case (upper or lower).
Demo Input:
['6\ntom\nlucius\nginny\nharry\nginny\nharry\n', '3\na\na\na\n']
Demo Output:
['NO\nNO\nNO\nNO\nYES\nYES\n', 'NO\nYES\nYES\n']
Note:
In test case 1, for *i* = 5 there exists *j* = 3 such that *s*<sub class="lower-index">*i*</sub> = *s*<sub class="lower-index">*j*</sub> and *j* < *i*, which means that answer for *i* = 5 is "YES".
|
```python
n=int(input())
alist=[]
for i in range(n):
name=str(input())
alist.append(name)
blist=[]
blist.append("NO")
for i in range(1,n):
if alist[i] in alist[0:i]:
blist.append("YES")
else:
blist.append("NO")
for i in blist:
print(i)
```
| 3
|
|
699
|
A
|
Launch of Collider
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
There will be a launch of a new, powerful and unusual collider very soon, which located along a straight line. *n* particles will be launched inside it. All of them are located in a straight line and there can not be two or more particles located in the same point. The coordinates of the particles coincide with the distance in meters from the center of the collider, *x**i* is the coordinate of the *i*-th particle and its position in the collider at the same time. All coordinates of particle positions are even integers.
You know the direction of each particle movement — it will move to the right or to the left after the collider's launch start. All particles begin to move simultaneously at the time of the collider's launch start. Each particle will move straight to the left or straight to the right with the constant speed of 1 meter per microsecond. The collider is big enough so particles can not leave it in the foreseeable time.
Write the program which finds the moment of the first collision of any two particles of the collider. In other words, find the number of microseconds before the first moment when any two particles are at the same point.
|
The first line contains the positive integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of particles.
The second line contains *n* symbols "L" and "R". If the *i*-th symbol equals "L", then the *i*-th particle will move to the left, otherwise the *i*-th symbol equals "R" and the *i*-th particle will move to the right.
The third line contains the sequence of pairwise distinct even integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=109) — the coordinates of particles in the order from the left to the right. It is guaranteed that the coordinates of particles are given in the increasing order.
|
In the first line print the only integer — the first moment (in microseconds) when two particles are at the same point and there will be an explosion.
Print the only integer -1, if the collision of particles doesn't happen.
|
[
"4\nRLRL\n2 4 6 10\n",
"3\nLLR\n40 50 60\n"
] |
[
"1\n",
"-1\n"
] |
In the first sample case the first explosion will happen in 1 microsecond because the particles number 1 and 2 will simultaneously be at the same point with the coordinate 3.
In the second sample case there will be no explosion because there are no particles which will simultaneously be at the same point.
| 500
|
[
{
"input": "4\nRLRL\n2 4 6 10",
"output": "1"
},
{
"input": "3\nLLR\n40 50 60",
"output": "-1"
},
{
"input": "4\nRLLR\n46 230 264 470",
"output": "92"
},
{
"input": "6\nLLRLLL\n446 492 650 844 930 970",
"output": "97"
},
{
"input": "8\nRRLLLLLL\n338 478 512 574 594 622 834 922",
"output": "17"
},
{
"input": "10\nLRLRLLRRLR\n82 268 430 598 604 658 670 788 838 1000",
"output": "3"
},
{
"input": "2\nRL\n0 1000000000",
"output": "500000000"
},
{
"input": "12\nLRLLRRRRLRLL\n254 1260 1476 1768 2924 4126 4150 4602 5578 7142 8134 9082",
"output": "108"
},
{
"input": "14\nRLLRRLRLLRLLLR\n698 2900 3476 3724 3772 3948 4320 4798 5680 6578 7754 8034 8300 8418",
"output": "88"
},
{
"input": "16\nRRLLLRLRLLLLRLLR\n222 306 968 1060 1636 1782 2314 2710 3728 4608 5088 6790 6910 7156 7418 7668",
"output": "123"
},
{
"input": "18\nRLRLLRRRLLLRLRRLRL\n1692 2028 2966 3008 3632 4890 5124 5838 6596 6598 6890 8294 8314 8752 8868 9396 9616 9808",
"output": "10"
},
{
"input": "20\nRLLLLLLLRRRRLRRLRRLR\n380 902 1400 1834 2180 2366 2562 2596 2702 2816 3222 3238 3742 5434 6480 7220 7410 8752 9708 9970",
"output": "252"
},
{
"input": "22\nLRRRRRRRRRRRLLRRRRRLRL\n1790 2150 2178 2456 2736 3282 3622 4114 4490 4772 5204 5240 5720 5840 5910 5912 6586 7920 8584 9404 9734 9830",
"output": "48"
},
{
"input": "24\nLLRLRRLLRLRRRRLLRRLRLRRL\n100 360 864 1078 1360 1384 1438 2320 2618 3074 3874 3916 3964 5178 5578 6278 6630 6992 8648 8738 8922 8930 9276 9720",
"output": "27"
},
{
"input": "26\nRLLLLLLLRLRRLRLRLRLRLLLRRR\n908 1826 2472 2474 2728 3654 3716 3718 3810 3928 4058 4418 4700 5024 5768 6006 6128 6386 6968 7040 7452 7774 7822 8726 9338 9402",
"output": "59"
},
{
"input": "28\nRRLRLRRRRRRLLLRRLRRLLLRRLLLR\n156 172 1120 1362 2512 3326 3718 4804 4990 5810 6242 6756 6812 6890 6974 7014 7088 7724 8136 8596 8770 8840 9244 9250 9270 9372 9400 9626",
"output": "10"
},
{
"input": "30\nRLLRLRLLRRRLRRRLLLLLLRRRLRRLRL\n128 610 1680 2436 2896 2994 3008 3358 3392 4020 4298 4582 4712 4728 5136 5900 6088 6232 6282 6858 6934 7186 7224 7256 7614 8802 8872 9170 9384 9794",
"output": "7"
},
{
"input": "10\nLLLLRRRRRR\n0 2 4 6 8 10 12 14 16 18",
"output": "-1"
},
{
"input": "5\nLLLLL\n0 10 20 30 40",
"output": "-1"
},
{
"input": "6\nRRRRRR\n40 50 60 70 80 100",
"output": "-1"
},
{
"input": "1\nR\n0",
"output": "-1"
},
{
"input": "2\nRL\n2 1000000000",
"output": "499999999"
},
{
"input": "2\nRL\n0 400000",
"output": "200000"
},
{
"input": "2\nRL\n0 200002",
"output": "100001"
},
{
"input": "2\nRL\n2 20000000",
"output": "9999999"
},
{
"input": "4\nLLRL\n2 4 10 100",
"output": "45"
},
{
"input": "4\nRLRL\n2 10 12 14",
"output": "1"
},
{
"input": "2\nRL\n0 100000000",
"output": "50000000"
},
{
"input": "2\nRL\n2 600002",
"output": "300000"
},
{
"input": "1\nL\n0",
"output": "-1"
},
{
"input": "2\nRL\n0 600000",
"output": "300000"
},
{
"input": "5\nRRRRR\n0 2 4 6 8",
"output": "-1"
},
{
"input": "2\nRL\n2 200000000",
"output": "99999999"
},
{
"input": "2\nRL\n0 267382766",
"output": "133691383"
},
{
"input": "3\nRRL\n4 8 999999998",
"output": "499999995"
},
{
"input": "2\nRL\n0 2",
"output": "1"
},
{
"input": "2\nRL\n2 400002",
"output": "200000"
},
{
"input": "2\nLL\n2 4",
"output": "-1"
},
{
"input": "2\nLL\n0 2",
"output": "-1"
},
{
"input": "2\nRL\n0 100000",
"output": "50000"
},
{
"input": "2\nRL\n2 200000020",
"output": "100000009"
},
{
"input": "2\nRL\n2000000 4000000",
"output": "1000000"
},
{
"input": "2\nRL\n0 199998",
"output": "99999"
},
{
"input": "3\nLRR\n40 50 60",
"output": "-1"
},
{
"input": "2\nRL\n200 400400",
"output": "200100"
},
{
"input": "2\nRL\n2 400004",
"output": "200001"
},
{
"input": "2\nRL\n0 200000000",
"output": "100000000"
}
] | 1,622,744,896
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 85
| 639
| 16,076,800
|
import re
def calcMoments (r , l):
return (l - r) / 2
moment = 0
many = int(input()) # 7
dirline = input() # RLLRRLR, R -> ++ L-> --
coor = [int(x) for x in input().split()] # 2 4 6 10 , even, increasing order 2 4 6 16
closest = -1
Rpos = [m.start() for m in re.finditer('R', dirline)] #[0, 3, 4, 6]
index = 0
once = True
expect = False
lst = list()
for r in Rpos:
if r == len(dirline)-1: break
if index+1 < len(Rpos) and r == Rpos[index+1]-1:
index = index +1
continue
index = index +1
expect = True # lst.append((r, r+1))
if once:
closest = calcMoments(coor[r], coor[r+1])
once = False
if calcMoments(coor[r], coor[r+1]) < closest:
closest = calcMoments(coor[r], coor[r+1])
if not expect:
print(-1)
else:
print(int(closest))
|
Title: Launch of Collider
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There will be a launch of a new, powerful and unusual collider very soon, which located along a straight line. *n* particles will be launched inside it. All of them are located in a straight line and there can not be two or more particles located in the same point. The coordinates of the particles coincide with the distance in meters from the center of the collider, *x**i* is the coordinate of the *i*-th particle and its position in the collider at the same time. All coordinates of particle positions are even integers.
You know the direction of each particle movement — it will move to the right or to the left after the collider's launch start. All particles begin to move simultaneously at the time of the collider's launch start. Each particle will move straight to the left or straight to the right with the constant speed of 1 meter per microsecond. The collider is big enough so particles can not leave it in the foreseeable time.
Write the program which finds the moment of the first collision of any two particles of the collider. In other words, find the number of microseconds before the first moment when any two particles are at the same point.
Input Specification:
The first line contains the positive integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of particles.
The second line contains *n* symbols "L" and "R". If the *i*-th symbol equals "L", then the *i*-th particle will move to the left, otherwise the *i*-th symbol equals "R" and the *i*-th particle will move to the right.
The third line contains the sequence of pairwise distinct even integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=109) — the coordinates of particles in the order from the left to the right. It is guaranteed that the coordinates of particles are given in the increasing order.
Output Specification:
In the first line print the only integer — the first moment (in microseconds) when two particles are at the same point and there will be an explosion.
Print the only integer -1, if the collision of particles doesn't happen.
Demo Input:
['4\nRLRL\n2 4 6 10\n', '3\nLLR\n40 50 60\n']
Demo Output:
['1\n', '-1\n']
Note:
In the first sample case the first explosion will happen in 1 microsecond because the particles number 1 and 2 will simultaneously be at the same point with the coordinate 3.
In the second sample case there will be no explosion because there are no particles which will simultaneously be at the same point.
|
```python
import re
def calcMoments (r , l):
return (l - r) / 2
moment = 0
many = int(input()) # 7
dirline = input() # RLLRRLR, R -> ++ L-> --
coor = [int(x) for x in input().split()] # 2 4 6 10 , even, increasing order 2 4 6 16
closest = -1
Rpos = [m.start() for m in re.finditer('R', dirline)] #[0, 3, 4, 6]
index = 0
once = True
expect = False
lst = list()
for r in Rpos:
if r == len(dirline)-1: break
if index+1 < len(Rpos) and r == Rpos[index+1]-1:
index = index +1
continue
index = index +1
expect = True # lst.append((r, r+1))
if once:
closest = calcMoments(coor[r], coor[r+1])
once = False
if calcMoments(coor[r], coor[r+1]) < closest:
closest = calcMoments(coor[r], coor[r+1])
if not expect:
print(-1)
else:
print(int(closest))
```
| 3
|
|
452
|
A
|
Eevee
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation",
"strings"
] | null | null |
You are solving the crossword problem K from IPSC 2014. You solved all the clues except for one: who does Eevee evolve into? You are not very into pokemons, but quick googling helped you find out, that Eevee can evolve into eight different pokemons: Vaporeon, Jolteon, Flareon, Espeon, Umbreon, Leafeon, Glaceon, and Sylveon.
You know the length of the word in the crossword, and you already know some letters. Designers of the crossword made sure that the answer is unambiguous, so you can assume that exactly one pokemon out of the 8 that Eevee evolves into fits the length and the letters given. Your task is to find it.
|
First line contains an integer *n* (6<=≤<=*n*<=≤<=8) – the length of the string.
Next line contains a string consisting of *n* characters, each of which is either a lower case english letter (indicating a known letter) or a dot character (indicating an empty cell in the crossword).
|
Print a name of the pokemon that Eevee can evolve into that matches the pattern in the input. Use lower case letters only to print the name (in particular, do not capitalize the first letter).
|
[
"7\nj......\n",
"7\n...feon\n",
"7\n.l.r.o.\n"
] |
[
"jolteon\n",
"leafeon\n",
"flareon\n"
] |
Here's a set of names in a form you can paste into your solution:
["vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"]
{"vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"}
| 500
|
[
{
"input": "7\n...feon",
"output": "leafeon"
},
{
"input": "7\n.l.r.o.",
"output": "flareon"
},
{
"input": "6\n.s..o.",
"output": "espeon"
},
{
"input": "7\nglaceon",
"output": "glaceon"
},
{
"input": "8\n.a.o.e.n",
"output": "vaporeon"
},
{
"input": "7\n.laceon",
"output": "glaceon"
},
{
"input": "7\n..lveon",
"output": "sylveon"
},
{
"input": "7\n.l.ceon",
"output": "glaceon"
},
{
"input": "7\n..areon",
"output": "flareon"
}
] | 1,557,837,811
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 124
| 0
|
b=["vaporeon", "jolteon", "flareon" , "espeon", "umbreon", "leafeon", "glaceon", "sylveon"]
n=int(input())
a=input()
c=0
# for x in a:
# for y in b:
# for z in y:
# if
b=[x for x in b if len(x)==n]
for word in b:
for x in range(n):
if a[x]=='.':
continue
elif a[x]!=word[x]:
break
if x+1==n:
print(word)
|
Title: Eevee
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are solving the crossword problem K from IPSC 2014. You solved all the clues except for one: who does Eevee evolve into? You are not very into pokemons, but quick googling helped you find out, that Eevee can evolve into eight different pokemons: Vaporeon, Jolteon, Flareon, Espeon, Umbreon, Leafeon, Glaceon, and Sylveon.
You know the length of the word in the crossword, and you already know some letters. Designers of the crossword made sure that the answer is unambiguous, so you can assume that exactly one pokemon out of the 8 that Eevee evolves into fits the length and the letters given. Your task is to find it.
Input Specification:
First line contains an integer *n* (6<=≤<=*n*<=≤<=8) – the length of the string.
Next line contains a string consisting of *n* characters, each of which is either a lower case english letter (indicating a known letter) or a dot character (indicating an empty cell in the crossword).
Output Specification:
Print a name of the pokemon that Eevee can evolve into that matches the pattern in the input. Use lower case letters only to print the name (in particular, do not capitalize the first letter).
Demo Input:
['7\nj......\n', '7\n...feon\n', '7\n.l.r.o.\n']
Demo Output:
['jolteon\n', 'leafeon\n', 'flareon\n']
Note:
Here's a set of names in a form you can paste into your solution:
["vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"]
{"vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"}
|
```python
b=["vaporeon", "jolteon", "flareon" , "espeon", "umbreon", "leafeon", "glaceon", "sylveon"]
n=int(input())
a=input()
c=0
# for x in a:
# for y in b:
# for z in y:
# if
b=[x for x in b if len(x)==n]
for word in b:
for x in range(n):
if a[x]=='.':
continue
elif a[x]!=word[x]:
break
if x+1==n:
print(word)
```
| 3
|
|
540
|
A
|
Combination Lock
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Scrooge McDuck keeps his most treasured savings in a home safe with a combination lock. Each time he wants to put there the treasures that he's earned fair and square, he has to open the lock.
The combination lock is represented by *n* rotating disks with digits from 0 to 9 written on them. Scrooge McDuck has to turn some disks so that the combination of digits on the disks forms a secret combination. In one move, he can rotate one disk one digit forwards or backwards. In particular, in one move he can go from digit 0 to digit 9 and vice versa. What minimum number of actions does he need for that?
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of disks on the combination lock.
The second line contains a string of *n* digits — the original state of the disks.
The third line contains a string of *n* digits — Scrooge McDuck's combination that opens the lock.
|
Print a single integer — the minimum number of moves Scrooge McDuck needs to open the lock.
|
[
"5\n82195\n64723\n"
] |
[
"13\n"
] |
In the sample he needs 13 moves:
- 1 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b8967f65a723782358b93eff9ce69f336817cf70.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 2 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/07fa58573ece0d32c4d555e498d2b24d2f70f36a.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 3 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cc2275d9252aae35a6867c6a5b4ba7596e9a7626.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 4 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b100aea470fcaaab4e9529b234ba0d7875943c10.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 5 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/eb2cbe4324cebca65b85816262a85e473cd65967.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 500
|
[
{
"input": "5\n82195\n64723",
"output": "13"
},
{
"input": "12\n102021090898\n010212908089",
"output": "16"
},
{
"input": "1\n8\n1",
"output": "3"
},
{
"input": "2\n83\n57",
"output": "7"
},
{
"input": "10\n0728592530\n1362615763",
"output": "27"
},
{
"input": "100\n4176196363694273682807653052945037727131821799902563705176501742060696655282954944720643131654235909\n3459912084922154505910287499879975659298239371519889866585472674423008837878123067103005344986554746",
"output": "245"
},
{
"input": "1\n8\n1",
"output": "3"
},
{
"input": "2\n83\n57",
"output": "7"
},
{
"input": "3\n607\n684",
"output": "5"
},
{
"input": "4\n0809\n0636",
"output": "8"
},
{
"input": "5\n84284\n08941",
"output": "16"
},
{
"input": "25\n8037856825987124762280548\n9519431339078678836940020",
"output": "72"
},
{
"input": "125\n23269567683904664184142384849516523616863461607751021071772615078579713054027902974007001544768640273491193035874486891541257\n47635110303703399505805044019026243695451609639556649012447370081552870340011971572363458960190590266459684717415349529509024",
"output": "305"
},
{
"input": "5\n84284\n08941",
"output": "16"
},
{
"input": "25\n8037856825987124762285484\n9519431339078678836940202",
"output": "74"
},
{
"input": "125\n23269567689466418414238845152168634610771021717726157879713054270294007001544768647391193035874486891412573389247025830678706\n47635110307339950580504010224954516093956649124473708152870340117152363458960190596659684717415349529090241694059599629136831",
"output": "357"
},
{
"input": "5\n84284\n08941",
"output": "16"
},
{
"input": "25\n8378525987476228048406972\n9194339078883694020217816",
"output": "55"
},
{
"input": "125\n23269576839046618414238484916523616863461607750210717761078579713054027902974007015447686027349193035874486891541257338624472\n47635103037033950580504401926243695451609639556490124437081552870340011971572363489601905026645984717415349529509024169604599",
"output": "274"
},
{
"input": "1\n0\n0",
"output": "0"
},
{
"input": "1\n7\n7",
"output": "0"
},
{
"input": "1\n0\n5",
"output": "5"
},
{
"input": "1\n2\n7",
"output": "5"
},
{
"input": "1\n7\n9",
"output": "2"
},
{
"input": "1\n9\n7",
"output": "2"
},
{
"input": "1\n2\n9",
"output": "3"
},
{
"input": "1\n9\n2",
"output": "3"
},
{
"input": "25\n3164978461316464614169874\n9413979197249127496597357",
"output": "66"
},
{
"input": "4\n9999\n9999",
"output": "0"
},
{
"input": "2\n11\n11",
"output": "0"
}
] | 1,684,420,639
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 43
| 31
| 0
|
n=int(input())
a=input()
b=input()
count=0
for i in range(n):
if((int(a[i])-int(b[i]))<0):
if(((9-int(b[i])+int(a[i])-0)+1)<(int(b[i])-int(a[i]))):
count+=9-int(b[i])+int(a[i])-0+1
else:
count+=int(b[i])-int(a[i])
else:
if(((9-int(a[i])+int(b[i])+1)-0)<(int(a[i])-int(b[i]))):
count+=9-int(a[i])+int(b[i])-0+1
else:
count+=int(a[i])-int(b[i])
print(count)
|
Title: Combination Lock
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Scrooge McDuck keeps his most treasured savings in a home safe with a combination lock. Each time he wants to put there the treasures that he's earned fair and square, he has to open the lock.
The combination lock is represented by *n* rotating disks with digits from 0 to 9 written on them. Scrooge McDuck has to turn some disks so that the combination of digits on the disks forms a secret combination. In one move, he can rotate one disk one digit forwards or backwards. In particular, in one move he can go from digit 0 to digit 9 and vice versa. What minimum number of actions does he need for that?
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of disks on the combination lock.
The second line contains a string of *n* digits — the original state of the disks.
The third line contains a string of *n* digits — Scrooge McDuck's combination that opens the lock.
Output Specification:
Print a single integer — the minimum number of moves Scrooge McDuck needs to open the lock.
Demo Input:
['5\n82195\n64723\n']
Demo Output:
['13\n']
Note:
In the sample he needs 13 moves:
- 1 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b8967f65a723782358b93eff9ce69f336817cf70.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 2 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/07fa58573ece0d32c4d555e498d2b24d2f70f36a.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 3 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cc2275d9252aae35a6867c6a5b4ba7596e9a7626.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 4 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b100aea470fcaaab4e9529b234ba0d7875943c10.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 5 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/eb2cbe4324cebca65b85816262a85e473cd65967.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
n=int(input())
a=input()
b=input()
count=0
for i in range(n):
if((int(a[i])-int(b[i]))<0):
if(((9-int(b[i])+int(a[i])-0)+1)<(int(b[i])-int(a[i]))):
count+=9-int(b[i])+int(a[i])-0+1
else:
count+=int(b[i])-int(a[i])
else:
if(((9-int(a[i])+int(b[i])+1)-0)<(int(a[i])-int(b[i]))):
count+=9-int(a[i])+int(b[i])-0+1
else:
count+=int(a[i])-int(b[i])
print(count)
```
| 3
|
|
493
|
B
|
Vasya and Wrestling
|
PROGRAMMING
| 1,400
|
[
"implementation"
] | null | null |
Vasya has become interested in wrestling. In wrestling wrestlers use techniques for which they are awarded points by judges. The wrestler who gets the most points wins.
When the numbers of points of both wrestlers are equal, the wrestler whose sequence of points is lexicographically greater, wins.
If the sequences of the awarded points coincide, the wrestler who performed the last technique wins. Your task is to determine which wrestler won.
|
The first line contains number *n* — the number of techniques that the wrestlers have used (1<=≤<=*n*<=≤<=2·105).
The following *n* lines contain integer numbers *a**i* (|*a**i*|<=≤<=109, *a**i*<=≠<=0). If *a**i* is positive, that means that the first wrestler performed the technique that was awarded with *a**i* points. And if *a**i* is negative, that means that the second wrestler performed the technique that was awarded with (<=-<=*a**i*) points.
The techniques are given in chronological order.
|
If the first wrestler wins, print string "first", otherwise print "second"
|
[
"5\n1\n2\n-3\n-4\n3\n",
"3\n-1\n-2\n3\n",
"2\n4\n-4\n"
] |
[
"second\n",
"first\n",
"second\n"
] |
Sequence *x* = *x*<sub class="lower-index">1</sub>*x*<sub class="lower-index">2</sub>... *x*<sub class="lower-index">|*x*|</sub> is lexicographically larger than sequence *y* = *y*<sub class="lower-index">1</sub>*y*<sub class="lower-index">2</sub>... *y*<sub class="lower-index">|*y*|</sub>, if either |*x*| > |*y*| and *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">|*y*|</sub> = *y*<sub class="lower-index">|*y*|</sub>, or there is such number *r* (*r* < |*x*|, *r* < |*y*|), that *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">*r*</sub> = *y*<sub class="lower-index">*r*</sub> and *x*<sub class="lower-index">*r* + 1</sub> > *y*<sub class="lower-index">*r* + 1</sub>.
We use notation |*a*| to denote length of sequence *a*.
| 1,000
|
[
{
"input": "5\n1\n2\n-3\n-4\n3",
"output": "second"
},
{
"input": "3\n-1\n-2\n3",
"output": "first"
},
{
"input": "2\n4\n-4",
"output": "second"
},
{
"input": "7\n1\n2\n-3\n4\n5\n-6\n7",
"output": "first"
},
{
"input": "14\n1\n2\n3\n4\n5\n6\n7\n-8\n-9\n-10\n-11\n-12\n-13\n-14",
"output": "second"
},
{
"input": "4\n16\n12\n19\n-98",
"output": "second"
},
{
"input": "5\n-6\n-1\n-1\n5\n3",
"output": "second"
},
{
"input": "11\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1",
"output": "first"
},
{
"input": "1\n-534365",
"output": "second"
},
{
"input": "1\n10253033",
"output": "first"
},
{
"input": "3\n-1\n-2\n3",
"output": "first"
},
{
"input": "8\n1\n-2\n-3\n4\n5\n-6\n-7\n8",
"output": "second"
},
{
"input": "2\n1\n-1",
"output": "second"
},
{
"input": "5\n1\n2\n3\n4\n5",
"output": "first"
},
{
"input": "5\n-1\n-2\n-3\n-4\n-5",
"output": "second"
},
{
"input": "10\n-1\n-2\n-3\n-4\n-5\n5\n4\n3\n2\n1",
"output": "first"
},
{
"input": "131\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n-1\n-1\n2",
"output": "first"
},
{
"input": "6\n-1\n-2\n-3\n1\n2\n3",
"output": "first"
},
{
"input": "3\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "12\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "4\n1000000000\n1000000000\n1000000000\n-1000000000",
"output": "first"
},
{
"input": "20\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "5\n1000000000\n1000000000\n-1000000000\n-1000000000\n-1000000000",
"output": "second"
},
{
"input": "4\n1\n-1000000000\n-1000000000\n-1000000000",
"output": "second"
},
{
"input": "5\n1000000000\n1000000000\n1000000000\n-1000000000\n-1000000000",
"output": "first"
},
{
"input": "4\n-1\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "11\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "2\n-4\n4",
"output": "first"
},
{
"input": "3\n-12\n3\n9",
"output": "second"
},
{
"input": "3\n9\n1\n-10",
"output": "second"
},
{
"input": "3\n1\n2\n-3",
"output": "second"
},
{
"input": "4\n55\n5\n-5\n-55",
"output": "first"
},
{
"input": "4\n5\n-1\n1\n-5",
"output": "first"
},
{
"input": "2\n-5\n6",
"output": "first"
},
{
"input": "4\n5\n-4\n3\n-40",
"output": "second"
},
{
"input": "4\n1000000000\n1000000000\n1000000000\n-5",
"output": "first"
},
{
"input": "6\n3\n2\n1\n-3\n-1\n-2",
"output": "first"
},
{
"input": "5\n4\n1\n1\n-3\n-3",
"output": "first"
},
{
"input": "5\n208\n-52\n-52\n-52\n-52",
"output": "first"
},
{
"input": "3\n-100\n-200\n300",
"output": "first"
},
{
"input": "3\n400\n-200\n-200",
"output": "first"
},
{
"input": "3\n208\n-207\n-1",
"output": "first"
},
{
"input": "3\n98888887\n98888888\n-197777775",
"output": "second"
}
] | 1,608,620,997
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 57
| 1,466
| 10,649,600
|
arr = []
brr = []
for _ in range(int(input())):
n = int(input())
#print(n)
if n > 0:
arr.append(n)
else:
brr.append(-1*n)
#print(arr,brr,n)
if sum(arr) > sum(brr):
print("first")
elif sum(arr) < sum(brr):
print("second")
else:
if arr > brr:
print("first")
elif arr < brr:
print("second")
else:
if n > 0:
print("first")
else:
print("second")
|
Title: Vasya and Wrestling
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has become interested in wrestling. In wrestling wrestlers use techniques for which they are awarded points by judges. The wrestler who gets the most points wins.
When the numbers of points of both wrestlers are equal, the wrestler whose sequence of points is lexicographically greater, wins.
If the sequences of the awarded points coincide, the wrestler who performed the last technique wins. Your task is to determine which wrestler won.
Input Specification:
The first line contains number *n* — the number of techniques that the wrestlers have used (1<=≤<=*n*<=≤<=2·105).
The following *n* lines contain integer numbers *a**i* (|*a**i*|<=≤<=109, *a**i*<=≠<=0). If *a**i* is positive, that means that the first wrestler performed the technique that was awarded with *a**i* points. And if *a**i* is negative, that means that the second wrestler performed the technique that was awarded with (<=-<=*a**i*) points.
The techniques are given in chronological order.
Output Specification:
If the first wrestler wins, print string "first", otherwise print "second"
Demo Input:
['5\n1\n2\n-3\n-4\n3\n', '3\n-1\n-2\n3\n', '2\n4\n-4\n']
Demo Output:
['second\n', 'first\n', 'second\n']
Note:
Sequence *x* = *x*<sub class="lower-index">1</sub>*x*<sub class="lower-index">2</sub>... *x*<sub class="lower-index">|*x*|</sub> is lexicographically larger than sequence *y* = *y*<sub class="lower-index">1</sub>*y*<sub class="lower-index">2</sub>... *y*<sub class="lower-index">|*y*|</sub>, if either |*x*| > |*y*| and *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">|*y*|</sub> = *y*<sub class="lower-index">|*y*|</sub>, or there is such number *r* (*r* < |*x*|, *r* < |*y*|), that *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">*r*</sub> = *y*<sub class="lower-index">*r*</sub> and *x*<sub class="lower-index">*r* + 1</sub> > *y*<sub class="lower-index">*r* + 1</sub>.
We use notation |*a*| to denote length of sequence *a*.
|
```python
arr = []
brr = []
for _ in range(int(input())):
n = int(input())
#print(n)
if n > 0:
arr.append(n)
else:
brr.append(-1*n)
#print(arr,brr,n)
if sum(arr) > sum(brr):
print("first")
elif sum(arr) < sum(brr):
print("second")
else:
if arr > brr:
print("first")
elif arr < brr:
print("second")
else:
if n > 0:
print("first")
else:
print("second")
```
| 3
|
|
242
|
B
|
Big Segment
|
PROGRAMMING
| 1,100
|
[
"implementation",
"sortings"
] | null | null |
A coordinate line has *n* segments, the *i*-th segment starts at the position *l**i* and ends at the position *r**i*. We will denote such a segment as [*l**i*,<=*r**i*].
You have suggested that one of the defined segments covers all others. In other words, there is such segment in the given set, which contains all other ones. Now you want to test your assumption. Find in the given set the segment which covers all other segments, and print its number. If such a segment doesn't exist, print -1.
Formally we will assume that segment [*a*,<=*b*] covers segment [*c*,<=*d*], if they meet this condition *a*<=≤<=*c*<=≤<=*d*<=≤<=*b*.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of segments. Next *n* lines contain the descriptions of the segments. The *i*-th line contains two space-separated integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=109) — the borders of the *i*-th segment.
It is guaranteed that no two segments coincide.
|
Print a single integer — the number of the segment that covers all other segments in the set. If there's no solution, print -1.
The segments are numbered starting from 1 in the order in which they appear in the input.
|
[
"3\n1 1\n2 2\n3 3\n",
"6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10\n"
] |
[
"-1\n",
"3\n"
] |
none
| 1,000
|
[
{
"input": "3\n1 1\n2 2\n3 3",
"output": "-1"
},
{
"input": "6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10",
"output": "3"
},
{
"input": "4\n1 5\n2 2\n2 4\n2 5",
"output": "1"
},
{
"input": "5\n3 3\n1 3\n2 2\n2 3\n1 2",
"output": "2"
},
{
"input": "7\n7 7\n8 8\n3 7\n1 6\n1 7\n4 7\n2 8",
"output": "-1"
},
{
"input": "3\n2 5\n3 4\n2 3",
"output": "1"
},
{
"input": "16\n15 15\n8 12\n6 9\n15 16\n8 14\n3 12\n7 19\n9 13\n5 16\n9 17\n10 15\n9 14\n9 9\n18 19\n5 15\n6 19",
"output": "-1"
},
{
"input": "9\n1 10\n7 8\n6 7\n1 4\n5 9\n2 8\n3 10\n1 1\n2 3",
"output": "1"
},
{
"input": "1\n1 100000",
"output": "1"
},
{
"input": "6\n2 2\n3 3\n3 5\n4 5\n1 1\n1 5",
"output": "6"
},
{
"input": "33\n2 18\n4 14\n2 16\n10 12\n4 6\n9 17\n2 8\n4 12\n8 20\n1 10\n11 14\n11 17\n8 15\n3 16\n3 4\n6 9\n6 19\n4 17\n17 19\n6 16\n3 12\n1 7\n6 20\n8 16\n12 19\n1 3\n12 18\n6 11\n7 20\n16 18\n4 15\n3 15\n15 19",
"output": "-1"
},
{
"input": "34\n3 8\n5 9\n2 9\n1 4\n3 7\n3 3\n8 9\n6 10\n4 7\n6 7\n5 8\n5 10\n1 5\n8 8\n2 5\n3 5\n7 7\n2 8\n4 5\n1 1\n7 9\n5 6\n2 3\n1 2\n2 4\n8 10\n7 8\n1 3\n4 8\n9 10\n1 7\n10 10\n2 2\n1 8",
"output": "-1"
},
{
"input": "55\n3 4\n6 8\n9 10\n3 9\n9 9\n2 5\n4 8\n3 8\n8 10\n1 1\n4 9\n10 10\n6 6\n8 8\n1 8\n5 5\n4 5\n5 9\n2 2\n3 10\n4 6\n3 6\n1 6\n1 7\n6 10\n2 6\n3 7\n2 4\n4 4\n5 10\n1 4\n2 9\n1 3\n7 9\n7 8\n1 9\n1 10\n2 8\n8 9\n6 7\n1 2\n6 9\n7 7\n4 7\n3 3\n2 7\n4 10\n7 10\n2 3\n2 10\n5 7\n3 5\n5 8\n1 5\n5 6",
"output": "37"
},
{
"input": "1\n999999999 1000000000",
"output": "1"
},
{
"input": "3\n1 20\n2 22\n3 18",
"output": "-1"
},
{
"input": "1\n1000000000 1000000000",
"output": "1"
},
{
"input": "2\n100001 100008\n100005 100006",
"output": "1"
},
{
"input": "1\n1000000 10000000",
"output": "1"
},
{
"input": "3\n3 6\n2 4\n1 5",
"output": "-1"
},
{
"input": "2\n3 5\n1 2",
"output": "-1"
}
] | 1,623,737,016
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 45
| 1,808
| 11,571,200
|
n = int(input())
data = []
min_ , max_ = list(map(int,input().split()))
data.append([min_,max_])
num = 0
for i in range(1,n):
a,b = list(map(int,input().split()))
data.append([a,b])
if a <= min_ and b >= max_ :
min_ = a
max_ = b
num = i
flag = 0
for i in range(n):
a,b = data[i]
if (a >= min_ and b <= max_) or i == num-1:
pass
else:
flag = 1
break
if flag == 0:
print(num+1)
else:
print(-1)
|
Title: Big Segment
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A coordinate line has *n* segments, the *i*-th segment starts at the position *l**i* and ends at the position *r**i*. We will denote such a segment as [*l**i*,<=*r**i*].
You have suggested that one of the defined segments covers all others. In other words, there is such segment in the given set, which contains all other ones. Now you want to test your assumption. Find in the given set the segment which covers all other segments, and print its number. If such a segment doesn't exist, print -1.
Formally we will assume that segment [*a*,<=*b*] covers segment [*c*,<=*d*], if they meet this condition *a*<=≤<=*c*<=≤<=*d*<=≤<=*b*.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of segments. Next *n* lines contain the descriptions of the segments. The *i*-th line contains two space-separated integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=109) — the borders of the *i*-th segment.
It is guaranteed that no two segments coincide.
Output Specification:
Print a single integer — the number of the segment that covers all other segments in the set. If there's no solution, print -1.
The segments are numbered starting from 1 in the order in which they appear in the input.
Demo Input:
['3\n1 1\n2 2\n3 3\n', '6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10\n']
Demo Output:
['-1\n', '3\n']
Note:
none
|
```python
n = int(input())
data = []
min_ , max_ = list(map(int,input().split()))
data.append([min_,max_])
num = 0
for i in range(1,n):
a,b = list(map(int,input().split()))
data.append([a,b])
if a <= min_ and b >= max_ :
min_ = a
max_ = b
num = i
flag = 0
for i in range(n):
a,b = data[i]
if (a >= min_ and b <= max_) or i == num-1:
pass
else:
flag = 1
break
if flag == 0:
print(num+1)
else:
print(-1)
```
| 3
|
|
34
|
B
|
Sale
|
PROGRAMMING
| 900
|
[
"greedy",
"sortings"
] |
B. Sale
|
2
|
256
|
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
|
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
|
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
|
[
"5 3\n-6 0 35 -2 4\n",
"4 2\n7 0 0 -7\n"
] |
[
"8\n",
"7\n"
] |
none
| 1,000
|
[
{
"input": "5 3\n-6 0 35 -2 4",
"output": "8"
},
{
"input": "4 2\n7 0 0 -7",
"output": "7"
},
{
"input": "6 6\n756 -611 251 -66 572 -818",
"output": "1495"
},
{
"input": "5 5\n976 437 937 788 518",
"output": "0"
},
{
"input": "5 3\n-2 -2 -2 -2 -2",
"output": "6"
},
{
"input": "5 1\n998 997 985 937 998",
"output": "0"
},
{
"input": "2 2\n-742 -187",
"output": "929"
},
{
"input": "3 3\n522 597 384",
"output": "0"
},
{
"input": "4 2\n-215 -620 192 647",
"output": "835"
},
{
"input": "10 6\n557 605 685 231 910 633 130 838 -564 -85",
"output": "649"
},
{
"input": "20 14\n932 442 960 943 624 624 955 998 631 910 850 517 715 123 1000 155 -10 961 966 59",
"output": "10"
},
{
"input": "30 5\n991 997 996 967 977 999 991 986 1000 965 984 997 998 1000 958 983 974 1000 991 999 1000 978 961 992 990 998 998 978 998 1000",
"output": "0"
},
{
"input": "50 20\n-815 -947 -946 -993 -992 -846 -884 -954 -963 -733 -940 -746 -766 -930 -821 -937 -937 -999 -914 -938 -936 -975 -939 -981 -977 -952 -925 -901 -952 -978 -994 -957 -946 -896 -905 -836 -994 -951 -887 -939 -859 -953 -985 -988 -946 -829 -956 -842 -799 -886",
"output": "19441"
},
{
"input": "88 64\n999 999 1000 1000 999 996 995 1000 1000 999 1000 997 998 1000 999 1000 997 1000 993 998 994 999 998 996 1000 997 1000 1000 1000 997 1000 998 997 1000 1000 998 1000 998 999 1000 996 999 999 999 996 995 999 1000 998 999 1000 999 999 1000 1000 1000 996 1000 1000 1000 997 1000 1000 997 999 1000 1000 1000 1000 1000 999 999 1000 1000 996 999 1000 1000 995 999 1000 996 1000 998 999 999 1000 999",
"output": "0"
},
{
"input": "99 17\n-993 -994 -959 -989 -991 -995 -976 -997 -990 -1000 -996 -994 -999 -995 -1000 -983 -979 -1000 -989 -968 -994 -992 -962 -993 -999 -983 -991 -979 -995 -993 -973 -999 -995 -995 -999 -993 -995 -992 -947 -1000 -999 -998 -982 -988 -979 -993 -963 -988 -980 -990 -979 -976 -995 -999 -981 -988 -998 -999 -970 -1000 -983 -994 -943 -975 -998 -977 -973 -997 -959 -999 -983 -985 -950 -977 -977 -991 -998 -973 -987 -985 -985 -986 -984 -994 -978 -998 -989 -989 -988 -970 -985 -974 -997 -981 -962 -972 -995 -988 -993",
"output": "16984"
},
{
"input": "100 37\n205 19 -501 404 912 -435 -322 -469 -655 880 -804 -470 793 312 -108 586 -642 -928 906 605 -353 -800 745 -440 -207 752 -50 -28 498 -800 -62 -195 602 -833 489 352 536 404 -775 23 145 -512 524 759 651 -461 -427 -557 684 -366 62 592 -563 -811 64 418 -881 -308 591 -318 -145 -261 -321 -216 -18 595 -202 960 -4 219 226 -238 -882 -963 425 970 -434 -160 243 -672 -4 873 8 -633 904 -298 -151 -377 -61 -72 -677 -66 197 -716 3 -870 -30 152 -469 981",
"output": "21743"
},
{
"input": "100 99\n-931 -806 -830 -828 -916 -962 -660 -867 -952 -966 -820 -906 -724 -982 -680 -717 -488 -741 -897 -613 -986 -797 -964 -939 -808 -932 -810 -860 -641 -916 -858 -628 -821 -929 -917 -976 -664 -985 -778 -665 -624 -928 -940 -958 -884 -757 -878 -896 -634 -526 -514 -873 -990 -919 -988 -878 -650 -973 -774 -783 -733 -648 -756 -895 -833 -974 -832 -725 -841 -748 -806 -613 -924 -867 -881 -943 -864 -991 -809 -926 -777 -817 -998 -682 -910 -996 -241 -722 -964 -904 -821 -920 -835 -699 -805 -632 -779 -317 -915 -654",
"output": "81283"
},
{
"input": "100 14\n995 994 745 684 510 737 984 690 979 977 542 933 871 603 758 653 962 997 747 974 773 766 975 770 527 960 841 989 963 865 974 967 950 984 757 685 986 809 982 959 931 880 978 867 805 562 970 900 834 782 616 885 910 608 974 918 576 700 871 980 656 941 978 759 767 840 573 859 841 928 693 853 716 927 976 851 962 962 627 797 707 873 869 988 993 533 665 887 962 880 929 980 877 887 572 790 721 883 848 782",
"output": "0"
},
{
"input": "100 84\n768 946 998 752 931 912 826 1000 991 910 875 962 901 952 958 733 959 908 872 840 923 826 952 980 974 980 947 955 959 822 997 963 966 933 829 923 971 999 926 932 865 984 974 858 994 855 949 941 992 861 951 949 991 711 763 728 935 485 716 907 869 952 960 859 909 963 978 942 968 933 923 909 997 962 687 764 924 774 875 1000 961 951 987 974 848 921 966 859 995 997 974 931 886 941 974 986 906 978 998 823",
"output": "0"
},
{
"input": "100 80\n-795 -994 -833 -930 -974 -980 -950 -940 -788 -927 -583 -956 -945 -949 -809 -974 -957 -736 -967 -908 -975 -961 -986 -983 -963 -771 -952 -847 -751 -741 -982 -959 -925 -931 -839 -937 -880 -914 -858 -998 -812 -911 -862 -965 -943 -984 -738 -920 -950 -998 -909 -998 -781 -901 -677 -940 -985 -951 -675 -952 -967 -949 -882 -641 -969 -937 -975 -993 -913 -941 -807 -851 -832 -960 -939 -943 -895 -929 -528 -880 -823 -930 -888 -862 -948 -966 -962 -857 -799 -969 -833 -998 -952 -878 -946 -971 -976 -974 -723 -992",
"output": "75068"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 1\n555",
"output": "0"
},
{
"input": "1 1\n-1",
"output": "1"
},
{
"input": "1 1\n-24",
"output": "24"
}
] | 1,663,556,088
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 92
| 0
|
n,m=map(int,input().split())
price=sorted(list(map(int,input().split())))
sum_=0
for i in range(m):
if price[i]<0:
sum_+=abs(price[i])
else:
break
print(sum_)
|
Title: Sale
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
Output Specification:
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
Demo Input:
['5 3\n-6 0 35 -2 4\n', '4 2\n7 0 0 -7\n']
Demo Output:
['8\n', '7\n']
Note:
none
|
```python
n,m=map(int,input().split())
price=sorted(list(map(int,input().split())))
sum_=0
for i in range(m):
if price[i]<0:
sum_+=abs(price[i])
else:
break
print(sum_)
```
| 3.977
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,666,765,513
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 81
| 124
| 0
|
n=int(input())
x0,y0,z0=0,0,0
for i in range(n):
x,y,z=[int(s) for s in input().split()]
x0+=x
y0+=y
z0+=z
if(x0==y0==z0==0):
print("YES")
else:
print("NO")
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
n=int(input())
x0,y0,z0=0,0,0
for i in range(n):
x,y,z=[int(s) for s in input().split()]
x0+=x
y0+=y
z0+=z
if(x0==y0==z0==0):
print("YES")
else:
print("NO")
```
| 3.969
|
523
|
A
|
Rotate, Flip and Zoom
|
PROGRAMMING
| 1,200
|
[
"*special",
"implementation"
] | null | null |
Polycarp is writing the prototype of a graphic editor. He has already made up his mind that the basic image transformations in his editor will be: rotate the image 90 degrees clockwise, flip the image horizontally (symmetry relative to the vertical line, that is, the right part of the image moves to the left, and vice versa) and zooming on the image. He is sure that that there is a large number of transformations that can be expressed through these three.
He has recently stopped implementing all three transformations for monochrome images. To test this feature, he asked you to write a code that will consecutively perform three actions with a monochrome image: first it will rotate the image 90 degrees clockwise, then it will flip the image horizontally and finally, it will zoom in twice on the image (that is, it will double all the linear sizes).
Implement this feature to help Polycarp test his editor.
|
The first line contains two integers, *w* and *h* (1<=≤<=*w*,<=*h*<=≤<=100) — the width and height of an image in pixels. The picture is given in *h* lines, each line contains *w* characters — each character encodes the color of the corresponding pixel of the image. The line consists only of characters "." and "*", as the image is monochrome.
|
Print 2*w* lines, each containing 2*h* characters — the result of consecutive implementing of the three transformations, described above.
|
[
"3 2\n.*.\n.*.\n",
"9 20\n**.......\n****.....\n******...\n*******..\n..******.\n....****.\n......***\n*.....***\n*********\n*********\n*********\n*********\n....**...\n...****..\n..******.\n.********\n****..***\n***...***\n**.....**\n*.......*\n"
] |
[
"....\n....\n****\n****\n....\n....\n",
"********......**********........********\n********......**********........********\n********........********......********..\n********........********......********..\n..********......********....********....\n..********......********....********....\n..********......********..********......\n..********......********..********......\n....********....****************........\n....********....****************........\n....********....****************........\n....********....****************........\n......******************..**********....\n......******************..**********....\n........****************....**********..\n........****************....**********..\n............************......**********\n............************......**********\n"
] |
none
| 500
|
[
{
"input": "3 2\n.*.\n.*.",
"output": "....\n....\n****\n****\n....\n...."
},
{
"input": "9 20\n**.......\n****.....\n******...\n*******..\n..******.\n....****.\n......***\n*.....***\n*********\n*********\n*********\n*********\n....**...\n...****..\n..******.\n.********\n****..***\n***...***\n**.....**\n*.......*",
"output": "********......**********........********\n********......**********........********\n********........********......********..\n********........********......********..\n..********......********....********....\n..********......********....********....\n..********......********..********......\n..********......********..********......\n....********....****************........\n....********....****************........\n....********....****************........\n....********....****************........\n......*..."
},
{
"input": "1 100\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.",
"output": "........................................................................................................................................................................................................\n........................................................................................................................................................................................................"
},
{
"input": "1 100\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*",
"output": "********************************************************************************************************************************************************************************************************\n********************************************************************************************************************************************************************************************************"
},
{
"input": "1 100\n.\n*\n.\n.\n.\n*\n.\n.\n.\n*\n*\n*\n.\n.\n.\n.\n.\n.\n*\n.\n.\n.\n*\n.\n*\n.\n.\n*\n*\n.\n*\n.\n.\n*\n.\n.\n*\n*\n.\n.\n.\n.\n.\n*\n.\n*\n.\n*\n.\n.\n.\n.\n*\n*\n*\n.\n.\n.\n.\n*\n.\n.\n*\n*\n*\n*\n.\n*\n*\n*\n*\n*\n.\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n.\n.\n*\n*\n*\n*\n*\n*\n*\n.\n.\n*\n.\n.\n*\n*\n.",
"output": "..**......**......******............**......**..**....****..**....**....****..........**..**..**........******........**....********..**********..********************....**************....**....****..\n..**......**......******............**......**..**....****..**....**....****..........**..**..**........******........**....********..**********..********************....**************....**....****.."
},
{
"input": "100 1\n****************************************************************************************************",
"output": "**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n..."
},
{
"input": "100 1\n*...***.....**.*...*.*.**.************.**..**.*..**..**.*.**...***.*...*.*..*.*.*......**..*..*...**",
"output": "**\n**\n..\n..\n..\n..\n..\n..\n**\n**\n**\n**\n**\n**\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n**\n**\n**\n**\n..\n..\n**\n**\n..\n..\n..\n..\n..\n..\n**\n**\n..\n..\n**\n**\n..\n..\n**\n**\n**\n**\n..\n..\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n..\n..\n**\n**\n**\n**\n..\n..\n..\n..\n**\n**\n**\n**\n..\n..\n**\n**\n..\n..\n..\n..\n**\n**\n**\n**\n..\n..\n..\n..\n**\n**\n**\n**\n..\n..\n**\n**\n..\n..\n**\n**\n**\n**\n..\n..\n..\n..\n..\n..\n**\n**\n..."
},
{
"input": "1 1\n.",
"output": "..\n.."
},
{
"input": "1 1\n*",
"output": "**\n**"
},
{
"input": "2 2\n.*\n*.",
"output": "..**\n..**\n**..\n**.."
},
{
"input": "1 2\n*\n.",
"output": "**..\n**.."
},
{
"input": "2 1\n*.",
"output": "**\n**\n..\n.."
}
] | 1,455,737,761
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 24
| 93
| 307,200
|
def rot(x):
matrix = [[0]*h for i in range(w)]
for i in range(w):
for j in range(h):
matrix[i][j] = x[h-1-j][i]
#for i in matrix:(print(i))
#print()
return matrix
def mir(x):
matrix = [[0]*h for i in range(w)]
for i in range(w):
for j in range(h):
matrix[i][j] = x[i][h-j-1]
#for i in matrix:(print(i))
#print()
return matrix
def scale(x):
matrix = [[0]*2*h for i in range(w*2)]
for i in range(2*w):
for j in range(2*h):
matrix[i][j] = x[i//2][j//2]
#for i in matrix:(print(i))
#print()
return matrix
w, h = map(int,input().split())
x = []
for i in range(h):
x.append(list(input()))
x = scale(mir(rot(x)))
for i in x: print(''.join(i))
|
Title: Rotate, Flip and Zoom
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is writing the prototype of a graphic editor. He has already made up his mind that the basic image transformations in his editor will be: rotate the image 90 degrees clockwise, flip the image horizontally (symmetry relative to the vertical line, that is, the right part of the image moves to the left, and vice versa) and zooming on the image. He is sure that that there is a large number of transformations that can be expressed through these three.
He has recently stopped implementing all three transformations for monochrome images. To test this feature, he asked you to write a code that will consecutively perform three actions with a monochrome image: first it will rotate the image 90 degrees clockwise, then it will flip the image horizontally and finally, it will zoom in twice on the image (that is, it will double all the linear sizes).
Implement this feature to help Polycarp test his editor.
Input Specification:
The first line contains two integers, *w* and *h* (1<=≤<=*w*,<=*h*<=≤<=100) — the width and height of an image in pixels. The picture is given in *h* lines, each line contains *w* characters — each character encodes the color of the corresponding pixel of the image. The line consists only of characters "." and "*", as the image is monochrome.
Output Specification:
Print 2*w* lines, each containing 2*h* characters — the result of consecutive implementing of the three transformations, described above.
Demo Input:
['3 2\n.*.\n.*.\n', '9 20\n**.......\n****.....\n******...\n*******..\n..******.\n....****.\n......***\n*.....***\n*********\n*********\n*********\n*********\n....**...\n...****..\n..******.\n.********\n****..***\n***...***\n**.....**\n*.......*\n']
Demo Output:
['....\n....\n****\n****\n....\n....\n', '********......**********........********\n********......**********........********\n********........********......********..\n********........********......********..\n..********......********....********....\n..********......********....********....\n..********......********..********......\n..********......********..********......\n....********....****************........\n....********....****************........\n....********....****************........\n....********....****************........\n......******************..**********....\n......******************..**********....\n........****************....**********..\n........****************....**********..\n............************......**********\n............************......**********\n']
Note:
none
|
```python
def rot(x):
matrix = [[0]*h for i in range(w)]
for i in range(w):
for j in range(h):
matrix[i][j] = x[h-1-j][i]
#for i in matrix:(print(i))
#print()
return matrix
def mir(x):
matrix = [[0]*h for i in range(w)]
for i in range(w):
for j in range(h):
matrix[i][j] = x[i][h-j-1]
#for i in matrix:(print(i))
#print()
return matrix
def scale(x):
matrix = [[0]*2*h for i in range(w*2)]
for i in range(2*w):
for j in range(2*h):
matrix[i][j] = x[i//2][j//2]
#for i in matrix:(print(i))
#print()
return matrix
w, h = map(int,input().split())
x = []
for i in range(h):
x.append(list(input()))
x = scale(mir(rot(x)))
for i in x: print(''.join(i))
```
| 3
|
|
381
|
A
|
Sereja and Dima
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"two pointers"
] | null | null |
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
|
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
|
[
"4\n4 1 2 10\n",
"7\n1 2 3 4 5 6 7\n"
] |
[
"12 5\n",
"16 12\n"
] |
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
| 500
|
[
{
"input": "4\n4 1 2 10",
"output": "12 5"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "16 12"
},
{
"input": "42\n15 29 37 22 16 5 26 31 6 32 19 3 45 36 33 14 25 20 48 7 42 11 24 28 9 18 8 21 47 17 38 40 44 4 35 1 43 39 41 27 12 13",
"output": "613 418"
},
{
"input": "43\n32 1 15 48 38 26 25 14 20 44 11 30 3 42 49 19 18 46 5 45 10 23 34 9 29 41 2 52 6 17 35 4 50 22 33 51 7 28 47 13 39 37 24",
"output": "644 500"
},
{
"input": "1\n3",
"output": "3 0"
},
{
"input": "45\n553 40 94 225 415 471 126 190 647 394 515 303 189 159 308 6 139 132 326 78 455 75 85 295 135 613 360 614 351 228 578 259 258 591 444 29 33 463 561 174 368 183 140 168 646",
"output": "6848 6568"
},
{
"input": "44\n849 373 112 307 479 608 856 769 526 82 168 143 573 762 115 501 688 36 214 450 396 496 236 309 287 786 397 43 811 141 745 846 350 270 276 677 420 459 403 722 267 54 394 727",
"output": "9562 9561"
},
{
"input": "35\n10 15 18 1 28 16 2 33 6 22 23 4 9 25 35 8 7 26 3 20 30 14 31 19 27 32 11 5 29 24 21 34 13 17 12",
"output": "315 315"
},
{
"input": "17\n580 376 191 496 73 44 520 357 483 149 81 178 514 300 216 598 304",
"output": "3238 2222"
},
{
"input": "30\n334 443 223 424 168 549 189 303 429 559 516 220 459 134 344 346 316 446 209 148 487 526 69 286 102 366 518 280 392 325",
"output": "5246 4864"
},
{
"input": "95\n122 29 188 265 292 287 183 225 222 187 155 256 64 148 173 278 218 136 290 17 31 130 2 87 57 283 255 280 68 166 174 142 102 39 116 206 288 154 26 78 296 172 184 232 77 91 277 8 249 186 94 93 207 251 257 195 101 299 193 124 293 65 58 35 24 302 220 189 252 125 27 284 247 182 141 103 198 97 234 83 281 216 85 180 267 236 109 143 149 239 79 300 191 244 71",
"output": "8147 7807"
},
{
"input": "1\n1",
"output": "1 0"
}
] | 1,681,320,314
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 46
| 0
|
n = int(input())
list1 = [int(num) for num in input().split()]
c1 = 0
c2 = 0
left, right = 0, n - 1
state = 's'
while(left <= right):
if state == 's':
if list1[right] >= list1[left]:
c1 += list1[right]
right -= 1
else:
c1 += list1[left]
left += 1
state = 'd'
else:
if list1[right] >= list1[left]:
c2 += list1[right]
right -= 1
else:
c2 += list1[left]
left += 1
state = 's'
print(c1, c2)
|
Title: Sereja and Dima
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
Output Specification:
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
Demo Input:
['4\n4 1 2 10\n', '7\n1 2 3 4 5 6 7\n']
Demo Output:
['12 5\n', '16 12\n']
Note:
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
|
```python
n = int(input())
list1 = [int(num) for num in input().split()]
c1 = 0
c2 = 0
left, right = 0, n - 1
state = 's'
while(left <= right):
if state == 's':
if list1[right] >= list1[left]:
c1 += list1[right]
right -= 1
else:
c1 += list1[left]
left += 1
state = 'd'
else:
if list1[right] >= list1[left]:
c2 += list1[right]
right -= 1
else:
c2 += list1[left]
left += 1
state = 's'
print(c1, c2)
```
| 3
|
|
260
|
A
|
Adding Digits
|
PROGRAMMING
| 1,400
|
[
"implementation",
"math"
] | null | null |
Vasya has got two number: *a* and *b*. However, Vasya finds number *a* too short. So he decided to repeat the operation of lengthening number *a* *n* times.
One operation of lengthening a number means adding exactly one digit to the number (in the decimal notation) to the right provided that the resulting number is divisible by Vasya's number *b*. If it is impossible to obtain the number which is divisible by *b*, then the lengthening operation cannot be performed.
Your task is to help Vasya and print the number he can get after applying the lengthening operation to number *a* *n* times.
|
The first line contains three integers: *a*,<=*b*,<=*n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=105).
|
In a single line print the integer without leading zeros, which Vasya can get when he applies the lengthening operations to number *a* *n* times. If no such number exists, then print number -1. If there are multiple possible answers, print any of them.
|
[
"5 4 5\n",
"12 11 1\n",
"260 150 10\n"
] |
[
"524848\n",
"121\n",
"-1\n"
] |
none
| 500
|
[
{
"input": "5 4 5",
"output": "524848"
},
{
"input": "12 11 1",
"output": "121"
},
{
"input": "260 150 10",
"output": "-1"
},
{
"input": "78843 5684 42717",
"output": "-1"
},
{
"input": "93248 91435 1133",
"output": "-1"
},
{
"input": "100000 10 64479",
"output": "1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99999 21 73839",
"output": "9999990000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99991 623 36438",
"output": "9999150000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99999 334 94854",
"output": "9999960000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99252 9827 84849",
"output": "9925270000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99313 9833 10561",
"output": "9931330000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "94885 55815 11417",
"output": "9488550000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99492 58525 53481",
"output": "9949250000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99858 28531 79193",
"output": "9985850000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "99136 47208 42607",
"output": "9913680000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "63270 19953 5555",
"output": "-1"
},
{
"input": "10240 128 100000",
"output": "1024000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "12 11 3",
"output": "12100"
},
{
"input": "14 12 99998",
"output": "1440000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000..."
},
{
"input": "1 11 3",
"output": "1100"
},
{
"input": "3 40 1",
"output": "-1"
},
{
"input": "150 100 10",
"output": "1500000000000"
},
{
"input": "5 10 1",
"output": "50"
},
{
"input": "1 15 10",
"output": "15000000000"
},
{
"input": "3 13 2",
"output": "390"
}
] | 1,651,601,634
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 1,965
| 204,800
|
a ,b ,n = map(int, input().split())
num = a
for i in range(10):
m = a*10+i
if m%b==0:
a=m
break
if num == a:
print(-1)
exit()
for i in range(n-1):
a*=10
print(a)
|
Title: Adding Digits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has got two number: *a* and *b*. However, Vasya finds number *a* too short. So he decided to repeat the operation of lengthening number *a* *n* times.
One operation of lengthening a number means adding exactly one digit to the number (in the decimal notation) to the right provided that the resulting number is divisible by Vasya's number *b*. If it is impossible to obtain the number which is divisible by *b*, then the lengthening operation cannot be performed.
Your task is to help Vasya and print the number he can get after applying the lengthening operation to number *a* *n* times.
Input Specification:
The first line contains three integers: *a*,<=*b*,<=*n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=105).
Output Specification:
In a single line print the integer without leading zeros, which Vasya can get when he applies the lengthening operations to number *a* *n* times. If no such number exists, then print number -1. If there are multiple possible answers, print any of them.
Demo Input:
['5 4 5\n', '12 11 1\n', '260 150 10\n']
Demo Output:
['524848\n', '121\n', '-1\n']
Note:
none
|
```python
a ,b ,n = map(int, input().split())
num = a
for i in range(10):
m = a*10+i
if m%b==0:
a=m
break
if num == a:
print(-1)
exit()
for i in range(n-1):
a*=10
print(a)
```
| 3
|
|
41
|
A
|
Translation
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Translation
|
2
|
256
|
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
|
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
|
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
|
[
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,618,715,582
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 124
| 0
|
word = input() #code
reversed = input() #edoc
no_times = len(word)
test = ("")
x = 1
for i in range(no_times):
test = test + word[len(word) - x]
x = x + 1
if reversed == test:
print("YES")
else:
print("NO")
|
Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
word = input() #code
reversed = input() #edoc
no_times = len(word)
test = ("")
x = 1
for i in range(no_times):
test = test + word[len(word) - x]
x = x + 1
if reversed == test:
print("YES")
else:
print("NO")
```
| 3.969
|
322
|
A
|
Ciel and Dancing
|
PROGRAMMING
| 1,000
|
[
"greedy"
] | null | null |
Fox Ciel and her friends are in a dancing room. There are *n* boys and *m* girls here, and they never danced before. There will be some songs, during each song, there must be exactly one boy and one girl are dancing. Besides, there is a special rule:
- either the boy in the dancing pair must dance for the first time (so, he didn't dance with anyone before); - or the girl in the dancing pair must dance for the first time.
Help Fox Ciel to make a schedule that they can dance as many songs as possible.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of boys and girls in the dancing room.
|
In the first line print *k* — the number of songs during which they can dance. Then in the following *k* lines, print the indexes of boys and girls dancing during songs chronologically. You can assume that the boys are indexed from 1 to *n*, and the girls are indexed from 1 to *m*.
|
[
"2 1\n",
"2 2\n"
] |
[
"2\n1 1\n2 1\n",
"3\n1 1\n1 2\n2 2\n"
] |
In test case 1, there are 2 boys and 1 girl. We can have 2 dances: the 1st boy and 1st girl (during the first song), the 2nd boy and 1st girl (during the second song).
And in test case 2, we have 2 boys with 2 girls, the answer is 3.
| 500
|
[
{
"input": "2 1",
"output": "2\n1 1\n2 1"
},
{
"input": "2 2",
"output": "3\n1 1\n1 2\n2 2"
},
{
"input": "1 1",
"output": "1\n1 1"
},
{
"input": "2 3",
"output": "4\n1 1\n1 2\n1 3\n2 3"
},
{
"input": "4 4",
"output": "7\n1 1\n1 2\n1 3\n1 4\n4 4\n3 4\n2 4"
},
{
"input": "1 12",
"output": "12\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12"
},
{
"input": "12 1",
"output": "12\n1 1\n12 1\n11 1\n10 1\n9 1\n8 1\n7 1\n6 1\n5 1\n4 1\n3 1\n2 1"
},
{
"input": "100 100",
"output": "199\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "24 6",
"output": "29\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n24 6\n23 6\n22 6\n21 6\n20 6\n19 6\n18 6\n17 6\n16 6\n15 6\n14 6\n13 6\n12 6\n11 6\n10 6\n9 6\n8 6\n7 6\n6 6\n5 6\n4 6\n3 6\n2 6"
},
{
"input": "7 59",
"output": "65\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n7 59\n6 59\n5 59\n4 59\n3 59\n2 59"
},
{
"input": "26 75",
"output": "100\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n26 75\n25 75\n24 75\n23 75\n22 75\n21 75\n20 75\n19 75\n18 75\n17..."
},
{
"input": "32 87",
"output": "118\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "42 51",
"output": "92\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n42 51\n41 51\n40 51\n39 51\n38 51\n37 51\n36 51\n35 51\n34 51\n33 51\n32 51\n31 51\n30 51\n29 51\n28 51\n27 51\n26 51\n25 51\n24 51\n23 51\n22 51\n21 51\n20 51\n19 51\n18 51\n17 51\n16 51\n15 51\n14 51\n13 51\n..."
},
{
"input": "4 63",
"output": "66\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n4 63\n3 63\n2 63"
},
{
"input": "10 79",
"output": "88\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n10 79\n9 79\n8 79\n7 79\n6 79\n5 79\n4 79\n..."
},
{
"input": "20 95",
"output": "114\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "35 55",
"output": "89\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n35 55\n34 55\n33 55\n32 55\n31 55\n30 55\n29 55\n28 55\n27 55\n26 55\n25 55\n24 55\n23 55\n22 55\n21 55\n20 55\n19 55\n18 55\n17 55\n16 55\n15 55\n14 55\n13 55\n12 55\n11 55\n10 55\n9 55..."
},
{
"input": "45 71",
"output": "115\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n45 71\n44 71\n43 71\n42 71\n41 71\n40 71\n39 71\n38 71\n37 71\n36 71\n35 71\n34 71\n33 71..."
},
{
"input": "7 83",
"output": "89\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n7 83\n6 83\n5 83\n..."
},
{
"input": "32 100",
"output": "131\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "42 17",
"output": "58\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n42 17\n41 17\n40 17\n39 17\n38 17\n37 17\n36 17\n35 17\n34 17\n33 17\n32 17\n31 17\n30 17\n29 17\n28 17\n27 17\n26 17\n25 17\n24 17\n23 17\n22 17\n21 17\n20 17\n19 17\n18 17\n17 17\n16 17\n15 17\n14 17\n13 17\n12 17\n11 17\n10 17\n9 17\n8 17\n7 17\n6 17\n5 17\n4 17\n3 17\n2 17"
},
{
"input": "1 77",
"output": "77\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77"
},
{
"input": "19 93",
"output": "111\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "25 5",
"output": "29\n1 1\n1 2\n1 3\n1 4\n1 5\n25 5\n24 5\n23 5\n22 5\n21 5\n20 5\n19 5\n18 5\n17 5\n16 5\n15 5\n14 5\n13 5\n12 5\n11 5\n10 5\n9 5\n8 5\n7 5\n6 5\n5 5\n4 5\n3 5\n2 5"
},
{
"input": "35 21",
"output": "55\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n35 21\n34 21\n33 21\n32 21\n31 21\n30 21\n29 21\n28 21\n27 21\n26 21\n25 21\n24 21\n23 21\n22 21\n21 21\n20 21\n19 21\n18 21\n17 21\n16 21\n15 21\n14 21\n13 21\n12 21\n11 21\n10 21\n9 21\n8 21\n7 21\n6 21\n5 21\n4 21\n3 21\n2 21"
},
{
"input": "99 99",
"output": "197\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "99 100",
"output": "198\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "100 99",
"output": "198\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
}
] | 1,642,832,446
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 28
| 92
| 0
|
n,m = [int(x) for x in input().split()]
k = m + (n-1)
print(k)
for i in range(1,m+1):
print(1,i)
if n<=m:
for j in range(2,n+1):
print(j,j)
else:
for j in range(2,n+1):
print(j,1)
|
Title: Ciel and Dancing
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Fox Ciel and her friends are in a dancing room. There are *n* boys and *m* girls here, and they never danced before. There will be some songs, during each song, there must be exactly one boy and one girl are dancing. Besides, there is a special rule:
- either the boy in the dancing pair must dance for the first time (so, he didn't dance with anyone before); - or the girl in the dancing pair must dance for the first time.
Help Fox Ciel to make a schedule that they can dance as many songs as possible.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of boys and girls in the dancing room.
Output Specification:
In the first line print *k* — the number of songs during which they can dance. Then in the following *k* lines, print the indexes of boys and girls dancing during songs chronologically. You can assume that the boys are indexed from 1 to *n*, and the girls are indexed from 1 to *m*.
Demo Input:
['2 1\n', '2 2\n']
Demo Output:
['2\n1 1\n2 1\n', '3\n1 1\n1 2\n2 2\n']
Note:
In test case 1, there are 2 boys and 1 girl. We can have 2 dances: the 1st boy and 1st girl (during the first song), the 2nd boy and 1st girl (during the second song).
And in test case 2, we have 2 boys with 2 girls, the answer is 3.
|
```python
n,m = [int(x) for x in input().split()]
k = m + (n-1)
print(k)
for i in range(1,m+1):
print(1,i)
if n<=m:
for j in range(2,n+1):
print(j,j)
else:
for j in range(2,n+1):
print(j,1)
```
| 3
|
|
71
|
A
|
Way Too Long Words
|
PROGRAMMING
| 800
|
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500
|
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,679,771,153
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 46
| 0
|
def way_too_long_words ():
n = int(input())
for i in range (n):
word = input()
b = len(word)
if b <= 10:
print(word)
else:
print(f'{word[0]}{b-2}{word[b-1]}')
way_too_long_words()
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
def way_too_long_words ():
n = int(input())
for i in range (n):
word = input()
b = len(word)
if b <= 10:
print(word)
else:
print(f'{word[0]}{b-2}{word[b-1]}')
way_too_long_words()
```
| 3.977
|
75
|
A
|
Life Without Zeros
|
PROGRAMMING
| 1,000
|
[
"implementation"
] |
A. Life Without Zeros
|
2
|
256
|
Can you imagine our life if we removed all zeros from it? For sure we will have many problems.
In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros?
For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation.
But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation.
|
The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*.
|
The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise.
|
[
"101\n102\n",
"105\n106\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "101\n102",
"output": "YES"
},
{
"input": "105\n106",
"output": "NO"
},
{
"input": "544\n397",
"output": "YES"
},
{
"input": "822\n280",
"output": "NO"
},
{
"input": "101\n413",
"output": "NO"
},
{
"input": "309\n139",
"output": "NO"
},
{
"input": "693\n970",
"output": "NO"
},
{
"input": "981\n1",
"output": "YES"
},
{
"input": "352\n276",
"output": "YES"
},
{
"input": "164\n691",
"output": "YES"
},
{
"input": "110036\n43",
"output": "YES"
},
{
"input": "100\n1000",
"output": "NO"
},
{
"input": "1000000000\n1000000000",
"output": "YES"
},
{
"input": "999999999\n999999999",
"output": "YES"
},
{
"input": "6\n4",
"output": "NO"
},
{
"input": "123456\n876543",
"output": "YES"
},
{
"input": "1234567\n9876543",
"output": "NO"
},
{
"input": "1111111\n1119111",
"output": "NO"
},
{
"input": "10502405\n40403403",
"output": "YES"
},
{
"input": "1\n1",
"output": "YES"
},
{
"input": "5\n4",
"output": "YES"
},
{
"input": "1\n6",
"output": "YES"
},
{
"input": "40\n17",
"output": "NO"
},
{
"input": "35\n81",
"output": "YES"
},
{
"input": "347\n908",
"output": "NO"
},
{
"input": "2081\n7450",
"output": "NO"
},
{
"input": "84355694\n373629503",
"output": "NO"
},
{
"input": "885992048\n510468672",
"output": "NO"
},
{
"input": "540144752\n647307841",
"output": "NO"
},
{
"input": "341781108\n784147010",
"output": "NO"
},
{
"input": "960440938\n572334653",
"output": "NO"
},
{
"input": "657414510\n768771903",
"output": "NO"
},
{
"input": "501871728\n725074574",
"output": "NO"
},
{
"input": "968\n851",
"output": "YES"
},
{
"input": "943\n939",
"output": "YES"
},
{
"input": "347\n908",
"output": "NO"
},
{
"input": "611\n41",
"output": "YES"
},
{
"input": "737\n289",
"output": "NO"
},
{
"input": "168\n571",
"output": "YES"
},
{
"input": "868\n463",
"output": "YES"
},
{
"input": "815732007\n913882008",
"output": "NO"
},
{
"input": "459039901\n453033850",
"output": "NO"
},
{
"input": "975305404\n484601256",
"output": "NO"
}
] | 1,667,680,605
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 43
| 92
| 0
|
a, b = input(), input()
c = str(int(a) + int(b)).replace("0", "")
a, b = a.replace("0", ""), b.replace("0", "")
print("YNEOS"[int(c) != eval(f"{a}+{b}") :: 2])
|
Title: Life Without Zeros
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Can you imagine our life if we removed all zeros from it? For sure we will have many problems.
In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros?
For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation.
But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation.
Input Specification:
The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*.
Output Specification:
The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise.
Demo Input:
['101\n102\n', '105\n106\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
a, b = input(), input()
c = str(int(a) + int(b)).replace("0", "")
a, b = a.replace("0", ""), b.replace("0", "")
print("YNEOS"[int(c) != eval(f"{a}+{b}") :: 2])
```
| 3.977
|
557
|
B
|
Pasha and Tea
|
PROGRAMMING
| 1,500
|
[
"constructive algorithms",
"implementation",
"math",
"sortings"
] | null | null |
Pasha decided to invite his friends to a tea party. For that occasion, he has a large teapot with the capacity of *w* milliliters and 2*n* tea cups, each cup is for one of Pasha's friends. The *i*-th cup can hold at most *a**i* milliliters of water.
It turned out that among Pasha's friends there are exactly *n* boys and exactly *n* girls and all of them are going to come to the tea party. To please everyone, Pasha decided to pour the water for the tea as follows:
- Pasha can boil the teapot exactly once by pouring there at most *w* milliliters of water; - Pasha pours the same amount of water to each girl; - Pasha pours the same amount of water to each boy; - if each girl gets *x* milliliters of water, then each boy gets 2*x* milliliters of water.
In the other words, each boy should get two times more water than each girl does.
Pasha is very kind and polite, so he wants to maximize the total amount of the water that he pours to his friends. Your task is to help him and determine the optimum distribution of cups between Pasha's friends.
|
The first line of the input contains two integers, *n* and *w* (1<=≤<=*n*<=≤<=105, 1<=≤<=*w*<=≤<=109) — the number of Pasha's friends that are boys (equal to the number of Pasha's friends that are girls) and the capacity of Pasha's teapot in milliliters.
The second line of the input contains the sequence of integers *a**i* (1<=≤<=*a**i*<=≤<=109, 1<=≤<=*i*<=≤<=2*n*) — the capacities of Pasha's tea cups in milliliters.
|
Print a single real number — the maximum total amount of water in milliliters that Pasha can pour to his friends without violating the given conditions. Your answer will be considered correct if its absolute or relative error doesn't exceed 10<=-<=6.
|
[
"2 4\n1 1 1 1\n",
"3 18\n4 4 4 2 2 2\n",
"1 5\n2 3\n"
] |
[
"3",
"18",
"4.5"
] |
Pasha also has candies that he is going to give to girls but that is another task...
| 1,000
|
[
{
"input": "2 4\n1 1 1 1",
"output": "3.0000000000"
},
{
"input": "3 18\n4 4 4 2 2 2",
"output": "18.0000000000"
},
{
"input": "1 5\n2 3",
"output": "4.5000000000"
},
{
"input": "1 1\n1000000000 1000000000",
"output": "1.0000000000"
},
{
"input": "4 1000000000\n1 1 1 1 1 1 1 1",
"output": "6.0000000000"
},
{
"input": "4 1000000000\n1 1 1 1 2 2 2 2",
"output": "12.0000000000"
},
{
"input": "4 1\n3 3 3 3 4 4 4 4",
"output": "1.0000000000"
},
{
"input": "2 19\n3 3 5 5",
"output": "15.0000000000"
},
{
"input": "3 31\n3 3 3 5 5 5",
"output": "22.5000000000"
},
{
"input": "5 15\n2 3 4 1 2 4 5 3 5 10",
"output": "15.0000000000"
},
{
"input": "5 14\n2 3 4 1 2 4 5 3 5 10",
"output": "14.0000000000"
},
{
"input": "5 16\n2 3 4 1 2 4 5 3 5 10",
"output": "15.0000000000"
},
{
"input": "1 100\n1 200",
"output": "3.0000000000"
},
{
"input": "1 1\n1 1",
"output": "1.0000000000"
},
{
"input": "2 1000000000\n1 1 1 100",
"output": "3.0000000000"
},
{
"input": "4 30\n3 3 3 3 4 5 6 7",
"output": "24.0000000000"
},
{
"input": "2 100\n1 1 1 10",
"output": "3.0000000000"
},
{
"input": "3 18\n1 1 1 1 1 5",
"output": "4.5000000000"
}
] | 1,435,997,203
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 50
| 218
| 16,076,800
|
n, w = map(int, input().split())
a = sorted(map(float, input().split()))
print(min(a[0], a[n]/2, w/3/n)*3*n)
|
Title: Pasha and Tea
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pasha decided to invite his friends to a tea party. For that occasion, he has a large teapot with the capacity of *w* milliliters and 2*n* tea cups, each cup is for one of Pasha's friends. The *i*-th cup can hold at most *a**i* milliliters of water.
It turned out that among Pasha's friends there are exactly *n* boys and exactly *n* girls and all of them are going to come to the tea party. To please everyone, Pasha decided to pour the water for the tea as follows:
- Pasha can boil the teapot exactly once by pouring there at most *w* milliliters of water; - Pasha pours the same amount of water to each girl; - Pasha pours the same amount of water to each boy; - if each girl gets *x* milliliters of water, then each boy gets 2*x* milliliters of water.
In the other words, each boy should get two times more water than each girl does.
Pasha is very kind and polite, so he wants to maximize the total amount of the water that he pours to his friends. Your task is to help him and determine the optimum distribution of cups between Pasha's friends.
Input Specification:
The first line of the input contains two integers, *n* and *w* (1<=≤<=*n*<=≤<=105, 1<=≤<=*w*<=≤<=109) — the number of Pasha's friends that are boys (equal to the number of Pasha's friends that are girls) and the capacity of Pasha's teapot in milliliters.
The second line of the input contains the sequence of integers *a**i* (1<=≤<=*a**i*<=≤<=109, 1<=≤<=*i*<=≤<=2*n*) — the capacities of Pasha's tea cups in milliliters.
Output Specification:
Print a single real number — the maximum total amount of water in milliliters that Pasha can pour to his friends without violating the given conditions. Your answer will be considered correct if its absolute or relative error doesn't exceed 10<=-<=6.
Demo Input:
['2 4\n1 1 1 1\n', '3 18\n4 4 4 2 2 2\n', '1 5\n2 3\n']
Demo Output:
['3', '18', '4.5']
Note:
Pasha also has candies that he is going to give to girls but that is another task...
|
```python
n, w = map(int, input().split())
a = sorted(map(float, input().split()))
print(min(a[0], a[n]/2, w/3/n)*3*n)
```
| 3
|
|
707
|
A
|
Brain's Photos
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead.
As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such).
Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour!
As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white.
Photo can be represented as a matrix sized *n*<=×<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors:
- 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black)
The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored.
|
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of photo pixel matrix rows and columns respectively.
Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'.
|
Print the "#Black&White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line.
|
[
"2 2\nC M\nY Y\n",
"3 2\nW W\nW W\nB B\n",
"1 1\nW\n"
] |
[
"#Color",
"#Black&White",
"#Black&White"
] |
none
| 500
|
[
{
"input": "2 2\nC M\nY Y",
"output": "#Color"
},
{
"input": "3 2\nW W\nW W\nB B",
"output": "#Black&White"
},
{
"input": "1 1\nW",
"output": "#Black&White"
},
{
"input": "2 3\nW W W\nB G Y",
"output": "#Color"
},
{
"input": "1 1\nW",
"output": "#Black&White"
},
{
"input": "5 5\nW G B Y M\nG B Y M C\nB Y M C W\nY M C W G\nM C W G B",
"output": "#Color"
},
{
"input": "1 6\nC M Y W G B",
"output": "#Color"
},
{
"input": "1 3\nW G B",
"output": "#Black&White"
},
{
"input": "1 1\nW",
"output": "#Black&White"
},
{
"input": "5 5\nW G B W G\nG B W G B\nB W G B W\nW G B W G\nG B W G B",
"output": "#Black&White"
},
{
"input": "2 3\nW W W\nB G C",
"output": "#Color"
},
{
"input": "2 3\nW W W\nB G M",
"output": "#Color"
},
{
"input": "3 3\nC B W\nB Y M\nB B W",
"output": "#Color"
},
{
"input": "1 3\nW C W",
"output": "#Color"
},
{
"input": "3 3\nB W B\nB C W\nB W W",
"output": "#Color"
},
{
"input": "1 2\nW Y",
"output": "#Color"
},
{
"input": "1 1\nG",
"output": "#Black&White"
},
{
"input": "1 3\nB G W",
"output": "#Black&White"
},
{
"input": "2 2\nW W\nB C",
"output": "#Color"
},
{
"input": "1 1\nM",
"output": "#Color"
},
{
"input": "1 2\nW C",
"output": "#Color"
},
{
"input": "2 3\nW W M\nW W M",
"output": "#Color"
},
{
"input": "3 2\nW W\nW W\nB C",
"output": "#Color"
},
{
"input": "2 3\nW W C\nW W W",
"output": "#Color"
},
{
"input": "1 3\nG G G",
"output": "#Black&White"
},
{
"input": "1 1\nC",
"output": "#Color"
},
{
"input": "1 2\nC W",
"output": "#Color"
},
{
"input": "1 3\nW W C",
"output": "#Color"
},
{
"input": "2 2\nW B\nB G",
"output": "#Black&White"
},
{
"input": "2 2\nB B\nY Y",
"output": "#Color"
},
{
"input": "2 2\nG G\nC C",
"output": "#Color"
},
{
"input": "1 2\nB C",
"output": "#Color"
},
{
"input": "1 4\nG G G C",
"output": "#Color"
},
{
"input": "1 1\nB",
"output": "#Black&White"
},
{
"input": "2 1\nY\nB",
"output": "#Color"
}
] | 1,679,013,509
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 50
| 46
| 0
|
# 코드포스 707A Brain's Photos
import sys
put = sys.stdin.readline
n, m = map(int, put().split())
color = set()
while n:
n -= 1
color.update(put().split())
if {'C', 'Y', 'M'} & color:
print("#Color")
else:
print("#Black&White")
|
Title: Brain's Photos
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead.
As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such).
Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour!
As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white.
Photo can be represented as a matrix sized *n*<=×<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors:
- 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black)
The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of photo pixel matrix rows and columns respectively.
Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'.
Output Specification:
Print the "#Black&White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line.
Demo Input:
['2 2\nC M\nY Y\n', '3 2\nW W\nW W\nB B\n', '1 1\nW\n']
Demo Output:
['#Color', '#Black&White', '#Black&White']
Note:
none
|
```python
# 코드포스 707A Brain's Photos
import sys
put = sys.stdin.readline
n, m = map(int, put().split())
color = set()
while n:
n -= 1
color.update(put().split())
if {'C', 'Y', 'M'} & color:
print("#Color")
else:
print("#Black&White")
```
| 3
|
|
677
|
A
|
Vanya and Fence
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
|
The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
|
Print a single integer — the minimum possible valid width of the road.
|
[
"3 7\n4 5 14\n",
"6 1\n1 1 1 1 1 1\n",
"6 5\n7 6 8 9 10 5\n"
] |
[
"4\n",
"6\n",
"11\n"
] |
In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4.
In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
| 500
|
[
{
"input": "3 7\n4 5 14",
"output": "4"
},
{
"input": "6 1\n1 1 1 1 1 1",
"output": "6"
},
{
"input": "6 5\n7 6 8 9 10 5",
"output": "11"
},
{
"input": "10 420\n214 614 297 675 82 740 174 23 255 15",
"output": "13"
},
{
"input": "10 561\n657 23 1096 487 785 66 481 554 1000 821",
"output": "15"
},
{
"input": "100 342\n478 143 359 336 162 333 385 515 117 496 310 538 469 539 258 676 466 677 1 296 150 560 26 213 627 221 255 126 617 174 279 178 24 435 70 145 619 46 669 566 300 67 576 251 58 176 441 564 569 194 24 669 73 262 457 259 619 78 400 579 222 626 269 47 80 315 160 194 455 186 315 424 197 246 683 220 68 682 83 233 290 664 273 598 362 305 674 614 321 575 362 120 14 534 62 436 294 351 485 396",
"output": "144"
},
{
"input": "100 290\n244 49 276 77 449 261 468 458 201 424 9 131 300 88 432 394 104 77 13 289 435 259 111 453 168 394 156 412 351 576 178 530 81 271 228 564 125 328 42 372 205 61 180 471 33 360 567 331 222 318 241 117 529 169 188 484 202 202 299 268 246 343 44 364 333 494 59 236 84 485 50 8 428 8 571 227 205 310 210 9 324 472 368 490 114 84 296 305 411 351 569 393 283 120 510 171 232 151 134 366",
"output": "145"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 1\n2",
"output": "2"
},
{
"input": "46 71\n30 26 56 138 123 77 60 122 73 45 79 10 130 3 14 1 38 46 128 50 82 16 32 68 28 98 62 106 2 49 131 11 114 39 139 70 40 50 45 137 33 30 35 136 135 19",
"output": "63"
},
{
"input": "20 723\n212 602 293 591 754 91 1135 640 80 495 845 928 1399 498 926 1431 1226 869 814 1386",
"output": "31"
},
{
"input": "48 864\n843 1020 751 1694 18 1429 1395 1174 272 1158 1628 1233 1710 441 765 561 778 748 1501 1200 563 1263 1398 1687 1518 1640 1591 839 500 466 1603 1587 1201 1209 432 868 1159 639 649 628 9 91 1036 147 896 1557 941 518",
"output": "75"
},
{
"input": "26 708\n549 241 821 734 945 1161 566 1268 216 30 1142 730 529 1014 255 168 796 1148 89 113 1328 286 743 871 1259 1397",
"output": "41"
},
{
"input": "75 940\n1620 1745 1599 441 64 1466 1496 1239 1716 1475 778 106 1136 1212 1261 444 781 257 1071 747 626 232 609 1544 682 1326 469 1361 1460 1450 1207 1319 922 625 1737 1057 1698 592 692 80 1016 541 1254 201 682 1007 847 206 1066 809 259 109 240 1611 219 1455 1326 1377 1827 786 42 1002 1382 1592 543 1866 1198 334 1524 1760 340 1566 955 257 1118",
"output": "116"
}
] | 1,690,864,483
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 46
| 0
|
line1 = input()
line2 = input()
line1Array = list(map(int, line1.split()))
listHeightOfPerson = list(map(int, line2.split()))
numOfPerson = line1Array[0]
heightOfFence = line1Array[1]
sumOfWidth = 0
for heightOfPerson in listHeightOfPerson:
if heightOfPerson > heightOfFence:
sumOfWidth += 2
else:
sumOfWidth += 1
print(sumOfWidth)
|
Title: Vanya and Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
Input Specification:
The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
Output Specification:
Print a single integer — the minimum possible valid width of the road.
Demo Input:
['3 7\n4 5 14\n', '6 1\n1 1 1 1 1 1\n', '6 5\n7 6 8 9 10 5\n']
Demo Output:
['4\n', '6\n', '11\n']
Note:
In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4.
In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
|
```python
line1 = input()
line2 = input()
line1Array = list(map(int, line1.split()))
listHeightOfPerson = list(map(int, line2.split()))
numOfPerson = line1Array[0]
heightOfFence = line1Array[1]
sumOfWidth = 0
for heightOfPerson in listHeightOfPerson:
if heightOfPerson > heightOfFence:
sumOfWidth += 2
else:
sumOfWidth += 1
print(sumOfWidth)
```
| 3
|
|
912
|
A
|
Tricky Alchemy
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
During the winter holidays, the demand for Christmas balls is exceptionally high. Since it's already 2018, the advances in alchemy allow easy and efficient ball creation by utilizing magic crystals.
Grisha needs to obtain some yellow, green and blue balls. It's known that to produce a yellow ball one needs two yellow crystals, green — one yellow and one blue, and for a blue ball, three blue crystals are enough.
Right now there are *A* yellow and *B* blue crystals in Grisha's disposal. Find out how many additional crystals he should acquire in order to produce the required number of balls.
|
The first line features two integers *A* and *B* (0<=≤<=*A*,<=*B*<=≤<=109), denoting the number of yellow and blue crystals respectively at Grisha's disposal.
The next line contains three integers *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=109) — the respective amounts of yellow, green and blue balls to be obtained.
|
Print a single integer — the minimum number of crystals that Grisha should acquire in addition.
|
[
"4 3\n2 1 1\n",
"3 9\n1 1 3\n",
"12345678 87654321\n43043751 1000000000 53798715\n"
] |
[
"2\n",
"1\n",
"2147483648\n"
] |
In the first sample case, Grisha needs five yellow and four blue crystals to create two yellow balls, one green ball, and one blue ball. To do that, Grisha needs to obtain two additional crystals: one yellow and one blue.
| 500
|
[
{
"input": "4 3\n2 1 1",
"output": "2"
},
{
"input": "3 9\n1 1 3",
"output": "1"
},
{
"input": "12345678 87654321\n43043751 1000000000 53798715",
"output": "2147483648"
},
{
"input": "12 12\n3 5 2",
"output": "0"
},
{
"input": "770 1390\n170 442 311",
"output": "12"
},
{
"input": "3555165 6693472\n1499112 556941 3075290",
"output": "3089339"
},
{
"input": "0 0\n1000000000 1000000000 1000000000",
"output": "7000000000"
},
{
"input": "1 1\n0 1 0",
"output": "0"
},
{
"input": "117708228 562858833\n118004008 360437130 154015822",
"output": "738362681"
},
{
"input": "999998118 700178721\n822106746 82987112 547955384",
"output": "1753877029"
},
{
"input": "566568710 765371101\n60614022 80126928 809950465",
"output": "1744607222"
},
{
"input": "448858599 829062060\n764716760 97644201 203890025",
"output": "1178219122"
},
{
"input": "626115781 966381948\n395190569 820194184 229233367",
"output": "1525971878"
},
{
"input": "803372962 103701834\n394260597 837711458 623172928",
"output": "3426388098"
},
{
"input": "980630143 241021722\n24734406 928857659 312079781",
"output": "1624075280"
},
{
"input": "862920032 378341609\n360240924 241342224 337423122",
"output": "974174021"
},
{
"input": "40177212 515661496\n64343660 963892207 731362684",
"output": "3694721078"
},
{
"input": "217434393 579352456\n694817470 981409480 756706026",
"output": "4825785129"
},
{
"input": "394691574 716672343\n398920207 72555681 150645586",
"output": "475704521"
},
{
"input": "276981463 853992230\n29394015 90072954 839552440",
"output": "1754738044"
},
{
"input": "843552056 919184611\n341530221 423649259 101547519",
"output": "263157645"
},
{
"input": "20809236 56504497\n972004030 441166533 495487081",
"output": "4235488636"
},
{
"input": "198066417 825228166\n602477839 532312735 520830423",
"output": "2808777834"
},
{
"input": "80356306 962548053\n601547868 549830008 914769984",
"output": "4004161345"
},
{
"input": "257613487 394835231\n642087093 567347282 308709545",
"output": "2692548667"
},
{
"input": "139903376 532155119\n641157122 289897263 629020178",
"output": "3077110809"
},
{
"input": "612127849 669475006\n271630930 676010757 22959739",
"output": "682559736"
},
{
"input": "0 0\n0 0 0",
"output": "0"
},
{
"input": "1000000000 1000000000\n499999998 4 333333332",
"output": "0"
},
{
"input": "1000000000 1000000000\n1000000000 1000000000 1000000000",
"output": "5000000000"
},
{
"input": "4 3\n1 0 1",
"output": "0"
},
{
"input": "4 12\n1 2 3",
"output": "0"
},
{
"input": "4 20\n1 2 1",
"output": "0"
},
{
"input": "100 10\n2 3 4",
"output": "5"
},
{
"input": "6 0\n1 1 1",
"output": "4"
},
{
"input": "25 5\n3 3 3",
"output": "7"
},
{
"input": "48 27\n22 39 20",
"output": "107"
},
{
"input": "4 0\n1 1 1",
"output": "4"
}
] | 1,600,677,495
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 38
| 109
| 0
|
A,B = map(int,input().split())
x,y,z = map(int,input().split())
ans = 0
yellow_crystal = 2*x+y-A
blue_crystal = y+3*z-B
if yellow_crystal > 0:
ans += yellow_crystal
if blue_crystal > 0:
ans += blue_crystal
print(ans)
|
Title: Tricky Alchemy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
During the winter holidays, the demand for Christmas balls is exceptionally high. Since it's already 2018, the advances in alchemy allow easy and efficient ball creation by utilizing magic crystals.
Grisha needs to obtain some yellow, green and blue balls. It's known that to produce a yellow ball one needs two yellow crystals, green — one yellow and one blue, and for a blue ball, three blue crystals are enough.
Right now there are *A* yellow and *B* blue crystals in Grisha's disposal. Find out how many additional crystals he should acquire in order to produce the required number of balls.
Input Specification:
The first line features two integers *A* and *B* (0<=≤<=*A*,<=*B*<=≤<=109), denoting the number of yellow and blue crystals respectively at Grisha's disposal.
The next line contains three integers *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=109) — the respective amounts of yellow, green and blue balls to be obtained.
Output Specification:
Print a single integer — the minimum number of crystals that Grisha should acquire in addition.
Demo Input:
['4 3\n2 1 1\n', '3 9\n1 1 3\n', '12345678 87654321\n43043751 1000000000 53798715\n']
Demo Output:
['2\n', '1\n', '2147483648\n']
Note:
In the first sample case, Grisha needs five yellow and four blue crystals to create two yellow balls, one green ball, and one blue ball. To do that, Grisha needs to obtain two additional crystals: one yellow and one blue.
|
```python
A,B = map(int,input().split())
x,y,z = map(int,input().split())
ans = 0
yellow_crystal = 2*x+y-A
blue_crystal = y+3*z-B
if yellow_crystal > 0:
ans += yellow_crystal
if blue_crystal > 0:
ans += blue_crystal
print(ans)
```
| 3
|
|
1,006
|
B
|
Polycarp's Practice
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
Polycarp is practicing his problem solving skill. He has a list of $n$ problems with difficulties $a_1, a_2, \dots, a_n$, respectively. His plan is to practice for exactly $k$ days. Each day he has to solve at least one problem from his list. Polycarp solves the problems in the order they are given in his list, he cannot skip any problem from his list. He has to solve all $n$ problems in exactly $k$ days.
Thus, each day Polycarp solves a contiguous sequence of (consecutive) problems from the start of the list. He can't skip problems or solve them multiple times. As a result, in $k$ days he will solve all the $n$ problems.
The profit of the $j$-th day of Polycarp's practice is the maximum among all the difficulties of problems Polycarp solves during the $j$-th day (i.e. if he solves problems with indices from $l$ to $r$ during a day, then the profit of the day is $\max\limits_{l \le i \le r}a_i$). The total profit of his practice is the sum of the profits over all $k$ days of his practice.
You want to help Polycarp to get the maximum possible total profit over all valid ways to solve problems. Your task is to distribute all $n$ problems between $k$ days satisfying the conditions above in such a way, that the total profit is maximum.
For example, if $n = 8, k = 3$ and $a = [5, 4, 2, 6, 5, 1, 9, 2]$, one of the possible distributions with maximum total profit is: $[5, 4, 2], [6, 5], [1, 9, 2]$. Here the total profit equals $5 + 6 + 9 = 20$.
|
The first line of the input contains two integers $n$ and $k$ ($1 \le k \le n \le 2000$) — the number of problems and the number of days, respectively.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 2000$) — difficulties of problems in Polycarp's list, in the order they are placed in the list (i.e. in the order Polycarp will solve them).
|
In the first line of the output print the maximum possible total profit.
In the second line print exactly $k$ positive integers $t_1, t_2, \dots, t_k$ ($t_1 + t_2 + \dots + t_k$ must equal $n$), where $t_j$ means the number of problems Polycarp will solve during the $j$-th day in order to achieve the maximum possible total profit of his practice.
If there are many possible answers, you may print any of them.
|
[
"8 3\n5 4 2 6 5 1 9 2\n",
"5 1\n1 1 1 1 1\n",
"4 2\n1 2000 2000 2\n"
] |
[
"20\n3 2 3",
"1\n5\n",
"4000\n2 2\n"
] |
The first example is described in the problem statement.
In the second example there is only one possible distribution.
In the third example the best answer is to distribute problems in the following way: $[1, 2000], [2000, 2]$. The total profit of this distribution is $2000 + 2000 = 4000$.
| 0
|
[
{
"input": "8 3\n5 4 2 6 5 1 9 2",
"output": "20\n4 1 3"
},
{
"input": "5 1\n1 1 1 1 1",
"output": "1\n5"
},
{
"input": "4 2\n1 2000 2000 2",
"output": "4000\n2 2"
},
{
"input": "1 1\n2000",
"output": "2000\n1"
},
{
"input": "1 1\n1234",
"output": "1234\n1"
},
{
"input": "3 2\n1 1 1",
"output": "2\n2 1"
},
{
"input": "4 2\n3 5 1 1",
"output": "8\n1 3"
},
{
"input": "5 3\n5 5 6 7 1",
"output": "18\n2 1 2"
},
{
"input": "6 4\n1 1 1 1 2 2",
"output": "6\n3 1 1 1"
},
{
"input": "5 3\n5 5 6 6 4",
"output": "17\n2 1 2"
},
{
"input": "16 15\n14 4 9 12 17 1 1 8 12 13 6 9 17 2 18 12",
"output": "154\n1 1 1 1 1 2 1 1 1 1 1 1 1 1 1"
},
{
"input": "1 1\n1996",
"output": "1996\n1"
},
{
"input": "5 3\n5 5 5 9 10",
"output": "24\n3 1 1"
},
{
"input": "18 15\n18 2 13 1 18 3 2 18 18 20 9 2 20 20 4 20 9 12",
"output": "204\n1 2 2 1 2 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "5 3\n1 20 20 50 50",
"output": "120\n3 1 1"
},
{
"input": "8 3\n15 14 11 19 17 14 14 8",
"output": "51\n1 3 4"
},
{
"input": "5 2\n15 20 6 19 6",
"output": "39\n2 3"
},
{
"input": "6 3\n5 5 5 5 6 9",
"output": "20\n4 1 1"
},
{
"input": "5 3\n2 2 2 3 3",
"output": "8\n3 1 1"
},
{
"input": "7 3\n2 2 2 2 2 3 3",
"output": "8\n5 1 1"
},
{
"input": "6 5\n1 1 6 6 6 6",
"output": "25\n2 1 1 1 1"
},
{
"input": "8 4\n1 2 2 2 2 3 4 5",
"output": "14\n5 1 1 1"
},
{
"input": "6 4\n1 1 1 5 5 5",
"output": "16\n3 1 1 1"
},
{
"input": "6 3\n1 2 2 2 4 5",
"output": "11\n4 1 1"
},
{
"input": "18 6\n17 17 19 14 10 20 18 16 6 7 2 15 14 16 13 6 12 11",
"output": "107\n1 1 1 3 1 11"
},
{
"input": "6 3\n1 1 2 2 3 4",
"output": "9\n4 1 1"
},
{
"input": "8 3\n5 4 2 5 6 1 9 2",
"output": "20\n4 1 3"
}
] | 1,625,141,847
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 92
| 0
|
n,k=map(int,input().split())
li=[0]+list(map(int,input().split()))
t=li.copy()
t.sort()
x=[]
e,s=-1,0
if k==1:
print(max(li))
print(n)
else:
for _ in range(k):
ind=li.index(t[e])
e-=1
s+=li[ind]
li[ind]=0
x.append(ind)
x.sort()
print(s)
for i in range(k):
if i==0:
print(x[i],end=' ')
elif i==k-1:
print(n-x[i-1],end=' ')
else:
print(x[i]-x[i-1],end=' ')
|
Title: Polycarp's Practice
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is practicing his problem solving skill. He has a list of $n$ problems with difficulties $a_1, a_2, \dots, a_n$, respectively. His plan is to practice for exactly $k$ days. Each day he has to solve at least one problem from his list. Polycarp solves the problems in the order they are given in his list, he cannot skip any problem from his list. He has to solve all $n$ problems in exactly $k$ days.
Thus, each day Polycarp solves a contiguous sequence of (consecutive) problems from the start of the list. He can't skip problems or solve them multiple times. As a result, in $k$ days he will solve all the $n$ problems.
The profit of the $j$-th day of Polycarp's practice is the maximum among all the difficulties of problems Polycarp solves during the $j$-th day (i.e. if he solves problems with indices from $l$ to $r$ during a day, then the profit of the day is $\max\limits_{l \le i \le r}a_i$). The total profit of his practice is the sum of the profits over all $k$ days of his practice.
You want to help Polycarp to get the maximum possible total profit over all valid ways to solve problems. Your task is to distribute all $n$ problems between $k$ days satisfying the conditions above in such a way, that the total profit is maximum.
For example, if $n = 8, k = 3$ and $a = [5, 4, 2, 6, 5, 1, 9, 2]$, one of the possible distributions with maximum total profit is: $[5, 4, 2], [6, 5], [1, 9, 2]$. Here the total profit equals $5 + 6 + 9 = 20$.
Input Specification:
The first line of the input contains two integers $n$ and $k$ ($1 \le k \le n \le 2000$) — the number of problems and the number of days, respectively.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 2000$) — difficulties of problems in Polycarp's list, in the order they are placed in the list (i.e. in the order Polycarp will solve them).
Output Specification:
In the first line of the output print the maximum possible total profit.
In the second line print exactly $k$ positive integers $t_1, t_2, \dots, t_k$ ($t_1 + t_2 + \dots + t_k$ must equal $n$), where $t_j$ means the number of problems Polycarp will solve during the $j$-th day in order to achieve the maximum possible total profit of his practice.
If there are many possible answers, you may print any of them.
Demo Input:
['8 3\n5 4 2 6 5 1 9 2\n', '5 1\n1 1 1 1 1\n', '4 2\n1 2000 2000 2\n']
Demo Output:
['20\n3 2 3', '1\n5\n', '4000\n2 2\n']
Note:
The first example is described in the problem statement.
In the second example there is only one possible distribution.
In the third example the best answer is to distribute problems in the following way: $[1, 2000], [2000, 2]$. The total profit of this distribution is $2000 + 2000 = 4000$.
|
```python
n,k=map(int,input().split())
li=[0]+list(map(int,input().split()))
t=li.copy()
t.sort()
x=[]
e,s=-1,0
if k==1:
print(max(li))
print(n)
else:
for _ in range(k):
ind=li.index(t[e])
e-=1
s+=li[ind]
li[ind]=0
x.append(ind)
x.sort()
print(s)
for i in range(k):
if i==0:
print(x[i],end=' ')
elif i==k-1:
print(n-x[i-1],end=' ')
else:
print(x[i]-x[i-1],end=' ')
```
| 3
|
|
556
|
A
|
Case of the Zeros and Ones
|
PROGRAMMING
| 900
|
[
"greedy"
] | null | null |
Andrewid the Android is a galaxy-famous detective. In his free time he likes to think about strings containing zeros and ones.
Once he thought about a string of length *n* consisting of zeroes and ones. Consider the following operation: we choose any two adjacent positions in the string, and if one them contains 0, and the other contains 1, then we are allowed to remove these two digits from the string, obtaining a string of length *n*<=-<=2 as a result.
Now Andreid thinks about what is the minimum length of the string that can remain after applying the described operation several times (possibly, zero)? Help him to calculate this number.
|
First line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=2·105), the length of the string that Andreid has.
The second line contains the string of length *n* consisting only from zeros and ones.
|
Output the minimum length of the string that may remain after applying the described operations several times.
|
[
"4\n1100\n",
"5\n01010\n",
"8\n11101111\n"
] |
[
"0\n",
"1\n",
"6\n"
] |
In the first sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/10df55364c21c6e8d5da31b6ab6f6294c4fc26b3.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/19ec5dcd85f0b5cf757aa076ace72df39634de2d.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the third sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/dc34a159e4230375fa325555527ebc748811f188.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
| 250
|
[
{
"input": "4\n1100",
"output": "0"
},
{
"input": "5\n01010",
"output": "1"
},
{
"input": "8\n11101111",
"output": "6"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n00",
"output": "2"
},
{
"input": "2\n01",
"output": "0"
},
{
"input": "2\n10",
"output": "0"
},
{
"input": "2\n11",
"output": "2"
},
{
"input": "3\n001",
"output": "1"
},
{
"input": "6\n110110",
"output": "2"
},
{
"input": "7\n0000011",
"output": "3"
},
{
"input": "6\n110010",
"output": "0"
},
{
"input": "6\n110100",
"output": "0"
},
{
"input": "3\n100",
"output": "1"
},
{
"input": "6\n010111",
"output": "2"
},
{
"input": "8\n01011100",
"output": "0"
},
{
"input": "6\n001011",
"output": "0"
},
{
"input": "7\n1110000",
"output": "1"
},
{
"input": "9\n011111101",
"output": "5"
}
] | 1,621,156,990
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 49
| 62
| 614,400
|
m=int(input())
n=input()
e=n.count('1')
o=n.count('0')
if(e==o):
print(0)
else:
print(abs(e-o))
|
Title: Case of the Zeros and Ones
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Andrewid the Android is a galaxy-famous detective. In his free time he likes to think about strings containing zeros and ones.
Once he thought about a string of length *n* consisting of zeroes and ones. Consider the following operation: we choose any two adjacent positions in the string, and if one them contains 0, and the other contains 1, then we are allowed to remove these two digits from the string, obtaining a string of length *n*<=-<=2 as a result.
Now Andreid thinks about what is the minimum length of the string that can remain after applying the described operation several times (possibly, zero)? Help him to calculate this number.
Input Specification:
First line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=2·105), the length of the string that Andreid has.
The second line contains the string of length *n* consisting only from zeros and ones.
Output Specification:
Output the minimum length of the string that may remain after applying the described operations several times.
Demo Input:
['4\n1100\n', '5\n01010\n', '8\n11101111\n']
Demo Output:
['0\n', '1\n', '6\n']
Note:
In the first sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/10df55364c21c6e8d5da31b6ab6f6294c4fc26b3.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/19ec5dcd85f0b5cf757aa076ace72df39634de2d.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the third sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/dc34a159e4230375fa325555527ebc748811f188.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
|
```python
m=int(input())
n=input()
e=n.count('1')
o=n.count('0')
if(e==o):
print(0)
else:
print(abs(e-o))
```
| 3
|
|
478
|
B
|
Random Teams
|
PROGRAMMING
| 1,300
|
[
"combinatorics",
"constructive algorithms",
"greedy",
"math"
] | null | null |
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends.
Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
|
The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively.
|
The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
|
[
"5 1\n",
"3 2\n",
"6 3\n"
] |
[
"10 10\n",
"1 1\n",
"3 6\n"
] |
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends.
In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one.
In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
| 1,000
|
[
{
"input": "5 1",
"output": "10 10"
},
{
"input": "3 2",
"output": "1 1"
},
{
"input": "6 3",
"output": "3 6"
},
{
"input": "5 3",
"output": "2 3"
},
{
"input": "10 2",
"output": "20 36"
},
{
"input": "10 6",
"output": "4 10"
},
{
"input": "1000000000 1",
"output": "499999999500000000 499999999500000000"
},
{
"input": "5000000 12",
"output": "1041664166668 12499942500066"
},
{
"input": "1833 195",
"output": "7722 1342341"
},
{
"input": "1000000000 1000000000",
"output": "0 0"
},
{
"input": "1000000000 1000000",
"output": "499500000000 499000500499500000"
},
{
"input": "1000000000 32170",
"output": "15541930838100 499967831017438365"
},
{
"input": "1000000 1000",
"output": "499500000 499000999500"
},
{
"input": "1234 1123",
"output": "111 6216"
},
{
"input": "599222887 298488",
"output": "601178656545 179355218158217800"
},
{
"input": "999999999 500000000",
"output": "499999999 124999999750000000"
},
{
"input": "1000000000 384842119",
"output": "845473643 189209609585784021"
},
{
"input": "1000000000 384842119",
"output": "845473643 189209609585784021"
},
{
"input": "1000000000 2",
"output": "249999999500000000 499999998500000001"
},
{
"input": "1000000000 999999999",
"output": "1 1"
},
{
"input": "38447 383",
"output": "1910550 724453080"
},
{
"input": "100000000 99999799",
"output": "201 20301"
},
{
"input": "1 1",
"output": "0 0"
},
{
"input": "2 1",
"output": "1 1"
},
{
"input": "2 2",
"output": "0 0"
},
{
"input": "10 10",
"output": "0 0"
}
] | 1,665,240,528
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 26
| 46
| 0
|
n,m=map(int,input().split())
k=n-(m-1)
mx=k*(k-1)//2
a=n//m
b=n%m
mi=b*(a+1)*a//2+ (m-b)*a*(a-1)//2
print(mi,mx)
|
Title: Random Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends.
Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
Input Specification:
The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively.
Output Specification:
The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
Demo Input:
['5 1\n', '3 2\n', '6 3\n']
Demo Output:
['10 10\n', '1 1\n', '3 6\n']
Note:
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends.
In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one.
In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
|
```python
n,m=map(int,input().split())
k=n-(m-1)
mx=k*(k-1)//2
a=n//m
b=n%m
mi=b*(a+1)*a//2+ (m-b)*a*(a-1)//2
print(mi,mx)
```
| 3
|
|
454
|
A
|
Little Pony and Crystal Mine
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
|
The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd).
|
Output a crystal of size *n*.
|
[
"3\n",
"5\n",
"7\n"
] |
[
"*D*\nDDD\n*D*\n",
"**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n",
"***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n"
] |
none
| 500
|
[
{
"input": "3",
"output": "*D*\nDDD\n*D*"
},
{
"input": "5",
"output": "**D**\n*DDD*\nDDDDD\n*DDD*\n**D**"
},
{
"input": "7",
"output": "***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***"
},
{
"input": "11",
"output": "*****D*****\n****DDD****\n***DDDDD***\n**DDDDDDD**\n*DDDDDDDDD*\nDDDDDDDDDDD\n*DDDDDDDDD*\n**DDDDDDD**\n***DDDDD***\n****DDD****\n*****D*****"
},
{
"input": "15",
"output": "*******D*******\n******DDD******\n*****DDDDD*****\n****DDDDDDD****\n***DDDDDDDDD***\n**DDDDDDDDDDD**\n*DDDDDDDDDDDDD*\nDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDD*\n**DDDDDDDDDDD**\n***DDDDDDDDD***\n****DDDDDDD****\n*****DDDDD*****\n******DDD******\n*******D*******"
},
{
"input": "21",
"output": "**********D**********\n*********DDD*********\n********DDDDD********\n*******DDDDDDD*******\n******DDDDDDDDD******\n*****DDDDDDDDDDD*****\n****DDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDD**\n*DDDDDDDDDDDDDDDDDDD*\nDDDDDDDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDDDDDDDD*\n**DDDDDDDDDDDDDDDDD**\n***DDDDDDDDDDDDDDD***\n****DDDDDDDDDDDDD****\n*****DDDDDDDDDDD*****\n******DDDDDDDDD******\n*******DDDDDDD*******\n********DDDDD********\n*********DDD*********\n**********D**********"
},
{
"input": "33",
"output": "****************D****************\n***************DDD***************\n**************DDDDD**************\n*************DDDDDDD*************\n************DDDDDDDDD************\n***********DDDDDDDDDDD***********\n**********DDDDDDDDDDDDD**********\n*********DDDDDDDDDDDDDDD*********\n********DDDDDDDDDDDDDDDDD********\n*******DDDDDDDDDDDDDDDDDDD*******\n******DDDDDDDDDDDDDDDDDDDDD******\n*****DDDDDDDDDDDDDDDDDDDDDDD*****\n****DDDDDDDDDDDDDDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDDDD..."
},
{
"input": "57",
"output": "****************************D****************************\n***************************DDD***************************\n**************************DDDDD**************************\n*************************DDDDDDD*************************\n************************DDDDDDDDD************************\n***********************DDDDDDDDDDD***********************\n**********************DDDDDDDDDDDDD**********************\n*********************DDDDDDDDDDDDDDD*********************\n********************DDDDDDDDDDDDDDDDD**..."
},
{
"input": "69",
"output": "**********************************D**********************************\n*********************************DDD*********************************\n********************************DDDDD********************************\n*******************************DDDDDDD*******************************\n******************************DDDDDDDDD******************************\n*****************************DDDDDDDDDDD*****************************\n****************************DDDDDDDDDDDDD****************************\n**************..."
},
{
"input": "81",
"output": "****************************************D****************************************\n***************************************DDD***************************************\n**************************************DDDDD**************************************\n*************************************DDDDDDD*************************************\n************************************DDDDDDDDD************************************\n***********************************DDDDDDDDDDD***********************************\n*************..."
},
{
"input": "91",
"output": "*********************************************D*********************************************\n********************************************DDD********************************************\n*******************************************DDDDD*******************************************\n******************************************DDDDDDD******************************************\n*****************************************DDDDDDDDD*****************************************\n****************************************DDDDDD..."
},
{
"input": "101",
"output": "**************************************************D**************************************************\n*************************************************DDD*************************************************\n************************************************DDDDD************************************************\n***********************************************DDDDDDD***********************************************\n**********************************************DDDDDDDDD********************************************..."
}
] | 1,616,019,283
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 12
| 62
| 409,600
|
N = int(input())
samping_kiri = N//2 - 1
samping_kanan = N//2 + 1
for i in range(N):
for j in range(N):
if j>samping_kiri and j<samping_kanan:
print("D", end="")
else:
print("*", end="")
if i < N//2:
samping_kiri -=1
samping_kanan +=1
elif i>= N//2:
samping_kiri +=1
samping_kanan -=1
print()
|
Title: Little Pony and Crystal Mine
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
Input Specification:
The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd).
Output Specification:
Output a crystal of size *n*.
Demo Input:
['3\n', '5\n', '7\n']
Demo Output:
['*D*\nDDD\n*D*\n', '**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n', '***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n']
Note:
none
|
```python
N = int(input())
samping_kiri = N//2 - 1
samping_kanan = N//2 + 1
for i in range(N):
for j in range(N):
if j>samping_kiri and j<samping_kanan:
print("D", end="")
else:
print("*", end="")
if i < N//2:
samping_kiri -=1
samping_kanan +=1
elif i>= N//2:
samping_kiri +=1
samping_kanan -=1
print()
```
| 3
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.