contestId
int64
0
1.01k
index
stringclasses
40 values
name
stringlengths
2
54
type
stringclasses
2 values
rating
int64
0
3.4k
tags
listlengths
0
7
title
stringclasses
393 values
time-limit
stringclasses
7 values
memory-limit
stringclasses
6 values
problem-description
stringlengths
0
2.97k
input-specification
stringlengths
4
1.87k
output-specification
stringlengths
4
1.12k
demo-input
listlengths
0
7
demo-output
listlengths
0
7
note
stringlengths
0
5.24k
points
float64
0
3.5k
test_cases
listlengths
0
402
creationTimeSeconds
int64
1.37B
1.7B
relativeTimeSeconds
int64
8
2.15B
programmingLanguage
stringclasses
3 values
verdict
stringclasses
1 value
testset
stringclasses
9 values
passedTestCount
int64
1
402
timeConsumedMillis
int64
15
8.06k
memoryConsumedBytes
int64
0
514M
code
stringlengths
11
61.4k
prompt
stringlengths
297
7.35k
response
stringlengths
25
61.4k
score
float64
2.82
3.99
897
B
Chtholly's request
PROGRAMMING
1,300
[ "brute force" ]
null
null
— I experienced so many great things. — You gave me memories like dreams... But I have to leave now... — One last request, can you... — Help me solve a Codeforces problem? — ...... — What? Chtholly has been thinking about a problem for days: If a number is palindrome and length of its decimal representation without leading zeros is even, we call it a zcy number. A number is palindrome means when written in decimal representation, it contains no leading zeros and reads the same forwards and backwards. For example 12321 and 1221 are palindromes and 123 and 12451 are not. Moreover, 1221 is zcy number and 12321 is not. Given integers *k* and *p*, calculate the sum of the *k* smallest zcy numbers and output this sum modulo *p*. Unfortunately, Willem isn't good at solving this kind of problems, so he asks you for help!
The first line contains two integers *k* and *p* (1<=≤<=*k*<=≤<=105,<=1<=≤<=*p*<=≤<=109).
Output single integer — answer to the problem.
[ "2 100\n", "5 30\n" ]
[ "33\n", "15\n" ]
In the first example, the smallest zcy number is 11, and the second smallest zcy number is 22. In the second example, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/68fffad54395f7d920ad0384e07c6215ddc64141.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
1,000
[ { "input": "2 100", "output": "33" }, { "input": "5 30", "output": "15" }, { "input": "42147 412393322", "output": "251637727" }, { "input": "77809 868097296", "output": "440411873" }, { "input": "5105 443422097", "output": "363192634" }, { "input": "75615 376679484", "output": "373089399" }, { "input": "22951 23793302", "output": "1898631" }, { "input": "12785 993582106", "output": "286204743" }, { "input": "60276 428978808", "output": "376477293" }, { "input": "84776 104860385", "output": "10209596" }, { "input": "41984 653766991", "output": "17823101" }, { "input": "100000 1000000000", "output": "495495496" }, { "input": "41163 472310076", "output": "207304047" }, { "input": "6983 765352180", "output": "586866999" }, { "input": "33493 967727004", "output": "305705165" }, { "input": "90898 94010922", "output": "65928728" }, { "input": "67298 349286579", "output": "156435206" }, { "input": "92452 296773064", "output": "229486976" }, { "input": "58832 563860457", "output": "16775206" }, { "input": "90234 156145441", "output": "44023160" }, { "input": "91454 977186148", "output": "681779748" }, { "input": "11108 444095250", "output": "188075844" }, { "input": "46304 584475527", "output": "275627129" }, { "input": "1 1", "output": "0" }, { "input": "1 1000000000", "output": "11" }, { "input": "100000 1", "output": "0" } ]
1,645,090,261
2,147,483,647
Python 3
OK
TESTS
26
124
0
a, k = map(int, input().split()) sm = 0 for i in range(1, a + 1): r = str(i) sm += int(r + r[::-1]) sm %= k print(sm % k) # Thu Feb 17 2022 09:30:59 GMT+0000 (Coordinated Universal Time)
Title: Chtholly's request Time Limit: None seconds Memory Limit: None megabytes Problem Description: — I experienced so many great things. — You gave me memories like dreams... But I have to leave now... — One last request, can you... — Help me solve a Codeforces problem? — ...... — What? Chtholly has been thinking about a problem for days: If a number is palindrome and length of its decimal representation without leading zeros is even, we call it a zcy number. A number is palindrome means when written in decimal representation, it contains no leading zeros and reads the same forwards and backwards. For example 12321 and 1221 are palindromes and 123 and 12451 are not. Moreover, 1221 is zcy number and 12321 is not. Given integers *k* and *p*, calculate the sum of the *k* smallest zcy numbers and output this sum modulo *p*. Unfortunately, Willem isn't good at solving this kind of problems, so he asks you for help! Input Specification: The first line contains two integers *k* and *p* (1<=≤<=*k*<=≤<=105,<=1<=≤<=*p*<=≤<=109). Output Specification: Output single integer — answer to the problem. Demo Input: ['2 100\n', '5 30\n'] Demo Output: ['33\n', '15\n'] Note: In the first example, the smallest zcy number is 11, and the second smallest zcy number is 22. In the second example, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/68fffad54395f7d920ad0384e07c6215ddc64141.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
```python a, k = map(int, input().split()) sm = 0 for i in range(1, a + 1): r = str(i) sm += int(r + r[::-1]) sm %= k print(sm % k) # Thu Feb 17 2022 09:30:59 GMT+0000 (Coordinated Universal Time) ```
3
290
B
QR code
PROGRAMMING
1,500
[ "*special", "implementation" ]
null
null
The input contains two integers *a*1,<=*a*2 (0<=≤<=*a**i*<=≤<=32), separated by a single space.
Output a single integer.
[ "1 1\n", "3 7\n", "13 10\n" ]
[ "0\n", "0\n", "1\n" ]
none
0
[ { "input": "1 1", "output": "0" }, { "input": "3 7", "output": "0" }, { "input": "13 10", "output": "1" }, { "input": "6 12", "output": "1" }, { "input": "14 14", "output": "0" }, { "input": "19 14", "output": "0" }, { "input": "21 18", "output": "1" }, { "input": "29 18", "output": "0" }, { "input": "0 24", "output": "0" }, { "input": "16 24", "output": "1" }, { "input": "20 28", "output": "1" }, { "input": "23 30", "output": "0" }, { "input": "23 7", "output": "1" }, { "input": "27 13", "output": "1" }, { "input": "0 13", "output": "0" }, { "input": "12 14", "output": "1" }, { "input": "21 18", "output": "1" }, { "input": "25 20", "output": "0" }, { "input": "29 24", "output": "1" }, { "input": "2 24", "output": "0" }, { "input": "14 28", "output": "0" }, { "input": "23 30", "output": "0" }, { "input": "17 32", "output": "0" }, { "input": "25 5", "output": "0" }, { "input": "29 5", "output": "0" }, { "input": "0 5", "output": "1" }, { "input": "16 11", "output": "1" }, { "input": "19 11", "output": "0" }, { "input": "27 15", "output": "1" }, { "input": "31 15", "output": "0" }, { "input": "0 0", "output": "1" }, { "input": "32 0", "output": "1" }, { "input": "0 32", "output": "1" }, { "input": "32 32", "output": "1" }, { "input": "0 31", "output": "1" }, { "input": "1 31", "output": "0" } ]
1,617,207,776
4,376
Python 3
OK
TESTS
36
124
0
x,y = map(int, input().split()) a = [ '111111101010101111100101001111111', '100000100000000001010110001000001', '101110100110110000011010001011101', '101110101011001001111101001011101', '101110101100011000111100101011101', '100000101010101011010000101000001', '111111101010101010101010101111111', '000000001111101111100111100000000', '100010111100100001011110111111001', '110111001111111100100001000101100', '011100111010000101000111010001010', '011110000110001111110101100000011', '111111111111111000111001001011000', '111000010111010011010011010100100', '101010100010110010110101010000010', '101100000101010001111101000000000', '000010100011001101000111101011010', '101001001111101111000101010001110', '101101111111000100100001110001000', '000010011000100110000011010000010', '001101101001101110010010011011000', '011101011010001000111101010100110', '111010100110011101001101000001110', '110001010010101111000101111111000', '001000111011100001010110111110000', '000000001110010110100010100010110', '111111101000101111000110101011010', '100000100111010101111100100011011', '101110101001010000101000111111000', '101110100011010010010111111011010', '101110100100011011110110101110000', '100000100110011001111100111100000', '111111101101000101001101110010001',] print(a[x][y])
Title: QR code Time Limit: None seconds Memory Limit: None megabytes Problem Description: Input Specification: The input contains two integers *a*1,<=*a*2 (0<=≤<=*a**i*<=≤<=32), separated by a single space. Output Specification: Output a single integer. Demo Input: ['1 1\n', '3 7\n', '13 10\n'] Demo Output: ['0\n', '0\n', '1\n'] Note: none
```python x,y = map(int, input().split()) a = [ '111111101010101111100101001111111', '100000100000000001010110001000001', '101110100110110000011010001011101', '101110101011001001111101001011101', '101110101100011000111100101011101', '100000101010101011010000101000001', '111111101010101010101010101111111', '000000001111101111100111100000000', '100010111100100001011110111111001', '110111001111111100100001000101100', '011100111010000101000111010001010', '011110000110001111110101100000011', '111111111111111000111001001011000', '111000010111010011010011010100100', '101010100010110010110101010000010', '101100000101010001111101000000000', '000010100011001101000111101011010', '101001001111101111000101010001110', '101101111111000100100001110001000', '000010011000100110000011010000010', '001101101001101110010010011011000', '011101011010001000111101010100110', '111010100110011101001101000001110', '110001010010101111000101111111000', '001000111011100001010110111110000', '000000001110010110100010100010110', '111111101000101111000110101011010', '100000100111010101111100100011011', '101110101001010000101000111111000', '101110100011010010010111111011010', '101110100100011011110110101110000', '100000100110011001111100111100000', '111111101101000101001101110010001',] print(a[x][y]) ```
3
430
B
Balls Game
PROGRAMMING
1,400
[ "brute force", "two pointers" ]
null
null
Iahub is training for the IOI. What is a better way to train than playing a Zuma-like game? There are *n* balls put in a row. Each ball is colored in one of *k* colors. Initially the row doesn't contain three or more contiguous balls with the same color. Iahub has a single ball of color *x*. He can insert his ball at any position in the row (probably, between two other balls). If at any moment there are three or more contiguous balls of the same color in the row, they are destroyed immediately. This rule is applied multiple times, until there are no more sets of 3 or more contiguous balls of the same color. For example, if Iahub has the row of balls [black, black, white, white, black, black] and a white ball, he can insert the ball between two white balls. Thus three white balls are destroyed, and then four black balls become contiguous, so all four balls are destroyed. The row will not contain any ball in the end, so Iahub can destroy all 6 balls. Iahub wants to destroy as many balls as possible. You are given the description of the row of balls, and the color of Iahub's ball. Help Iahub train for the IOI by telling him the maximum number of balls from the row he can destroy.
The first line of input contains three integers: *n* (1<=≤<=*n*<=≤<=100), *k* (1<=≤<=*k*<=≤<=100) and *x* (1<=≤<=*x*<=≤<=*k*). The next line contains *n* space-separated integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=*k*). Number *c**i* means that the *i*-th ball in the row has color *c**i*. It is guaranteed that the initial row of balls will never contain three or more contiguous balls of the same color.
Print a single integer — the maximum number of balls Iahub can destroy.
[ "6 2 2\n1 1 2 2 1 1\n", "1 1 1\n1\n" ]
[ "6\n", "0\n" ]
none
1,000
[ { "input": "6 2 2\n1 1 2 2 1 1", "output": "6" }, { "input": "1 1 1\n1", "output": "0" }, { "input": "10 2 1\n2 1 2 2 1 2 2 1 1 2", "output": "5" }, { "input": "50 2 1\n1 1 2 2 1 2 1 1 2 2 1 2 1 2 1 1 2 2 1 2 1 2 2 1 2 1 2 1 2 2 1 1 2 2 1 1 2 2 1 2 1 1 2 1 1 2 2 1 1 2", "output": "15" }, { "input": "75 5 5\n1 1 5 5 3 5 2 3 3 2 2 1 1 5 4 4 3 4 5 4 3 3 1 2 2 1 2 1 2 5 5 2 1 3 2 2 3 1 2 1 1 5 5 1 1 2 1 1 2 2 5 2 2 1 1 2 1 2 1 1 3 3 5 4 4 3 3 4 4 5 5 1 1 2 2", "output": "6" }, { "input": "100 3 2\n1 1 2 3 1 3 2 1 1 3 3 2 2 1 1 2 2 1 1 3 2 2 3 2 3 2 2 3 3 1 1 2 2 1 2 2 1 3 3 1 3 3 1 2 1 2 2 1 2 3 2 1 1 2 1 1 3 3 1 3 3 1 1 2 2 1 1 2 1 3 2 2 3 2 2 3 3 1 2 1 2 2 1 1 2 3 1 3 3 1 2 3 2 2 1 3 2 2 3 3", "output": "6" }, { "input": "100 2 1\n2 2 1 2 1 2 1 2 2 1 1 2 1 1 2 1 1 2 2 1 1 2 1 1 2 1 2 2 1 2 1 2 1 2 1 1 2 1 1 2 1 1 2 2 1 1 2 1 2 2 1 2 1 2 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 1 2 1 2 1 2 2 1 2 1 1 2 1 2 1 1 2 1 1 2 1 1 2 2 1 2 2 1 1 2 1", "output": "15" }, { "input": "100 2 2\n1 2 1 2 2 1 2 1 2 1 2 1 1 2 1 2 2 1 1 2 1 1 2 2 1 1 2 1 2 2 1 2 2 1 2 1 2 1 1 2 1 2 1 2 1 2 1 1 2 1 1 2 2 1 1 2 2 1 2 1 2 1 2 1 2 2 1 2 1 2 2 1 1 2 1 2 2 1 1 2 2 1 2 1 2 1 1 2 1 2 1 2 1 2 1 2 2 1 2 2", "output": "14" }, { "input": "100 2 2\n1 2 1 1 2 1 2 2 1 2 1 2 1 2 1 2 1 2 2 1 1 2 2 1 2 1 1 2 2 1 1 2 1 2 1 2 1 1 2 1 1 2 1 2 2 1 1 2 2 1 1 2 1 2 2 1 1 2 1 2 1 2 2 1 2 2 1 1 2 1 2 2 1 2 2 1 2 1 1 2 1 2 2 1 2 2 1 2 1 2 1 2 1 1 2 2 1 1 2 2", "output": "17" }, { "input": "100 2 2\n2 1 1 2 2 1 1 2 1 2 1 1 2 2 1 2 1 2 1 2 2 1 2 1 1 2 1 2 1 2 1 2 1 1 2 2 1 1 2 1 1 2 1 2 2 1 1 2 1 2 1 1 2 2 1 1 2 1 2 1 2 1 2 2 1 1 2 2 1 1 2 2 1 2 1 2 1 1 2 1 1 2 2 1 2 1 2 2 1 2 2 1 1 2 1 2 2 1 2 2", "output": "17" }, { "input": "100 2 2\n1 2 2 1 2 2 1 1 2 1 2 1 2 1 2 1 2 1 2 1 1 2 2 1 2 1 2 1 2 1 2 1 1 2 1 1 2 1 2 2 1 1 2 2 1 1 2 1 1 2 2 1 2 1 2 1 2 1 2 1 1 2 2 1 1 2 2 1 1 2 2 1 2 2 1 1 2 1 2 2 1 2 2 1 2 2 1 2 2 1 1 2 2 1 2 1 2 1 2 1", "output": "28" }, { "input": "100 2 2\n1 1 2 1 2 1 1 2 1 2 1 2 2 1 2 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 1 2 2 1 2 2 1 2 1 2 1 1 2 1 2 1 1 2 2 1 1 2 1 2 1 2 1 2 1 2 2 1 1 2 1 2 2 1 2 1 1 2 1 1 2 1 2 1 2 1 1 2 1 2 2 1 2 1 2 2 1 1 2 1 2 2 1 1 2 2", "output": "8" }, { "input": "100 100 50\n15 44 5 7 75 40 52 82 78 90 48 32 16 53 69 2 21 84 7 21 21 87 29 8 42 54 10 21 38 55 54 88 48 63 3 17 45 82 82 91 7 11 11 24 24 79 1 32 32 38 41 41 4 4 74 17 26 26 96 96 3 3 50 50 96 26 26 17 17 74 74 4 41 38 38 32 1 1 79 79 24 11 11 7 7 91 91 82 45 45 97 9 74 60 32 91 61 64 100 26", "output": "2" }, { "input": "100 50 22\n15 2 18 15 48 35 46 33 32 39 39 5 5 27 27 50 50 47 47 10 10 6 3 3 7 8 7 17 17 29 14 10 10 46 13 13 31 32 31 22 22 32 31 31 32 13 13 46 46 10 10 14 14 29 29 17 7 7 8 3 6 6 10 47 50 50 27 5 5 39 39 21 47 4 40 47 21 28 21 21 40 27 34 17 3 36 5 7 21 14 25 49 40 34 32 13 23 29 2 4", "output": "2" }, { "input": "100 3 3\n3 1 1 2 1 1 3 1 3 3 1 3 3 1 2 1 1 2 2 3 3 2 3 2 2 3 1 3 3 2 2 1 3 3 2 2 1 2 3 3 1 3 1 3 1 2 2 1 2 1 2 3 1 3 1 3 2 1 3 2 3 3 2 3 2 3 1 3 2 2 1 2 1 2 1 1 3 1 3 1 2 1 2 1 2 3 2 2 3 3 2 2 3 2 2 3 1 1 2 3", "output": "6" }, { "input": "100 100 100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "0" }, { "input": "100 2 2\n1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2", "output": "98" }, { "input": "6 20 10\n10 2 10 10 2 2", "output": "5" } ]
1,585,017,456
2,147,483,647
Python 3
OK
TESTS
18
109
307,200
n, k, bola = [int(x) for x in input().split()] fila = [int(x) for x in input().split()] removidas = 0 for i in range(n): copia = fila.copy() copia.insert(i, bola) while len(copia) > 2: tmp = len(copia) for j in range(len(copia)-2): if copia[j] == copia[j+1] == copia[j+2]: p = j + 3 while p < len(copia): if copia[j] != copia[p]: break p += 1 copia = copia[:j] + copia[p:] break if tmp == len(copia): break removidas = max(removidas, n - len(copia)) print(removidas)
Title: Balls Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Iahub is training for the IOI. What is a better way to train than playing a Zuma-like game? There are *n* balls put in a row. Each ball is colored in one of *k* colors. Initially the row doesn't contain three or more contiguous balls with the same color. Iahub has a single ball of color *x*. He can insert his ball at any position in the row (probably, between two other balls). If at any moment there are three or more contiguous balls of the same color in the row, they are destroyed immediately. This rule is applied multiple times, until there are no more sets of 3 or more contiguous balls of the same color. For example, if Iahub has the row of balls [black, black, white, white, black, black] and a white ball, he can insert the ball between two white balls. Thus three white balls are destroyed, and then four black balls become contiguous, so all four balls are destroyed. The row will not contain any ball in the end, so Iahub can destroy all 6 balls. Iahub wants to destroy as many balls as possible. You are given the description of the row of balls, and the color of Iahub's ball. Help Iahub train for the IOI by telling him the maximum number of balls from the row he can destroy. Input Specification: The first line of input contains three integers: *n* (1<=≤<=*n*<=≤<=100), *k* (1<=≤<=*k*<=≤<=100) and *x* (1<=≤<=*x*<=≤<=*k*). The next line contains *n* space-separated integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=*k*). Number *c**i* means that the *i*-th ball in the row has color *c**i*. It is guaranteed that the initial row of balls will never contain three or more contiguous balls of the same color. Output Specification: Print a single integer — the maximum number of balls Iahub can destroy. Demo Input: ['6 2 2\n1 1 2 2 1 1\n', '1 1 1\n1\n'] Demo Output: ['6\n', '0\n'] Note: none
```python n, k, bola = [int(x) for x in input().split()] fila = [int(x) for x in input().split()] removidas = 0 for i in range(n): copia = fila.copy() copia.insert(i, bola) while len(copia) > 2: tmp = len(copia) for j in range(len(copia)-2): if copia[j] == copia[j+1] == copia[j+2]: p = j + 3 while p < len(copia): if copia[j] != copia[p]: break p += 1 copia = copia[:j] + copia[p:] break if tmp == len(copia): break removidas = max(removidas, n - len(copia)) print(removidas) ```
3
20
A
BerOS file system
PROGRAMMING
1,700
[ "implementation" ]
A. BerOS file system
2
64
The new operating system BerOS has a nice feature. It is possible to use any number of characters '/' as a delimiter in path instead of one traditional '/'. For example, strings //usr///local//nginx/sbin// and /usr/local/nginx///sbin are equivalent. The character '/' (or some sequence of such characters) at the end of the path is required only in case of the path to the root directory, which can be represented as single character '/'. A path called normalized if it contains the smallest possible number of characters '/'. Your task is to transform a given path to the normalized form.
The first line of the input contains only lowercase Latin letters and character '/' — the path to some directory. All paths start with at least one character '/'. The length of the given line is no more than 100 characters, it is not empty.
The path in normalized form.
[ "//usr///local//nginx/sbin\n" ]
[ "/usr/local/nginx/sbin\n" ]
none
500
[ { "input": "//usr///local//nginx/sbin", "output": "/usr/local/nginx/sbin" }, { "input": "////a//b/////g", "output": "/a/b/g" }, { "input": "/a/b/c", "output": "/a/b/c" }, { "input": "/", "output": "/" }, { "input": "////", "output": "/" }, { "input": "/a//aa/a//", "output": "/a/aa/a" }, { "input": "/aa//b/aa", "output": "/aa/b/aa" }, { "input": "////////////////////////////////////////////////////////////////////////////////////////////////////", "output": "/" }, { "input": "/opt///pokerband///srvb/opt///pokerband///srvb////pokerband///srvb/", "output": "/opt/pokerband/srvb/opt/pokerband/srvb/pokerband/srvb" }, { "input": "/root/pokerband/trunk/server/game/code/src/main/java/com/uosipa/pokerband/gameserver/game/", "output": "/root/pokerband/trunk/server/game/code/src/main/java/com/uosipa/pokerband/gameserver/game" }, { "input": "/root//pokerband/trunk/server/game/code/src///main/java/com/uosipa/pokerband//gameserver/game//", "output": "/root/pokerband/trunk/server/game/code/src/main/java/com/uosipa/pokerband/gameserver/game" }, { "input": "/root//pokerband/trunk/server/game/code/src///main/java/com/uosipa/pokerband//gameserver/game//test/", "output": "/root/pokerband/trunk/server/game/code/src/main/java/com/uosipa/pokerband/gameserver/game/test" }, { "input": "/root//pokerband/trunk/server/game/code/src///main/java/com/uosipa/pokerband//gameserver/game//testt", "output": "/root/pokerband/trunk/server/game/code/src/main/java/com/uosipa/pokerband/gameserver/game/testt" }, { "input": "///a//a////a/a//a//a//a/////", "output": "/a/a/a/a/a/a/a" }, { "input": "/zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz", "output": "/zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz" }, { "input": "/zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz/", "output": "/zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz" }, { "input": "/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a", "output": "/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a" }, { "input": "///////////////////////////////////////////////////////////////////////////////////////////////////z", "output": "/z" }, { "input": "/z//////////////////////////////////////////////////////////////////////////////////////////////////", "output": "/z" } ]
1,645,886,274
2,147,483,647
PyPy 3-64
OK
TESTS
19
122
0
s = [i for i in input().split('/') if len(i) > 0] print('/' + '/'.join(s))
Title: BerOS file system Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: The new operating system BerOS has a nice feature. It is possible to use any number of characters '/' as a delimiter in path instead of one traditional '/'. For example, strings //usr///local//nginx/sbin// and /usr/local/nginx///sbin are equivalent. The character '/' (or some sequence of such characters) at the end of the path is required only in case of the path to the root directory, which can be represented as single character '/'. A path called normalized if it contains the smallest possible number of characters '/'. Your task is to transform a given path to the normalized form. Input Specification: The first line of the input contains only lowercase Latin letters and character '/' — the path to some directory. All paths start with at least one character '/'. The length of the given line is no more than 100 characters, it is not empty. Output Specification: The path in normalized form. Demo Input: ['//usr///local//nginx/sbin\n'] Demo Output: ['/usr/local/nginx/sbin\n'] Note: none
```python s = [i for i in input().split('/') if len(i) > 0] print('/' + '/'.join(s)) ```
3.9695
122
A
Lucky Division
PROGRAMMING
1,000
[ "brute force", "number theory" ]
null
null
Petya loves lucky numbers. Everybody knows that lucky numbers are positive integers whose decimal representation contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. Petya calls a number almost lucky if it could be evenly divided by some lucky number. Help him find out if the given number *n* is almost lucky.
The single line contains an integer *n* (1<=≤<=*n*<=≤<=1000) — the number that needs to be checked.
In the only line print "YES" (without the quotes), if number *n* is almost lucky. Otherwise, print "NO" (without the quotes).
[ "47\n", "16\n", "78\n" ]
[ "YES\n", "YES\n", "NO\n" ]
Note that all lucky numbers are almost lucky as any number is evenly divisible by itself. In the first sample 47 is a lucky number. In the second sample 16 is divisible by 4.
500
[ { "input": "47", "output": "YES" }, { "input": "16", "output": "YES" }, { "input": "78", "output": "NO" }, { "input": "48", "output": "YES" }, { "input": "100", "output": "YES" }, { "input": "107", "output": "NO" }, { "input": "77", "output": "YES" }, { "input": "477", "output": "YES" }, { "input": "480", "output": "YES" }, { "input": "1", "output": "NO" }, { "input": "3", "output": "NO" }, { "input": "4", "output": "YES" }, { "input": "49", "output": "YES" }, { "input": "56", "output": "YES" }, { "input": "124", "output": "YES" }, { "input": "1000", "output": "YES" }, { "input": "999", "output": "NO" }, { "input": "298", "output": "NO" }, { "input": "274", "output": "NO" }, { "input": "998", "output": "NO" }, { "input": "42", "output": "YES" }, { "input": "788", "output": "YES" }, { "input": "70", "output": "YES" }, { "input": "444", "output": "YES" }, { "input": "777", "output": "YES" }, { "input": "799", "output": "YES" }, { "input": "25", "output": "NO" }, { "input": "882", "output": "YES" }, { "input": "88", "output": "YES" }, { "input": "11", "output": "NO" }, { "input": "2", "output": "NO" }, { "input": "7", "output": "YES" }, { "input": "8", "output": "YES" }, { "input": "94", "output": "YES" }, { "input": "477", "output": "YES" }, { "input": "141", "output": "YES" } ]
1,689,441,427
2,147,483,647
Python 3
OK
TESTS
36
62
0
n=int(input()) a=[4,7,44,47,74,77,444,447,474,477,744,747,777] flag=False for i in a: if n%i==0: flag=True break if flag: print("YES") else: print("NO")
Title: Lucky Division Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petya loves lucky numbers. Everybody knows that lucky numbers are positive integers whose decimal representation contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. Petya calls a number almost lucky if it could be evenly divided by some lucky number. Help him find out if the given number *n* is almost lucky. Input Specification: The single line contains an integer *n* (1<=≤<=*n*<=≤<=1000) — the number that needs to be checked. Output Specification: In the only line print "YES" (without the quotes), if number *n* is almost lucky. Otherwise, print "NO" (without the quotes). Demo Input: ['47\n', '16\n', '78\n'] Demo Output: ['YES\n', 'YES\n', 'NO\n'] Note: Note that all lucky numbers are almost lucky as any number is evenly divisible by itself. In the first sample 47 is a lucky number. In the second sample 16 is divisible by 4.
```python n=int(input()) a=[4,7,44,47,74,77,444,447,474,477,744,747,777] flag=False for i in a: if n%i==0: flag=True break if flag: print("YES") else: print("NO") ```
3
495
B
Modular Equations
PROGRAMMING
1,600
[ "math", "number theory" ]
null
null
Last week, Hamed learned about a new type of equations in his math class called Modular Equations. Lets define *i* modulo *j* as the remainder of division of *i* by *j* and denote it by . A Modular Equation, as Hamed's teacher described, is an equation of the form in which *a* and *b* are two non-negative integers and *x* is a variable. We call a positive integer *x* for which a solution of our equation. Hamed didn't pay much attention to the class since he was watching a movie. He only managed to understand the definitions of these equations. Now he wants to write his math exercises but since he has no idea how to do that, he asked you for help. He has told you all he knows about Modular Equations and asked you to write a program which given two numbers *a* and *b* determines how many answers the Modular Equation has.
In the only line of the input two space-separated integers *a* and *b* (0<=≤<=*a*,<=*b*<=≤<=109) are given.
If there is an infinite number of answers to our equation, print "infinity" (without the quotes). Otherwise print the number of solutions of the Modular Equation .
[ "21 5\n", "9435152 272\n", "10 10\n" ]
[ "2\n", "282\n", "infinity\n" ]
In the first sample the answers of the Modular Equation are 8 and 16 since <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/6f5ff39ebd209bf990adaf91f4b82f9687097224.png" style="max-width: 100.0%;max-height: 100.0%;"/>
1,000
[ { "input": "21 5", "output": "2" }, { "input": "9435152 272", "output": "282" }, { "input": "10 10", "output": "infinity" }, { "input": "0 1000000000", "output": "0" }, { "input": "11 2", "output": "2" }, { "input": "1 0", "output": "1" }, { "input": "0 0", "output": "infinity" }, { "input": "121 0", "output": "3" }, { "input": "772930485 686893955", "output": "0" }, { "input": "257424 24", "output": "127" }, { "input": "295138437 589952171", "output": "0" }, { "input": "223093836 966", "output": "399" }, { "input": "233758336 10665466", "output": "13" }, { "input": "223092887 17", "output": "500" }, { "input": "223094728 1858", "output": "371" }, { "input": "223092899 29", "output": "495" }, { "input": "997920 0", "output": "240" }, { "input": "887043 3", "output": "213" }, { "input": "124 24", "output": "3" }, { "input": "982901 101", "output": "193" }, { "input": "357987 35", "output": "45" }, { "input": "954374 1030", "output": "32" }, { "input": "49106 46", "output": "15" }, { "input": "325508499 119510657", "output": "1" }, { "input": "89768760 885778845", "output": "0" }, { "input": "944387968 700818251", "output": "0" }, { "input": "12 3", "output": "1" }, { "input": "1000000000 1", "output": "19" }, { "input": "923456789 3", "output": "14" }, { "input": "1000000000 6", "output": "6" }, { "input": "1000000000 333333300", "output": "2" }, { "input": "5 2", "output": "1" }, { "input": "1 10", "output": "0" }, { "input": "15 3", "output": "3" }, { "input": "2 0", "output": "2" }, { "input": "77 75", "output": "0" }, { "input": "1000000000 1000000000", "output": "infinity" } ]
1,643,881,156
2,147,483,647
PyPy 3
OK
TESTS
37
77
1,228,800
a,b=map(int,input().split()) if a<b: print(0) elif a==b: print("infinity") else: x=a-b ans=0 for i in range(1,int(x**(0.5))+1): if x%i==0: j=x//i #print(i,j) if a%i==b: ans+=1 if a%j==b and i!=j: ans+=1 print(ans)
Title: Modular Equations Time Limit: None seconds Memory Limit: None megabytes Problem Description: Last week, Hamed learned about a new type of equations in his math class called Modular Equations. Lets define *i* modulo *j* as the remainder of division of *i* by *j* and denote it by . A Modular Equation, as Hamed's teacher described, is an equation of the form in which *a* and *b* are two non-negative integers and *x* is a variable. We call a positive integer *x* for which a solution of our equation. Hamed didn't pay much attention to the class since he was watching a movie. He only managed to understand the definitions of these equations. Now he wants to write his math exercises but since he has no idea how to do that, he asked you for help. He has told you all he knows about Modular Equations and asked you to write a program which given two numbers *a* and *b* determines how many answers the Modular Equation has. Input Specification: In the only line of the input two space-separated integers *a* and *b* (0<=≤<=*a*,<=*b*<=≤<=109) are given. Output Specification: If there is an infinite number of answers to our equation, print "infinity" (without the quotes). Otherwise print the number of solutions of the Modular Equation . Demo Input: ['21 5\n', '9435152 272\n', '10 10\n'] Demo Output: ['2\n', '282\n', 'infinity\n'] Note: In the first sample the answers of the Modular Equation are 8 and 16 since <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/6f5ff39ebd209bf990adaf91f4b82f9687097224.png" style="max-width: 100.0%;max-height: 100.0%;"/>
```python a,b=map(int,input().split()) if a<b: print(0) elif a==b: print("infinity") else: x=a-b ans=0 for i in range(1,int(x**(0.5))+1): if x%i==0: j=x//i #print(i,j) if a%i==b: ans+=1 if a%j==b and i!=j: ans+=1 print(ans) ```
3
864
A
Fair Game
PROGRAMMING
1,000
[ "implementation", "sortings" ]
null
null
Petya and Vasya decided to play a game. They have *n* cards (*n* is an even number). A single integer is written on each card. Before the game Petya will choose an integer and after that Vasya will choose another integer (different from the number that Petya chose). During the game each player takes all the cards with number he chose. For example, if Petya chose number 5 before the game he will take all cards on which 5 is written and if Vasya chose number 10 before the game he will take all cards on which 10 is written. The game is considered fair if Petya and Vasya can take all *n* cards, and the number of cards each player gets is the same. Determine whether Petya and Vasya can choose integer numbers before the game so that the game is fair.
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=100) — number of cards. It is guaranteed that *n* is an even number. The following *n* lines contain a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (one integer per line, 1<=≤<=*a**i*<=≤<=100) — numbers written on the *n* cards.
If it is impossible for Petya and Vasya to choose numbers in such a way that the game will be fair, print "NO" (without quotes) in the first line. In this case you should not print anything more. In the other case print "YES" (without quotes) in the first line. In the second line print two distinct integers — number that Petya should choose and the number that Vasya should choose to make the game fair. If there are several solutions, print any of them.
[ "4\n11\n27\n27\n11\n", "2\n6\n6\n", "6\n10\n20\n30\n20\n10\n20\n", "6\n1\n1\n2\n2\n3\n3\n" ]
[ "YES\n11 27\n", "NO\n", "NO\n", "NO\n" ]
In the first example the game will be fair if, for example, Petya chooses number 11, and Vasya chooses number 27. Then the will take all cards — Petya will take cards 1 and 4, and Vasya will take cards 2 and 3. Thus, each of them will take exactly two cards. In the second example fair game is impossible because the numbers written on the cards are equal, but the numbers that Petya and Vasya should choose should be distinct. In the third example it is impossible to take all cards. Petya and Vasya can take at most five cards — for example, Petya can choose number 10 and Vasya can choose number 20. But for the game to be fair it is necessary to take 6 cards.
500
[ { "input": "4\n11\n27\n27\n11", "output": "YES\n11 27" }, { "input": "2\n6\n6", "output": "NO" }, { "input": "6\n10\n20\n30\n20\n10\n20", "output": "NO" }, { "input": "6\n1\n1\n2\n2\n3\n3", "output": "NO" }, { "input": "2\n1\n100", "output": "YES\n1 100" }, { "input": "2\n1\n1", "output": "NO" }, { "input": "2\n100\n100", "output": "NO" }, { "input": "14\n43\n43\n43\n43\n43\n43\n43\n43\n43\n43\n43\n43\n43\n43", "output": "NO" }, { "input": "100\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n14\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32\n32", "output": "YES\n14 32" }, { "input": "2\n50\n100", "output": "YES\n50 100" }, { "input": "2\n99\n100", "output": "YES\n99 100" }, { "input": "4\n4\n4\n5\n5", "output": "YES\n4 5" }, { "input": "10\n10\n10\n10\n10\n10\n23\n23\n23\n23\n23", "output": "YES\n10 23" }, { "input": "20\n34\n34\n34\n34\n34\n34\n34\n34\n34\n34\n11\n11\n11\n11\n11\n11\n11\n11\n11\n11", "output": "YES\n11 34" }, { "input": "40\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n20\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30\n30", "output": "YES\n20 30" }, { "input": "58\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1", "output": "YES\n1 100" }, { "input": "98\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99\n99", "output": "YES\n2 99" }, { "input": "100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100", "output": "YES\n1 100" }, { "input": "100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2\n2", "output": "YES\n1 2" }, { "input": "100\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n49\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12", "output": "YES\n12 49" }, { "input": "100\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n15\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94\n94", "output": "YES\n15 94" }, { "input": "100\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42\n42", "output": "YES\n33 42" }, { "input": "100\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n16\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35\n35", "output": "YES\n16 35" }, { "input": "100\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n33\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44\n44", "output": "YES\n33 44" }, { "input": "100\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n54\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98\n98", "output": "YES\n54 98" }, { "input": "100\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n81\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12", "output": "YES\n12 81" }, { "input": "100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100", "output": "NO" }, { "input": "100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1", "output": "NO" }, { "input": "40\n20\n20\n30\n30\n20\n20\n20\n30\n30\n20\n20\n30\n30\n30\n30\n20\n30\n30\n30\n30\n20\n20\n30\n30\n30\n20\n30\n20\n30\n20\n30\n20\n20\n20\n30\n20\n20\n20\n30\n30", "output": "NO" }, { "input": "58\n100\n100\n100\n100\n100\n1\n1\n1\n1\n1\n1\n100\n100\n1\n100\n1\n100\n100\n1\n1\n100\n100\n1\n100\n1\n100\n100\n1\n1\n100\n1\n1\n1\n100\n1\n1\n1\n1\n100\n1\n100\n100\n100\n100\n100\n1\n1\n100\n100\n100\n100\n1\n100\n1\n1\n1\n1\n1", "output": "NO" }, { "input": "98\n2\n99\n99\n99\n99\n2\n99\n99\n99\n2\n2\n99\n2\n2\n2\n2\n99\n99\n2\n99\n2\n2\n99\n99\n99\n99\n2\n2\n99\n2\n99\n99\n2\n2\n99\n2\n99\n2\n99\n2\n2\n2\n99\n2\n2\n2\n2\n99\n99\n99\n99\n2\n2\n2\n2\n2\n2\n2\n2\n99\n2\n99\n99\n2\n2\n99\n99\n99\n99\n99\n99\n99\n99\n2\n99\n2\n99\n2\n2\n2\n99\n99\n99\n99\n99\n99\n2\n99\n99\n2\n2\n2\n2\n2\n99\n99\n99\n2", "output": "NO" }, { "input": "100\n100\n1\n100\n1\n1\n100\n1\n1\n1\n100\n100\n1\n100\n1\n100\n100\n1\n1\n1\n100\n1\n100\n1\n100\n100\n1\n100\n1\n100\n1\n1\n1\n1\n1\n100\n1\n100\n100\n100\n1\n100\n100\n1\n100\n1\n1\n100\n100\n100\n1\n100\n100\n1\n1\n100\n100\n1\n100\n1\n100\n1\n1\n100\n100\n100\n100\n100\n100\n1\n100\n100\n1\n100\n100\n1\n100\n1\n1\n1\n100\n100\n1\n100\n1\n100\n1\n1\n1\n1\n100\n1\n1\n100\n1\n100\n100\n1\n100\n1\n100", "output": "NO" }, { "input": "100\n100\n100\n100\n1\n100\n1\n1\n1\n100\n1\n1\n1\n1\n100\n1\n100\n1\n100\n1\n100\n100\n100\n1\n100\n1\n1\n1\n100\n1\n1\n1\n1\n1\n100\n100\n1\n100\n1\n1\n100\n1\n1\n100\n1\n100\n100\n100\n1\n100\n100\n100\n1\n100\n1\n100\n100\n100\n1\n1\n100\n100\n100\n100\n1\n100\n36\n100\n1\n100\n1\n100\n100\n100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n100\n1\n1\n100\n100\n100\n100\n100\n1\n100\n1\n100\n1\n1\n100\n100\n1\n100", "output": "NO" }, { "input": "100\n2\n1\n1\n2\n2\n1\n1\n1\n1\n2\n1\n1\n1\n2\n2\n2\n1\n1\n1\n2\n1\n2\n2\n2\n2\n1\n1\n2\n1\n1\n2\n1\n27\n1\n1\n1\n2\n2\n2\n1\n2\n1\n2\n1\n1\n2\n2\n2\n2\n2\n2\n2\n2\n1\n2\n2\n2\n2\n1\n2\n1\n1\n1\n1\n1\n2\n1\n1\n1\n2\n2\n2\n2\n2\n2\n1\n1\n1\n1\n2\n2\n1\n2\n2\n1\n1\n1\n2\n1\n2\n2\n1\n1\n2\n1\n1\n1\n2\n2\n1", "output": "NO" }, { "input": "100\n99\n99\n100\n99\n99\n100\n100\n100\n99\n100\n99\n99\n100\n99\n99\n99\n99\n99\n99\n100\n100\n100\n99\n100\n100\n99\n100\n99\n100\n100\n99\n100\n99\n99\n99\n100\n99\n10\n99\n100\n100\n100\n99\n100\n100\n100\n100\n100\n100\n100\n99\n100\n100\n100\n99\n99\n100\n99\n100\n99\n100\n100\n99\n99\n99\n99\n100\n99\n100\n100\n100\n100\n100\n100\n99\n99\n100\n100\n99\n99\n99\n99\n99\n99\n100\n99\n99\n100\n100\n99\n100\n99\n99\n100\n99\n99\n99\n99\n100\n100", "output": "NO" }, { "input": "100\n29\n43\n43\n29\n43\n29\n29\n29\n43\n29\n29\n29\n29\n43\n29\n29\n29\n29\n43\n29\n29\n29\n43\n29\n29\n29\n43\n43\n43\n43\n43\n43\n29\n29\n43\n43\n43\n29\n43\n43\n43\n29\n29\n29\n43\n29\n29\n29\n43\n43\n43\n43\n29\n29\n29\n29\n43\n29\n43\n43\n29\n29\n43\n43\n29\n29\n95\n29\n29\n29\n43\n43\n29\n29\n29\n29\n29\n43\n43\n43\n43\n29\n29\n43\n43\n43\n43\n43\n43\n29\n43\n43\n43\n43\n43\n43\n29\n43\n29\n43", "output": "NO" }, { "input": "100\n98\n98\n98\n88\n88\n88\n88\n98\n98\n88\n98\n88\n98\n88\n88\n88\n88\n88\n98\n98\n88\n98\n98\n98\n88\n88\n88\n98\n98\n88\n88\n88\n98\n88\n98\n88\n98\n88\n88\n98\n98\n98\n88\n88\n98\n98\n88\n88\n88\n88\n88\n98\n98\n98\n88\n98\n88\n88\n98\n98\n88\n98\n88\n88\n98\n88\n88\n98\n27\n88\n88\n88\n98\n98\n88\n88\n98\n98\n98\n98\n98\n88\n98\n88\n98\n98\n98\n98\n88\n88\n98\n88\n98\n88\n98\n98\n88\n98\n98\n88", "output": "NO" }, { "input": "100\n50\n1\n1\n50\n50\n50\n50\n1\n50\n100\n50\n50\n50\n100\n1\n100\n1\n100\n50\n50\n50\n50\n50\n1\n50\n1\n100\n1\n1\n50\n100\n50\n50\n100\n50\n50\n100\n1\n50\n50\n100\n1\n1\n50\n1\n100\n50\n50\n100\n100\n1\n100\n1\n50\n100\n50\n50\n1\n1\n50\n100\n50\n100\n100\n100\n50\n50\n1\n1\n50\n100\n1\n50\n100\n100\n1\n50\n50\n50\n100\n50\n50\n100\n1\n50\n50\n50\n50\n1\n50\n50\n50\n50\n1\n50\n50\n100\n1\n50\n100", "output": "NO" }, { "input": "100\n45\n45\n45\n45\n45\n45\n44\n44\n44\n43\n45\n44\n44\n45\n44\n44\n45\n44\n43\n44\n43\n43\n43\n45\n43\n45\n44\n45\n43\n44\n45\n45\n45\n45\n45\n45\n45\n45\n43\n45\n43\n43\n45\n44\n45\n45\n45\n44\n45\n45\n45\n45\n45\n45\n44\n43\n45\n45\n43\n44\n45\n45\n45\n45\n44\n45\n45\n45\n43\n43\n44\n44\n43\n45\n43\n45\n45\n45\n44\n44\n43\n43\n44\n44\n44\n43\n45\n43\n44\n43\n45\n43\n43\n45\n45\n44\n45\n43\n43\n45", "output": "NO" }, { "input": "100\n12\n12\n97\n15\n97\n12\n15\n97\n12\n97\n12\n12\n97\n12\n15\n12\n12\n15\n12\n12\n97\n12\n12\n15\n15\n12\n97\n15\n12\n97\n15\n12\n12\n15\n15\n15\n97\n15\n97\n12\n12\n12\n12\n12\n97\n12\n97\n12\n15\n15\n12\n15\n12\n15\n12\n12\n12\n12\n12\n12\n12\n12\n97\n97\n12\n12\n97\n12\n97\n97\n15\n97\n12\n97\n97\n12\n12\n12\n97\n97\n15\n12\n12\n15\n12\n15\n97\n97\n12\n15\n12\n12\n97\n12\n15\n15\n15\n15\n12\n12", "output": "NO" }, { "input": "12\n2\n3\n1\n3\n3\n1\n2\n1\n2\n1\n3\n2", "output": "NO" }, { "input": "48\n99\n98\n100\n100\n99\n100\n99\n100\n100\n98\n99\n98\n98\n99\n98\n99\n98\n100\n100\n98\n100\n98\n99\n100\n98\n99\n98\n99\n99\n100\n98\n99\n99\n98\n100\n99\n98\n99\n98\n100\n100\n100\n99\n98\n99\n98\n100\n100", "output": "NO" }, { "input": "4\n1\n3\n3\n3", "output": "NO" }, { "input": "6\n1\n1\n1\n1\n2\n2", "output": "NO" }, { "input": "4\n1\n1\n1\n2", "output": "NO" }, { "input": "4\n1\n2\n2\n2", "output": "NO" }, { "input": "4\n1\n2\n3\n4", "output": "NO" }, { "input": "8\n1\n1\n2\n2\n3\n3\n4\n4", "output": "NO" }, { "input": "4\n1\n3\n2\n4", "output": "NO" }, { "input": "4\n10\n10\n10\n20", "output": "NO" }, { "input": "4\n11\n12\n13\n13", "output": "NO" }, { "input": "4\n1\n1\n1\n3", "output": "NO" }, { "input": "6\n1\n1\n2\n2\n2\n2", "output": "NO" }, { "input": "10\n1\n1\n2\n2\n2\n3\n3\n4\n4\n4", "output": "NO" } ]
1,642,747,843
2,147,483,647
PyPy 3
OK
TESTS
54
93
0
n = int(input()) data = [int(input()) for _ in range(n)] if len(set(data)) == 2: if len(data) / 2 == data.count(data[0]): print("YES") print(*list(set(data))) else: print("NO") else: print("NO")
Title: Fair Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petya and Vasya decided to play a game. They have *n* cards (*n* is an even number). A single integer is written on each card. Before the game Petya will choose an integer and after that Vasya will choose another integer (different from the number that Petya chose). During the game each player takes all the cards with number he chose. For example, if Petya chose number 5 before the game he will take all cards on which 5 is written and if Vasya chose number 10 before the game he will take all cards on which 10 is written. The game is considered fair if Petya and Vasya can take all *n* cards, and the number of cards each player gets is the same. Determine whether Petya and Vasya can choose integer numbers before the game so that the game is fair. Input Specification: The first line contains a single integer *n* (2<=≤<=*n*<=≤<=100) — number of cards. It is guaranteed that *n* is an even number. The following *n* lines contain a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (one integer per line, 1<=≤<=*a**i*<=≤<=100) — numbers written on the *n* cards. Output Specification: If it is impossible for Petya and Vasya to choose numbers in such a way that the game will be fair, print "NO" (without quotes) in the first line. In this case you should not print anything more. In the other case print "YES" (without quotes) in the first line. In the second line print two distinct integers — number that Petya should choose and the number that Vasya should choose to make the game fair. If there are several solutions, print any of them. Demo Input: ['4\n11\n27\n27\n11\n', '2\n6\n6\n', '6\n10\n20\n30\n20\n10\n20\n', '6\n1\n1\n2\n2\n3\n3\n'] Demo Output: ['YES\n11 27\n', 'NO\n', 'NO\n', 'NO\n'] Note: In the first example the game will be fair if, for example, Petya chooses number 11, and Vasya chooses number 27. Then the will take all cards — Petya will take cards 1 and 4, and Vasya will take cards 2 and 3. Thus, each of them will take exactly two cards. In the second example fair game is impossible because the numbers written on the cards are equal, but the numbers that Petya and Vasya should choose should be distinct. In the third example it is impossible to take all cards. Petya and Vasya can take at most five cards — for example, Petya can choose number 10 and Vasya can choose number 20. But for the game to be fair it is necessary to take 6 cards.
```python n = int(input()) data = [int(input()) for _ in range(n)] if len(set(data)) == 2: if len(data) / 2 == data.count(data[0]): print("YES") print(*list(set(data))) else: print("NO") else: print("NO") ```
3
624
A
Save Luke
PROGRAMMING
800
[ "math" ]
null
null
Luke Skywalker got locked up in a rubbish shredder between two presses. R2D2 is already working on his rescue, but Luke needs to stay alive as long as possible. For simplicity we will assume that everything happens on a straight line, the presses are initially at coordinates 0 and *L*, and they move towards each other with speed *v*1 and *v*2, respectively. Luke has width *d* and is able to choose any position between the presses. Luke dies as soon as the distance between the presses is less than his width. Your task is to determine for how long Luke can stay alive.
The first line of the input contains four integers *d*, *L*, *v*1, *v*2 (1<=≤<=*d*,<=*L*,<=*v*1,<=*v*2<=≤<=10<=000,<=*d*<=&lt;<=*L*) — Luke's width, the initial position of the second press and the speed of the first and second presses, respectively.
Print a single real value — the maximum period of time Luke can stay alive for. Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6. Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if .
[ "2 6 2 2\n", "1 9 1 2\n" ]
[ "1.00000000000000000000\n", "2.66666666666666650000\n" ]
In the first sample Luke should stay exactly in the middle of the segment, that is at coordinates [2;4], as the presses move with the same speed. In the second sample he needs to occupy the position <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/71395c777960eaded59a9fdc428a9625f152605b.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In this case both presses move to his edges at the same time.
500
[ { "input": "2 6 2 2", "output": "1.00000000000000000000" }, { "input": "1 9 1 2", "output": "2.66666666666666650000" }, { "input": "1 10000 1 1", "output": "4999.50000000000000000000" }, { "input": "9999 10000 10000 10000", "output": "0.00005000000000000000" }, { "input": "1023 2340 1029 3021", "output": "0.32518518518518519000" }, { "input": "2173 2176 10000 9989", "output": "0.00015008254539996998" }, { "input": "1 2 123 1", "output": "0.00806451612903225780" }, { "input": "123 1242 12 312", "output": "3.45370370370370370000" }, { "input": "2 9997 3 12", "output": "666.33333333333337000000" }, { "input": "1 10000 10000 10000", "output": "0.49995000000000001000" }, { "input": "3274 4728 888 4578", "output": "0.26600804976216613000" }, { "input": "4600 9696 5634 8248", "output": "0.36709407866301685000" }, { "input": "2255 7902 8891 429", "output": "0.60590128755364803000" }, { "input": "6745 9881 2149 9907", "output": "0.26011944260119441000" }, { "input": "4400 8021 6895 2089", "output": "0.40304986642920748000" }, { "input": "5726 9082 7448 3054", "output": "0.31955817939440107000" }, { "input": "3381 9769 4898 2532", "output": "0.85975773889636609000" }, { "input": "1036 6259 5451 4713", "output": "0.51387249114521838000" }, { "input": "5526 6455 197 4191", "output": "0.21171376481312670000" }, { "input": "1196 4082 4071 9971", "output": "0.20552627830793335000" }, { "input": "8850 9921 8816 9449", "output": "0.05863673692855187600" }, { "input": "3341 7299 2074 8927", "output": "0.35978547404781386000" }, { "input": "7831 8609 6820 2596", "output": "0.08262531860662701600" }, { "input": "2322 7212 77 4778", "output": "1.00720906282183310000" }, { "input": "9976 9996 4823 4255", "output": "0.00220312844238819110" }, { "input": "7631 9769 5377 6437", "output": "0.18097172845776197000" }, { "input": "8957 9525 8634 107", "output": "0.06498112344125385500" }, { "input": "6612 9565 3380 2288", "output": "0.52099505998588569000" }, { "input": "1103 6256 3934 9062", "output": "0.39650661742074483000" }, { "input": "1854 3280 1481 2140", "output": "0.39381386357359843000" } ]
1,632,858,727
2,147,483,647
PyPy 3
OK
TESTS
30
93
20,172,800
d, l, v1, v2 = map(int, input().split()) distance = l - d time = v1 + v2 ans = distance / time print("%.10f" % ans)
Title: Save Luke Time Limit: None seconds Memory Limit: None megabytes Problem Description: Luke Skywalker got locked up in a rubbish shredder between two presses. R2D2 is already working on his rescue, but Luke needs to stay alive as long as possible. For simplicity we will assume that everything happens on a straight line, the presses are initially at coordinates 0 and *L*, and they move towards each other with speed *v*1 and *v*2, respectively. Luke has width *d* and is able to choose any position between the presses. Luke dies as soon as the distance between the presses is less than his width. Your task is to determine for how long Luke can stay alive. Input Specification: The first line of the input contains four integers *d*, *L*, *v*1, *v*2 (1<=≤<=*d*,<=*L*,<=*v*1,<=*v*2<=≤<=10<=000,<=*d*<=&lt;<=*L*) — Luke's width, the initial position of the second press and the speed of the first and second presses, respectively. Output Specification: Print a single real value — the maximum period of time Luke can stay alive for. Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6. Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if . Demo Input: ['2 6 2 2\n', '1 9 1 2\n'] Demo Output: ['1.00000000000000000000\n', '2.66666666666666650000\n'] Note: In the first sample Luke should stay exactly in the middle of the segment, that is at coordinates [2;4], as the presses move with the same speed. In the second sample he needs to occupy the position <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/71395c777960eaded59a9fdc428a9625f152605b.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In this case both presses move to his edges at the same time.
```python d, l, v1, v2 = map(int, input().split()) distance = l - d time = v1 + v2 ans = distance / time print("%.10f" % ans) ```
3
52
A
123-sequence
PROGRAMMING
900
[ "implementation" ]
A. 123-sequence
2
256
There is a given sequence of integers *a*1,<=*a*2,<=...,<=*a**n*, where every number is from 1 to 3 inclusively. You have to replace the minimum number of numbers in it so that all the numbers in the sequence are equal to each other.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=106). The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=3).
Print the minimum number of replacements needed to be performed to make all the numbers in the sequence equal.
[ "9\n1 3 2 2 2 1 1 2 3\n" ]
[ "5\n" ]
In the example all the numbers equal to 1 and 3 should be replaced by 2.
500
[ { "input": "9\n1 3 2 2 2 1 1 2 3", "output": "5" }, { "input": "6\n3 3 2 2 1 3", "output": "3" }, { "input": "12\n3 1 3 1 2 1 3 2 2 1 2 1", "output": "7" }, { "input": "15\n3 2 1 1 1 1 3 2 2 3 3 1 2 3 2", "output": "10" }, { "input": "2\n2 1", "output": "1" }, { "input": "2\n3 2", "output": "1" }, { "input": "2\n3 1", "output": "1" }, { "input": "18\n2 3 2 1 2 3 2 1 2 3 3 3 1 2 3 3 3 2", "output": "10" }, { "input": "30\n2 1 3 2 3 2 2 2 2 3 2 2 3 2 1 1 3 1 3 2 1 2 3 1 1 3 3 1 3 1", "output": "19" }, { "input": "1\n1", "output": "0" }, { "input": "1\n2", "output": "0" }, { "input": "1\n3", "output": "0" } ]
1,599,910,445
2,147,483,647
Python 3
OK
TESTS
23
1,310
14,848,000
def calculate(list1): ones=0 twos=0 threes=0 for i in list1: if i==1: ones=ones+1 elif i==2: twos= twos+1 else: threes += 1 if (ones>twos and ones> threes): return 1 elif (twos>ones and twos>threes): return 2 elif (threes>ones and threes>twos): return 3 elif (ones==threes): return 3 elif (twos==threes): return 2 elif(ones==twos): return 1 N=int(input()) numbers=[] replacements=0 numbers =list(map(int, input().split()[:N])) most= calculate(numbers) for i in range(N): if numbers[i]!= most: numbers[i] = most replacements+=1 print(replacements)
Title: 123-sequence Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: There is a given sequence of integers *a*1,<=*a*2,<=...,<=*a**n*, where every number is from 1 to 3 inclusively. You have to replace the minimum number of numbers in it so that all the numbers in the sequence are equal to each other. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=106). The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=3). Output Specification: Print the minimum number of replacements needed to be performed to make all the numbers in the sequence equal. Demo Input: ['9\n1 3 2 2 2 1 1 2 3\n'] Demo Output: ['5\n'] Note: In the example all the numbers equal to 1 and 3 should be replaced by 2.
```python def calculate(list1): ones=0 twos=0 threes=0 for i in list1: if i==1: ones=ones+1 elif i==2: twos= twos+1 else: threes += 1 if (ones>twos and ones> threes): return 1 elif (twos>ones and twos>threes): return 2 elif (threes>ones and threes>twos): return 3 elif (ones==threes): return 3 elif (twos==threes): return 2 elif(ones==twos): return 1 N=int(input()) numbers=[] replacements=0 numbers =list(map(int, input().split()[:N])) most= calculate(numbers) for i in range(N): if numbers[i]!= most: numbers[i] = most replacements+=1 print(replacements) ```
3.644843
987
A
Infinity Gauntlet
PROGRAMMING
800
[ "implementation" ]
null
null
You took a peek on Thanos wearing Infinity Gauntlet. In the Gauntlet there is a place for six Infinity Gems: - the Power Gem of purple color, - the Time Gem of green color, - the Space Gem of blue color, - the Soul Gem of orange color, - the Reality Gem of red color, - the Mind Gem of yellow color. Using colors of Gems you saw in the Gauntlet determine the names of absent Gems.
In the first line of input there is one integer $n$ ($0 \le n \le 6$) — the number of Gems in Infinity Gauntlet. In next $n$ lines there are colors of Gems you saw. Words used for colors are: purple, green, blue, orange, red, yellow. It is guaranteed that all the colors are distinct. All colors are given in lowercase English letters.
In the first line output one integer $m$ ($0 \le m \le 6$) — the number of absent Gems. Then in $m$ lines print the names of absent Gems, each on its own line. Words used for names are: Power, Time, Space, Soul, Reality, Mind. Names can be printed in any order. Keep the first letter uppercase, others lowercase.
[ "4\nred\npurple\nyellow\norange\n", "0\n" ]
[ "2\nSpace\nTime\n", "6\nTime\nMind\nSoul\nPower\nReality\nSpace\n" ]
In the first sample Thanos already has Reality, Power, Mind and Soul Gems, so he needs two more: Time and Space. In the second sample Thanos doesn't have any Gems, so he needs all six.
500
[ { "input": "4\nred\npurple\nyellow\norange", "output": "2\nSpace\nTime" }, { "input": "0", "output": "6\nMind\nSpace\nPower\nTime\nReality\nSoul" }, { "input": "6\npurple\nblue\nyellow\nred\ngreen\norange", "output": "0" }, { "input": "1\npurple", "output": "5\nTime\nReality\nSoul\nSpace\nMind" }, { "input": "3\nblue\norange\npurple", "output": "3\nTime\nReality\nMind" }, { "input": "2\nyellow\nred", "output": "4\nPower\nSoul\nSpace\nTime" }, { "input": "1\ngreen", "output": "5\nReality\nSpace\nPower\nSoul\nMind" }, { "input": "2\npurple\ngreen", "output": "4\nReality\nMind\nSpace\nSoul" }, { "input": "1\nblue", "output": "5\nPower\nReality\nSoul\nTime\nMind" }, { "input": "2\npurple\nblue", "output": "4\nMind\nSoul\nTime\nReality" }, { "input": "2\ngreen\nblue", "output": "4\nReality\nMind\nPower\nSoul" }, { "input": "3\npurple\ngreen\nblue", "output": "3\nMind\nReality\nSoul" }, { "input": "1\norange", "output": "5\nReality\nTime\nPower\nSpace\nMind" }, { "input": "2\npurple\norange", "output": "4\nReality\nMind\nTime\nSpace" }, { "input": "2\norange\ngreen", "output": "4\nSpace\nMind\nReality\nPower" }, { "input": "3\norange\npurple\ngreen", "output": "3\nReality\nSpace\nMind" }, { "input": "2\norange\nblue", "output": "4\nTime\nMind\nReality\nPower" }, { "input": "3\nblue\ngreen\norange", "output": "3\nPower\nMind\nReality" }, { "input": "4\nblue\norange\ngreen\npurple", "output": "2\nMind\nReality" }, { "input": "1\nred", "output": "5\nTime\nSoul\nMind\nPower\nSpace" }, { "input": "2\nred\npurple", "output": "4\nMind\nSpace\nTime\nSoul" }, { "input": "2\nred\ngreen", "output": "4\nMind\nSpace\nPower\nSoul" }, { "input": "3\nred\npurple\ngreen", "output": "3\nSoul\nSpace\nMind" }, { "input": "2\nblue\nred", "output": "4\nMind\nTime\nPower\nSoul" }, { "input": "3\nred\nblue\npurple", "output": "3\nTime\nMind\nSoul" }, { "input": "3\nred\nblue\ngreen", "output": "3\nSoul\nPower\nMind" }, { "input": "4\npurple\nblue\ngreen\nred", "output": "2\nMind\nSoul" }, { "input": "2\norange\nred", "output": "4\nPower\nMind\nTime\nSpace" }, { "input": "3\nred\norange\npurple", "output": "3\nMind\nSpace\nTime" }, { "input": "3\nred\norange\ngreen", "output": "3\nMind\nSpace\nPower" }, { "input": "4\nred\norange\ngreen\npurple", "output": "2\nSpace\nMind" }, { "input": "3\nblue\norange\nred", "output": "3\nPower\nMind\nTime" }, { "input": "4\norange\nblue\npurple\nred", "output": "2\nTime\nMind" }, { "input": "4\ngreen\norange\nred\nblue", "output": "2\nMind\nPower" }, { "input": "5\npurple\norange\nblue\nred\ngreen", "output": "1\nMind" }, { "input": "1\nyellow", "output": "5\nPower\nSoul\nReality\nSpace\nTime" }, { "input": "2\npurple\nyellow", "output": "4\nTime\nReality\nSpace\nSoul" }, { "input": "2\ngreen\nyellow", "output": "4\nSpace\nReality\nPower\nSoul" }, { "input": "3\npurple\nyellow\ngreen", "output": "3\nSoul\nReality\nSpace" }, { "input": "2\nblue\nyellow", "output": "4\nTime\nReality\nPower\nSoul" }, { "input": "3\nyellow\nblue\npurple", "output": "3\nSoul\nReality\nTime" }, { "input": "3\ngreen\nyellow\nblue", "output": "3\nSoul\nReality\nPower" }, { "input": "4\nyellow\nblue\ngreen\npurple", "output": "2\nReality\nSoul" }, { "input": "2\nyellow\norange", "output": "4\nTime\nSpace\nReality\nPower" }, { "input": "3\nyellow\npurple\norange", "output": "3\nSpace\nReality\nTime" }, { "input": "3\norange\nyellow\ngreen", "output": "3\nSpace\nReality\nPower" }, { "input": "4\ngreen\nyellow\norange\npurple", "output": "2\nSpace\nReality" }, { "input": "3\nyellow\nblue\norange", "output": "3\nTime\nReality\nPower" }, { "input": "4\norange\npurple\nblue\nyellow", "output": "2\nReality\nTime" }, { "input": "4\nblue\norange\nyellow\ngreen", "output": "2\nReality\nPower" }, { "input": "5\ngreen\nyellow\norange\nblue\npurple", "output": "1\nReality" }, { "input": "3\nyellow\npurple\nred", "output": "3\nTime\nSoul\nSpace" }, { "input": "3\nred\ngreen\nyellow", "output": "3\nPower\nSoul\nSpace" }, { "input": "4\nred\npurple\ngreen\nyellow", "output": "2\nSpace\nSoul" }, { "input": "3\nred\nyellow\nblue", "output": "3\nPower\nSoul\nTime" }, { "input": "4\nblue\nyellow\nred\npurple", "output": "2\nTime\nSoul" }, { "input": "4\nblue\nyellow\nred\ngreen", "output": "2\nSoul\nPower" }, { "input": "5\nred\nyellow\ngreen\nblue\npurple", "output": "1\nSoul" }, { "input": "3\nred\nyellow\norange", "output": "3\nPower\nSpace\nTime" }, { "input": "4\norange\ngreen\nyellow\nred", "output": "2\nPower\nSpace" }, { "input": "5\norange\nred\ngreen\nyellow\npurple", "output": "1\nSpace" }, { "input": "4\nyellow\nred\norange\nblue", "output": "2\nTime\nPower" }, { "input": "5\npurple\nblue\norange\nyellow\nred", "output": "1\nTime" }, { "input": "5\norange\nblue\nyellow\nred\ngreen", "output": "1\nPower" } ]
1,613,539,246
2,147,483,647
PyPy 3
OK
TESTS
64
108
0
n= int(input()) i=0 l=[] while(i<n): s=input() l.append(s) i=i+1 d={'red':'Reality','blue':'Space', 'yellow':'Mind','orange':'Soul','green':'Time' ,'purple':'Power'} l1 = [] for k,v in d.items(): h=0 for j in l: if k==j: h=h+1 if h==0: l1.append(v) print(len(l1)) for i in l1: print(i)
Title: Infinity Gauntlet Time Limit: None seconds Memory Limit: None megabytes Problem Description: You took a peek on Thanos wearing Infinity Gauntlet. In the Gauntlet there is a place for six Infinity Gems: - the Power Gem of purple color, - the Time Gem of green color, - the Space Gem of blue color, - the Soul Gem of orange color, - the Reality Gem of red color, - the Mind Gem of yellow color. Using colors of Gems you saw in the Gauntlet determine the names of absent Gems. Input Specification: In the first line of input there is one integer $n$ ($0 \le n \le 6$) — the number of Gems in Infinity Gauntlet. In next $n$ lines there are colors of Gems you saw. Words used for colors are: purple, green, blue, orange, red, yellow. It is guaranteed that all the colors are distinct. All colors are given in lowercase English letters. Output Specification: In the first line output one integer $m$ ($0 \le m \le 6$) — the number of absent Gems. Then in $m$ lines print the names of absent Gems, each on its own line. Words used for names are: Power, Time, Space, Soul, Reality, Mind. Names can be printed in any order. Keep the first letter uppercase, others lowercase. Demo Input: ['4\nred\npurple\nyellow\norange\n', '0\n'] Demo Output: ['2\nSpace\nTime\n', '6\nTime\nMind\nSoul\nPower\nReality\nSpace\n'] Note: In the first sample Thanos already has Reality, Power, Mind and Soul Gems, so he needs two more: Time and Space. In the second sample Thanos doesn't have any Gems, so he needs all six.
```python n= int(input()) i=0 l=[] while(i<n): s=input() l.append(s) i=i+1 d={'red':'Reality','blue':'Space', 'yellow':'Mind','orange':'Soul','green':'Time' ,'purple':'Power'} l1 = [] for k,v in d.items(): h=0 for j in l: if k==j: h=h+1 if h==0: l1.append(v) print(len(l1)) for i in l1: print(i) ```
3
285
A
Slightly Decreasing Permutations
PROGRAMMING
1,100
[ "greedy", "implementation" ]
null
null
Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*. The decreasing coefficient of permutation *p*1,<=*p*2,<=...,<=*p**n* is the number of such *i* (1<=≤<=*i*<=&lt;<=*n*), that *p**i*<=&gt;<=*p**i*<=+<=1. You have numbers *n* and *k*. Your task is to print the permutation of length *n* with decreasing coefficient *k*.
The single line contains two space-separated integers: *n*,<=*k* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*k*<=&lt;<=*n*) — the permutation length and the decreasing coefficient.
In a single line print *n* space-separated integers: *p*1,<=*p*2,<=...,<=*p**n* — the permutation of length *n* with decreasing coefficient *k*. If there are several permutations that meet this condition, print any of them. It is guaranteed that the permutation with the sought parameters exists.
[ "5 2\n", "3 0\n", "3 2\n" ]
[ "1 5 2 4 3\n", "1 2 3\n", "3 2 1\n" ]
none
500
[ { "input": "5 2", "output": "1 5 2 4 3" }, { "input": "3 0", "output": "1 2 3" }, { "input": "3 2", "output": "3 2 1" }, { "input": "1 0", "output": "1" }, { "input": "2 0", "output": "1 2" }, { "input": "2 1", "output": "2 1" }, { "input": "10 4", "output": "10 9 8 7 1 2 3 4 5 6" }, { "input": "56893 5084", "output": "56893 56892 56891 56890 56889 56888 56887 56886 56885 56884 56883 56882 56881 56880 56879 56878 56877 56876 56875 56874 56873 56872 56871 56870 56869 56868 56867 56866 56865 56864 56863 56862 56861 56860 56859 56858 56857 56856 56855 56854 56853 56852 56851 56850 56849 56848 56847 56846 56845 56844 56843 56842 56841 56840 56839 56838 56837 56836 56835 56834 56833 56832 56831 56830 56829 56828 56827 56826 56825 56824 56823 56822 56821 56820 56819 56818 56817 56816 56815 56814 56813 56812 56811 56810 56809 5..." }, { "input": "6 3", "output": "6 5 4 1 2 3" }, { "input": "1 0", "output": "1" }, { "input": "310 186", "output": "310 309 308 307 306 305 304 303 302 301 300 299 298 297 296 295 294 293 292 291 290 289 288 287 286 285 284 283 282 281 280 279 278 277 276 275 274 273 272 271 270 269 268 267 266 265 264 263 262 261 260 259 258 257 256 255 254 253 252 251 250 249 248 247 246 245 244 243 242 241 240 239 238 237 236 235 234 233 232 231 230 229 228 227 226 225 224 223 222 221 220 219 218 217 216 215 214 213 212 211 210 209 208 207 206 205 204 203 202 201 200 199 198 197 196 195 194 193 192 191 190 189 188 187 186 185 184 183..." }, { "input": "726 450", "output": "726 725 724 723 722 721 720 719 718 717 716 715 714 713 712 711 710 709 708 707 706 705 704 703 702 701 700 699 698 697 696 695 694 693 692 691 690 689 688 687 686 685 684 683 682 681 680 679 678 677 676 675 674 673 672 671 670 669 668 667 666 665 664 663 662 661 660 659 658 657 656 655 654 653 652 651 650 649 648 647 646 645 644 643 642 641 640 639 638 637 636 635 634 633 632 631 630 629 628 627 626 625 624 623 622 621 620 619 618 617 616 615 614 613 612 611 610 609 608 607 606 605 604 603 602 601 600 599..." }, { "input": "438 418", "output": "438 437 436 435 434 433 432 431 430 429 428 427 426 425 424 423 422 421 420 419 418 417 416 415 414 413 412 411 410 409 408 407 406 405 404 403 402 401 400 399 398 397 396 395 394 393 392 391 390 389 388 387 386 385 384 383 382 381 380 379 378 377 376 375 374 373 372 371 370 369 368 367 366 365 364 363 362 361 360 359 358 357 356 355 354 353 352 351 350 349 348 347 346 345 344 343 342 341 340 339 338 337 336 335 334 333 332 331 330 329 328 327 326 325 324 323 322 321 320 319 318 317 316 315 314 313 312 311..." }, { "input": "854 829", "output": "854 853 852 851 850 849 848 847 846 845 844 843 842 841 840 839 838 837 836 835 834 833 832 831 830 829 828 827 826 825 824 823 822 821 820 819 818 817 816 815 814 813 812 811 810 809 808 807 806 805 804 803 802 801 800 799 798 797 796 795 794 793 792 791 790 789 788 787 786 785 784 783 782 781 780 779 778 777 776 775 774 773 772 771 770 769 768 767 766 765 764 763 762 761 760 759 758 757 756 755 754 753 752 751 750 749 748 747 746 745 744 743 742 741 740 739 738 737 736 735 734 733 732 731 730 729 728 727..." }, { "input": "214 167", "output": "214 213 212 211 210 209 208 207 206 205 204 203 202 201 200 199 198 197 196 195 194 193 192 191 190 189 188 187 186 185 184 183 182 181 180 179 178 177 176 175 174 173 172 171 170 169 168 167 166 165 164 163 162 161 160 159 158 157 156 155 154 153 152 151 150 149 148 147 146 145 144 143 142 141 140 139 138 137 136 135 134 133 132 131 130 129 128 127 126 125 124 123 122 121 120 119 118 117 116 115 114 113 112 111 110 109 108 107 106 105 104 103 102 101 100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 ..." }, { "input": "85705 56268", "output": "85705 85704 85703 85702 85701 85700 85699 85698 85697 85696 85695 85694 85693 85692 85691 85690 85689 85688 85687 85686 85685 85684 85683 85682 85681 85680 85679 85678 85677 85676 85675 85674 85673 85672 85671 85670 85669 85668 85667 85666 85665 85664 85663 85662 85661 85660 85659 85658 85657 85656 85655 85654 85653 85652 85651 85650 85649 85648 85647 85646 85645 85644 85643 85642 85641 85640 85639 85638 85637 85636 85635 85634 85633 85632 85631 85630 85629 85628 85627 85626 85625 85624 85623 85622 85621 8..." }, { "input": "11417 4583", "output": "11417 11416 11415 11414 11413 11412 11411 11410 11409 11408 11407 11406 11405 11404 11403 11402 11401 11400 11399 11398 11397 11396 11395 11394 11393 11392 11391 11390 11389 11388 11387 11386 11385 11384 11383 11382 11381 11380 11379 11378 11377 11376 11375 11374 11373 11372 11371 11370 11369 11368 11367 11366 11365 11364 11363 11362 11361 11360 11359 11358 11357 11356 11355 11354 11353 11352 11351 11350 11349 11348 11347 11346 11345 11344 11343 11342 11341 11340 11339 11338 11337 11336 11335 11334 11333 1..." }, { "input": "53481 20593", "output": "53481 53480 53479 53478 53477 53476 53475 53474 53473 53472 53471 53470 53469 53468 53467 53466 53465 53464 53463 53462 53461 53460 53459 53458 53457 53456 53455 53454 53453 53452 53451 53450 53449 53448 53447 53446 53445 53444 53443 53442 53441 53440 53439 53438 53437 53436 53435 53434 53433 53432 53431 53430 53429 53428 53427 53426 53425 53424 53423 53422 53421 53420 53419 53418 53417 53416 53415 53414 53413 53412 53411 53410 53409 53408 53407 53406 53405 53404 53403 53402 53401 53400 53399 53398 53397 5..." }, { "input": "79193 77281", "output": "79193 79192 79191 79190 79189 79188 79187 79186 79185 79184 79183 79182 79181 79180 79179 79178 79177 79176 79175 79174 79173 79172 79171 79170 79169 79168 79167 79166 79165 79164 79163 79162 79161 79160 79159 79158 79157 79156 79155 79154 79153 79152 79151 79150 79149 79148 79147 79146 79145 79144 79143 79142 79141 79140 79139 79138 79137 79136 79135 79134 79133 79132 79131 79130 79129 79128 79127 79126 79125 79124 79123 79122 79121 79120 79119 79118 79117 79116 79115 79114 79113 79112 79111 79110 79109 7..." }, { "input": "42607 42144", "output": "42607 42606 42605 42604 42603 42602 42601 42600 42599 42598 42597 42596 42595 42594 42593 42592 42591 42590 42589 42588 42587 42586 42585 42584 42583 42582 42581 42580 42579 42578 42577 42576 42575 42574 42573 42572 42571 42570 42569 42568 42567 42566 42565 42564 42563 42562 42561 42560 42559 42558 42557 42556 42555 42554 42553 42552 42551 42550 42549 42548 42547 42546 42545 42544 42543 42542 42541 42540 42539 42538 42537 42536 42535 42534 42533 42532 42531 42530 42529 42528 42527 42526 42525 42524 42523 4..." }, { "input": "100000 0", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "100000 99999", "output": "100000 99999 99998 99997 99996 99995 99994 99993 99992 99991 99990 99989 99988 99987 99986 99985 99984 99983 99982 99981 99980 99979 99978 99977 99976 99975 99974 99973 99972 99971 99970 99969 99968 99967 99966 99965 99964 99963 99962 99961 99960 99959 99958 99957 99956 99955 99954 99953 99952 99951 99950 99949 99948 99947 99946 99945 99944 99943 99942 99941 99940 99939 99938 99937 99936 99935 99934 99933 99932 99931 99930 99929 99928 99927 99926 99925 99924 99923 99922 99921 99920 99919 99918 99917 99916 ..." }, { "input": "100000 53860", "output": "100000 99999 99998 99997 99996 99995 99994 99993 99992 99991 99990 99989 99988 99987 99986 99985 99984 99983 99982 99981 99980 99979 99978 99977 99976 99975 99974 99973 99972 99971 99970 99969 99968 99967 99966 99965 99964 99963 99962 99961 99960 99959 99958 99957 99956 99955 99954 99953 99952 99951 99950 99949 99948 99947 99946 99945 99944 99943 99942 99941 99940 99939 99938 99937 99936 99935 99934 99933 99932 99931 99930 99929 99928 99927 99926 99925 99924 99923 99922 99921 99920 99919 99918 99917 99916 ..." }, { "input": "4 0", "output": "1 2 3 4" }, { "input": "4 1", "output": "4 1 2 3" }, { "input": "4 2", "output": "4 3 1 2" }, { "input": "4 3", "output": "4 3 2 1" }, { "input": "3 1", "output": "3 1 2" } ]
1,547,468,346
2,147,483,647
Python 3
OK
TESTS
28
280
7,475,200
n, k = map(int, input().split()) R = [] for i in range(1, n - k): R.append(i) for i in range(n, n - k - 1, -1): R.append(i) print(" ".join(map(str, R)))
Title: Slightly Decreasing Permutations Time Limit: None seconds Memory Limit: None megabytes Problem Description: Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*. The decreasing coefficient of permutation *p*1,<=*p*2,<=...,<=*p**n* is the number of such *i* (1<=≤<=*i*<=&lt;<=*n*), that *p**i*<=&gt;<=*p**i*<=+<=1. You have numbers *n* and *k*. Your task is to print the permutation of length *n* with decreasing coefficient *k*. Input Specification: The single line contains two space-separated integers: *n*,<=*k* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*k*<=&lt;<=*n*) — the permutation length and the decreasing coefficient. Output Specification: In a single line print *n* space-separated integers: *p*1,<=*p*2,<=...,<=*p**n* — the permutation of length *n* with decreasing coefficient *k*. If there are several permutations that meet this condition, print any of them. It is guaranteed that the permutation with the sought parameters exists. Demo Input: ['5 2\n', '3 0\n', '3 2\n'] Demo Output: ['1 5 2 4 3\n', '1 2 3\n', '3 2 1\n'] Note: none
```python n, k = map(int, input().split()) R = [] for i in range(1, n - k): R.append(i) for i in range(n, n - k - 1, -1): R.append(i) print(" ".join(map(str, R))) ```
3
897
A
Scarborough Fair
PROGRAMMING
800
[ "implementation" ]
null
null
Parsley, sage, rosemary and thyme. Remember me to one who lives there. He once was the true love of mine. Willem is taking the girl to the highest building in island No.28, however, neither of them knows how to get there. Willem asks his friend, Grick for directions, Grick helped them, and gave them a task. Although the girl wants to help, Willem insists on doing it by himself. Grick gave Willem a string of length *n*. Willem needs to do *m* operations, each operation has four parameters *l*,<=*r*,<=*c*1,<=*c*2, which means that all symbols *c*1 in range [*l*,<=*r*] (from *l*-th to *r*-th, including *l* and *r*) are changed into *c*2. String is 1-indexed. Grick wants to know the final string after all the *m* operations.
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100). The second line contains a string *s* of length *n*, consisting of lowercase English letters. Each of the next *m* lines contains four parameters *l*,<=*r*,<=*c*1,<=*c*2 (1<=≤<=*l*<=≤<=*r*<=≤<=*n*, *c*1,<=*c*2 are lowercase English letters), separated by space.
Output string *s* after performing *m* operations described above.
[ "3 1\nioi\n1 1 i n\n", "5 3\nwxhak\n3 3 h x\n1 5 x a\n1 3 w g\n" ]
[ "noi", "gaaak" ]
For the second example: After the first operation, the string is wxxak. After the second operation, the string is waaak. After the third operation, the string is gaaak.
500
[ { "input": "3 1\nioi\n1 1 i n", "output": "noi" }, { "input": "5 3\nwxhak\n3 3 h x\n1 5 x a\n1 3 w g", "output": "gaaak" }, { "input": "9 51\nbhfbdcgff\n2 3 b b\n2 8 e f\n3 8 g f\n5 7 d a\n1 5 e b\n3 4 g b\n6 7 c d\n3 6 e g\n3 6 e h\n5 6 a e\n7 9 a c\n4 9 a h\n3 7 c b\n6 9 b g\n1 7 h b\n4 5 a e\n3 9 f a\n1 2 c h\n4 8 a c\n3 5 e d\n3 4 g f\n2 3 d h\n2 3 d e\n1 7 d g\n2 6 e g\n2 3 d g\n5 5 h h\n2 8 g d\n8 9 a f\n5 9 c e\n1 7 f d\n1 6 e e\n5 7 c a\n8 9 b b\n2 6 e b\n6 6 g h\n1 2 b b\n1 5 a f\n5 8 f h\n1 5 e g\n3 9 f h\n6 8 g a\n4 6 h g\n1 5 f a\n5 6 a c\n4 8 e d\n1 4 d g\n7 8 b f\n5 6 h b\n3 9 c e\n1 9 b a", "output": "aahaddddh" }, { "input": "28 45\ndcbbaddjhbeefjadjchgkhgggfha\n10 25 c a\n13 19 a f\n12 28 e d\n12 27 e a\n9 20 b e\n7 17 g d\n22 26 j j\n8 16 c g\n14 16 a d\n3 10 f c\n10 26 d b\n8 17 i e\n10 19 d i\n6 21 c j\n7 22 b k\n17 19 a i\n4 18 j k\n8 25 a g\n10 27 j e\n9 18 g d\n16 23 h a\n17 26 k e\n8 16 h f\n1 15 d f\n22 28 k k\n11 20 c k\n6 11 b h\n17 17 e i\n15 22 g h\n8 18 c f\n4 16 e a\n8 25 b c\n6 24 d g\n5 9 f j\n12 19 i h\n4 25 e f\n15 25 c j\n15 27 e e\n11 20 b f\n19 27 e k\n2 21 d a\n9 27 k e\n14 24 b a\n3 6 i g\n2 26 k f", "output": "fcbbajjfjaaefefehfahfagggfha" }, { "input": "87 5\nnfinedeojadjmgafnaogekfjkjfncnliagfchjfcmellgigjjcaaoeakdolchjcecljdeblmheimkibkgdkcdml\n47 56 a k\n51 81 o d\n5 11 j h\n48 62 j d\n16 30 k m", "output": "nfinedeohadjmgafnaogemfjmjfncnliagfchjfcmellgigddckkdekkddlchdcecljdeblmheimkibkgdkcdml" }, { "input": "5 16\nacfbb\n1 2 e f\n2 5 a f\n2 3 b e\n4 4 f a\n2 3 f a\n1 2 b e\n4 5 c d\n2 4 e c\n1 4 e a\n1 3 d c\n3 5 e b\n3 5 e b\n2 2 e d\n1 3 e c\n3 3 a e\n1 5 a a", "output": "acebb" }, { "input": "94 13\nbcaaaaaaccacddcdaacbdaabbcbaddbccbccbbbddbadddcccbddadddaadbdababadaacdcdbcdadabdcdcbcbcbcbbcd\n52 77 d d\n21 92 d b\n45 48 c b\n20 25 d a\n57 88 d b\n3 91 b d\n64 73 a a\n5 83 b d\n2 69 c c\n28 89 a b\n49 67 c b\n41 62 a c\n49 87 b c", "output": "bcaaaaaaccacddcdaacddaaddcdbdddccdccddddddbdddddcdddcdddccdddcdcdcdcccdcddcdcdcddcdcdcdcdcdbcd" }, { "input": "67 39\nacbcbccccbabaabcabcaaaaaaccbcbbcbaaaacbbcccbcbabbcacccbbabbabbabaac\n4 36 a b\n25 38 a a\n3 44 b c\n35 57 b a\n4 8 a c\n20 67 c a\n30 66 b b\n27 40 a a\n2 56 a b\n10 47 c a\n22 65 c b\n29 42 a b\n1 46 c b\n57 64 b c\n20 29 b a\n14 51 c a\n12 55 b b\n20 20 a c\n2 57 c a\n22 60 c b\n16 51 c c\n31 64 a c\n17 30 c a\n23 36 c c\n28 67 a c\n37 40 a c\n37 50 b c\n29 48 c b\n2 34 b c\n21 53 b a\n26 63 a c\n23 28 c a\n51 56 c b\n32 61 b b\n64 67 b b\n21 67 b c\n8 53 c c\n40 62 b b\n32 38 c c", "output": "accccccccaaaaaaaaaaaaaaaaaaaccccccccccccccccccccccccccccccccccccccc" }, { "input": "53 33\nhhcbhfafeececbhadfbdbehdfacfchbhdbfebdfeghebfcgdhehfh\n27 41 h g\n18 35 c b\n15 46 h f\n48 53 e g\n30 41 b c\n12 30 b f\n10 37 e f\n18 43 a h\n10 52 d a\n22 48 c e\n40 53 f d\n7 12 b h\n12 51 f a\n3 53 g a\n19 41 d h\n22 29 b h\n2 30 a b\n26 28 e h\n25 35 f a\n19 31 h h\n44 44 d e\n19 22 e c\n29 44 d h\n25 33 d h\n3 53 g c\n18 44 h b\n19 28 f e\n3 22 g h\n8 17 c a\n37 51 d d\n3 28 e h\n27 50 h h\n27 46 f b", "output": "hhcbhfbfhfababbbbbbbbbbbbbbbbbeaaeaaeaaeabebdeaahahdh" }, { "input": "83 10\nfhbecdgadecabbbecedcgfdcefcbgechbedagecgdgfgdaahchdgchbeaedgafdefecdchceececfcdhcdh\n9 77 e e\n26 34 b g\n34 70 b a\n40 64 e g\n33 78 h f\n14 26 a a\n17 70 d g\n56 65 a c\n8 41 d c\n11 82 c b", "output": "fhbecdgacebabbbebegbgfgbefbggebhgegagebgggfggaafbfggbfagbgggbfggfebgbfbeebebfbdhbdh" }, { "input": "1 4\ne\n1 1 c e\n1 1 e a\n1 1 e c\n1 1 d a", "output": "a" }, { "input": "71 21\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\n61 61 a a\n32 56 a a\n10 67 a a\n7 32 a a\n26 66 a a\n41 55 a a\n49 55 a a\n4 61 a a\n53 59 a a\n37 58 a a\n7 63 a a\n39 40 a a\n51 64 a a\n27 37 a a\n22 71 a a\n4 45 a a\n7 8 a a\n43 46 a a\n19 28 a a\n51 54 a a\n14 67 a a", "output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa" }, { "input": "30 4\neaaddabedcbbcccddbabdecadcecce\n2 17 c a\n16 29 e e\n16 21 c b\n7 11 b c", "output": "eaaddacedacbaaaddbabdecadcecce" }, { "input": "48 30\naaaabaabbaababbbaabaabaababbabbbaabbbaabaaaaaaba\n3 45 a b\n1 14 a a\n15 32 a b\n37 47 a b\n9 35 a b\n36 39 b b\n6 26 a b\n36 44 a a\n28 44 b a\n29 31 b a\n20 39 a a\n45 45 a b\n21 32 b b\n7 43 a b\n14 48 a b\n14 33 a b\n39 44 a a\n9 36 b b\n4 23 b b\n9 42 b b\n41 41 b a\n30 47 a b\n8 42 b a\n14 38 b b\n3 15 a a\n35 47 b b\n14 34 a b\n38 43 a b\n1 35 b a\n16 28 b a", "output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbb" }, { "input": "89 29\nbabaabaaabaaaababbbbbbbabbbaaaaababbaababababbababaaabbababaaabbbbaaabaaaaaabaaabaabbabab\n39 70 b b\n3 56 b b\n5 22 b a\n4 39 a b\n41 87 b b\n34 41 a a\n10 86 a b\n29 75 a b\n2 68 a a\n27 28 b b\n42 51 b a\n18 61 a a\n6 67 b a\n47 63 a a\n8 68 a b\n4 74 b a\n19 65 a b\n8 55 a b\n5 30 a a\n3 65 a b\n16 57 a b\n34 56 b a\n1 70 a b\n59 68 b b\n29 57 b a\n47 49 b b\n49 73 a a\n32 61 b b\n29 42 a a", "output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbaaaabbbbbbbbbbbbbab" }, { "input": "59 14\nfbebcfabdefbaaedcefdeecababcabebadfbccaaedaebfdaefdbbcbebbe\n5 32 e f\n8 46 e e\n31 43 e f\n3 10 e a\n53 54 f d\n55 59 d a\n39 58 e b\n54 56 f a\n9 40 b e\n28 37 d a\n7 35 e b\n7 56 c f\n23 26 e a\n15 44 e d", "output": "fbabcfabdffbaafdfffdfffababfabfbaafdffaafdabbfdabfdbbfbbbbe" }, { "input": "7 17\nbbaabab\n3 5 a b\n5 7 a a\n5 5 a a\n4 4 b a\n7 7 a a\n5 6 b b\n1 3 b a\n6 7 a b\n4 6 a b\n6 6 a a\n2 4 b a\n1 7 b a\n4 6 b b\n2 5 b b\n2 5 a b\n1 4 a a\n4 4 b a", "output": "abbabaa" }, { "input": "100 1\ndebaaagbfdgehagadabfgheegggfghghgeeeabgceffeffggcbcegfgebbdhebhfagcgadcbdbabddbcadgbgdebdfehceehcaef\n13 99 f c", "output": "debaaagbfdgehagadabcgheegggcghghgeeeabgcecceccggcbcegcgebbdhebhcagcgadcbdbabddbcadgbgdebdcehceehcaef" }, { "input": "1 1\na\n1 1 a b", "output": "b" }, { "input": "100 1\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\n1 100 a b", "output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb" }, { "input": "2 2\naa\n1 2 a b\n1 2 b c", "output": "cc" }, { "input": "3 3\naaa\n1 3 a b\n1 3 b c\n1 3 c d", "output": "ddd" }, { "input": "2 2\naa\n2 2 a b\n1 1 a b", "output": "bb" } ]
1,678,157,808
2,147,483,647
Python 3
OK
TESTS
47
62
0
n, m = map(int, input(). split()) s = list(input()) for i in range(m): l, r, c1, c2 = map(str, input(). split()) l, r = int(l), int(r) for j in range(l - 1, r): if s[j] == c1: s[j] = c2 for l in s: print(l, end = '')
Title: Scarborough Fair Time Limit: None seconds Memory Limit: None megabytes Problem Description: Parsley, sage, rosemary and thyme. Remember me to one who lives there. He once was the true love of mine. Willem is taking the girl to the highest building in island No.28, however, neither of them knows how to get there. Willem asks his friend, Grick for directions, Grick helped them, and gave them a task. Although the girl wants to help, Willem insists on doing it by himself. Grick gave Willem a string of length *n*. Willem needs to do *m* operations, each operation has four parameters *l*,<=*r*,<=*c*1,<=*c*2, which means that all symbols *c*1 in range [*l*,<=*r*] (from *l*-th to *r*-th, including *l* and *r*) are changed into *c*2. String is 1-indexed. Grick wants to know the final string after all the *m* operations. Input Specification: The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100). The second line contains a string *s* of length *n*, consisting of lowercase English letters. Each of the next *m* lines contains four parameters *l*,<=*r*,<=*c*1,<=*c*2 (1<=≤<=*l*<=≤<=*r*<=≤<=*n*, *c*1,<=*c*2 are lowercase English letters), separated by space. Output Specification: Output string *s* after performing *m* operations described above. Demo Input: ['3 1\nioi\n1 1 i n\n', '5 3\nwxhak\n3 3 h x\n1 5 x a\n1 3 w g\n'] Demo Output: ['noi', 'gaaak'] Note: For the second example: After the first operation, the string is wxxak. After the second operation, the string is waaak. After the third operation, the string is gaaak.
```python n, m = map(int, input(). split()) s = list(input()) for i in range(m): l, r, c1, c2 = map(str, input(). split()) l, r = int(l), int(r) for j in range(l - 1, r): if s[j] == c1: s[j] = c2 for l in s: print(l, end = '') ```
3
621
A
Wet Shark and Odd and Even
PROGRAMMING
900
[ "implementation" ]
null
null
Today, Wet Shark is given *n* integers. Using any of these integers no more than once, Wet Shark wants to get maximum possible even (divisible by 2) sum. Please, calculate this value for Wet Shark. Note, that if Wet Shark uses no integers from the *n* integers, the sum is an even integer 0.
The first line of the input contains one integer, *n* (1<=≤<=*n*<=≤<=100<=000). The next line contains *n* space separated integers given to Wet Shark. Each of these integers is in range from 1 to 109, inclusive.
Print the maximum possible even sum that can be obtained if we use some of the given integers.
[ "3\n1 2 3\n", "5\n999999999 999999999 999999999 999999999 999999999\n" ]
[ "6", "3999999996" ]
In the first sample, we can simply take all three integers for a total sum of 6. In the second sample Wet Shark should take any four out of five integers 999 999 999.
500
[ { "input": "3\n1 2 3", "output": "6" }, { "input": "5\n999999999 999999999 999999999 999999999 999999999", "output": "3999999996" }, { "input": "1\n1", "output": "0" }, { "input": "15\n39 52 88 78 46 95 84 98 55 3 68 42 6 18 98", "output": "870" }, { "input": "15\n59 96 34 48 8 72 67 90 15 85 7 90 97 47 25", "output": "840" }, { "input": "15\n87 37 91 29 58 45 51 74 70 71 47 38 91 89 44", "output": "922" }, { "input": "15\n11 81 49 7 11 14 30 67 29 50 90 81 77 18 59", "output": "674" }, { "input": "15\n39 21 95 89 73 90 9 55 85 32 30 21 68 59 82", "output": "848" }, { "input": "15\n59 70 48 54 26 67 84 39 40 18 77 69 70 88 93", "output": "902" }, { "input": "15\n87 22 98 32 88 36 72 31 100 97 17 16 60 22 20", "output": "798" }, { "input": "15\n15 63 51 13 37 9 43 19 55 79 57 60 50 59 31", "output": "632" }, { "input": "1\n4", "output": "4" }, { "input": "2\n1 4", "output": "4" }, { "input": "3\n1 2 4", "output": "6" }, { "input": "2\n9 3", "output": "12" }, { "input": "2\n1000000000 1001", "output": "1000000000" }, { "input": "3\n1 8 4", "output": "12" }, { "input": "3\n7 4 4", "output": "8" }, { "input": "5\n2 3 4 5 3", "output": "14" }, { "input": "2\n4 5", "output": "4" }, { "input": "3\n2 4 5", "output": "6" }, { "input": "3\n2 2 3", "output": "4" }, { "input": "2\n2 3", "output": "2" }, { "input": "4\n2 3 7 7", "output": "16" }, { "input": "2\n999999999 2", "output": "2" }, { "input": "2\n2 5", "output": "2" }, { "input": "3\n5 3 1", "output": "8" }, { "input": "4\n3 2 5 7", "output": "14" } ]
1,514,893,376
2,147,483,647
Python 3
OK
TESTS
87
140
13,926,400
n=int(input()) l=list(map(int,input().split())) odd=[] for j in l: if j%2!=0: odd.append(j) jam=0 for i in l: jam=jam+i if jam%2==0: print(jam) else: while jam%2!=0: jam=jam-min(odd) print(jam)
Title: Wet Shark and Odd and Even Time Limit: None seconds Memory Limit: None megabytes Problem Description: Today, Wet Shark is given *n* integers. Using any of these integers no more than once, Wet Shark wants to get maximum possible even (divisible by 2) sum. Please, calculate this value for Wet Shark. Note, that if Wet Shark uses no integers from the *n* integers, the sum is an even integer 0. Input Specification: The first line of the input contains one integer, *n* (1<=≤<=*n*<=≤<=100<=000). The next line contains *n* space separated integers given to Wet Shark. Each of these integers is in range from 1 to 109, inclusive. Output Specification: Print the maximum possible even sum that can be obtained if we use some of the given integers. Demo Input: ['3\n1 2 3\n', '5\n999999999 999999999 999999999 999999999 999999999\n'] Demo Output: ['6', '3999999996'] Note: In the first sample, we can simply take all three integers for a total sum of 6. In the second sample Wet Shark should take any four out of five integers 999 999 999.
```python n=int(input()) l=list(map(int,input().split())) odd=[] for j in l: if j%2!=0: odd.append(j) jam=0 for i in l: jam=jam+i if jam%2==0: print(jam) else: while jam%2!=0: jam=jam-min(odd) print(jam) ```
3
846
B
Math Show
PROGRAMMING
1,800
[ "brute force", "greedy" ]
null
null
Polycarp takes part in a math show. He is given *n* tasks, each consists of *k* subtasks, numbered 1 through *k*. It takes him *t**j* minutes to solve the *j*-th subtask of any task. Thus, time required to solve a subtask depends only on its index, but not on the task itself. Polycarp can solve subtasks in any order. By solving subtask of arbitrary problem he earns one point. Thus, the number of points for task is equal to the number of solved subtasks in it. Moreover, if Polycarp completely solves the task (solves all *k* of its subtasks), he recieves one extra point. Thus, total number of points he recieves for the complete solution of the task is *k*<=+<=1. Polycarp has *M* minutes of time. What is the maximum number of points he can earn?
The first line contains three integer numbers *n*, *k* and *M* (1<=≤<=*n*<=≤<=45, 1<=≤<=*k*<=≤<=45, 0<=≤<=*M*<=≤<=2·109). The second line contains *k* integer numbers, values *t**j* (1<=≤<=*t**j*<=≤<=1000000), where *t**j* is the time in minutes required to solve *j*-th subtask of any task.
Print the maximum amount of points Polycarp can earn in *M* minutes.
[ "3 4 11\n1 2 3 4\n", "5 5 10\n1 2 4 8 16\n" ]
[ "6\n", "7\n" ]
In the first example Polycarp can complete the first task and spend 1 + 2 + 3 + 4 = 10 minutes. He also has the time to solve one subtask of the second task in one minute. In the second example Polycarp can solve the first subtask of all five tasks and spend 5·1 = 5 minutes. Also he can solve the second subtasks of two tasks and spend 2·2 = 4 minutes. Thus, he earns 5 + 2 = 7 points in total.
0
[ { "input": "3 4 11\n1 2 3 4", "output": "6" }, { "input": "5 5 10\n1 2 4 8 16", "output": "7" }, { "input": "1 1 0\n2", "output": "0" }, { "input": "1 1 1\n1", "output": "2" }, { "input": "2 1 0\n2", "output": "0" }, { "input": "2 2 2\n2 3", "output": "1" }, { "input": "4 2 15\n1 4", "output": "9" }, { "input": "24 42 126319796\n318996 157487 174813 189765 259136 406743 138997 377982 244813 16862 95438 346702 454882 274633 67361 387756 61951 448901 427272 288847 316578 416035 56608 211390 187241 191538 299856 294995 442139 95784 410894 439744 455044 301002 196932 352004 343622 73438 325186 295727 21130 32856", "output": "677" }, { "input": "5 3 10\n1 3 6", "output": "6" }, { "input": "5 3 50\n1 3 6", "output": "20" }, { "input": "5 3 2000000000\n1 3 6", "output": "20" }, { "input": "5 3 49\n1 3 6", "output": "18" }, { "input": "3 4 16\n1 2 3 4", "output": "9" }, { "input": "11 2 20\n1 9", "output": "13" }, { "input": "11 3 38\n1 9 9", "output": "15" }, { "input": "5 3 11\n1 1 2", "output": "11" }, { "input": "5 4 36\n1 3 7 7", "output": "13" }, { "input": "1 13 878179\n103865 43598 180009 528483 409585 449955 368163 381135 713512 645876 241515 20336 572091", "output": "5" }, { "input": "1 9 262522\n500878 36121 420012 341288 139726 362770 462113 261122 394426", "output": "2" }, { "input": "45 32 252252766\n282963 74899 446159 159106 469932 288063 297289 501442 241341 240108 470371 316076 159136 72720 37365 108455 82789 529789 303825 392553 153053 389577 327929 277446 505280 494678 159006 505007 328366 460640 18354 313300", "output": "1094" }, { "input": "44 41 93891122\n447 314862 48587 198466 73450 166523 247421 50078 14115 229926 11070 53089 73041 156924 200782 53225 290967 219349 119034 88726 255048 59778 287298 152539 55104 170525 135722 111341 279873 168400 267489 157697 188015 94306 231121 304553 27684 46144 127122 166022 150941", "output": "1084" }, { "input": "12 45 2290987\n50912 189025 5162 252398 298767 154151 164139 185891 121047 227693 93549 284244 312843 313833 285436 131672 135248 324541 194905 205729 241315 32044 131902 305884 263 27717 173077 81428 285684 66470 220938 282471 234921 316283 30485 244283 170631 224579 72899 87066 6727 161661 40556 89162 314616", "output": "95" }, { "input": "42 9 4354122\n47443 52983 104606 84278 5720 55971 100555 90845 91972", "output": "124" }, { "input": "45 28 33631968\n5905 17124 64898 40912 75855 53868 27056 18284 63975 51975 27182 94373 52477 260 87551 50223 73798 77430 17510 15226 6269 43301 39592 27043 15546 60047 83400 63983", "output": "979" }, { "input": "18 3 36895\n877 2054 4051", "output": "28" }, { "input": "13 30 357\n427 117 52 140 162 58 5 149 438 327 103 357 202 1 148 238 442 200 438 97 414 301 224 166 254 322 378 422 90 312", "output": "31" }, { "input": "44 11 136\n77 38 12 71 81 15 66 47 29 22 71", "output": "11" }, { "input": "32 6 635\n3 4 2 1 7 7", "output": "195" }, { "input": "30 19 420\n2 2 1 2 2 1 1 2 1 2 2 2 1 2 2 2 2 1 2", "output": "309" }, { "input": "37 40 116\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "118" }, { "input": "7 37 133\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "136" }, { "input": "40 1 8\n3", "output": "4" }, { "input": "1 28 1\n3 3 2 2 1 1 3 1 1 2 2 1 1 3 3 1 1 1 1 1 3 1 3 3 3 2 2 3", "output": "1" }, { "input": "12 1 710092\n145588", "output": "8" }, { "input": "1 7 47793\n72277 45271 85507 39251 45440 101022 105165", "output": "1" }, { "input": "1 1 0\n4", "output": "0" }, { "input": "1 2 3\n2 2", "output": "1" }, { "input": "1 1 0\n5", "output": "0" }, { "input": "1 1 3\n5", "output": "0" }, { "input": "1 3 0\n6 3 4", "output": "0" }, { "input": "1 2 0\n1 2", "output": "0" }, { "input": "1 1 3\n5", "output": "0" }, { "input": "1 1 0\n5", "output": "0" }, { "input": "2 2 3\n7 2", "output": "1" }, { "input": "2 4 5\n1 2 8 6", "output": "3" }, { "input": "2 1 0\n3", "output": "0" }, { "input": "1 3 3\n16 4 5", "output": "0" }, { "input": "2 1 0\n1", "output": "0" }, { "input": "3 2 2\n6 1", "output": "2" }, { "input": "3 2 1\n1 1", "output": "1" }, { "input": "1 3 19\n12 15 6", "output": "2" }, { "input": "2 2 8\n12 1", "output": "2" }, { "input": "1 6 14\n15 2 6 13 14 4", "output": "3" }, { "input": "4 1 0\n1", "output": "0" }, { "input": "1 1 0\n2", "output": "0" }, { "input": "1 1 0\n2", "output": "0" }, { "input": "2 2 5\n5 6", "output": "1" }, { "input": "1 3 8\n5 4 4", "output": "2" }, { "input": "1 5 44\n2 19 18 6 8", "output": "4" }, { "input": "1 1 0\n4", "output": "0" }, { "input": "3 2 7\n5 1", "output": "4" }, { "input": "4 2 9\n8 6", "output": "1" }, { "input": "4 3 3\n6 12 7", "output": "0" }, { "input": "4 1 2\n1", "output": "4" }, { "input": "2 4 15\n8 3 7 8", "output": "3" }, { "input": "6 1 2\n4", "output": "0" }, { "input": "2 1 1\n1", "output": "2" }, { "input": "1 1 2\n3", "output": "0" }, { "input": "2 2 2\n1 4", "output": "2" }, { "input": "6 2 78\n12 10", "output": "10" }, { "input": "1 3 10\n17 22 15", "output": "0" }, { "input": "6 3 13\n1 2 3", "output": "10" }, { "input": "21 3 26\n1 2 3", "output": "24" }, { "input": "3 7 20012\n1 1 1 1 1 1 10000", "output": "20" }, { "input": "5 4 40\n4 2 3 3", "output": "17" }, { "input": "4 5 40\n4 1 3 2 4", "output": "18" }, { "input": "3 5 22\n1 1 4 1 1", "output": "16" }, { "input": "5 2 17\n3 4", "output": "7" }, { "input": "5 4 32\n4 2 1 1", "output": "21" }, { "input": "5 5 34\n4 1 1 2 4", "output": "20" }, { "input": "3 3 15\n1 2 1", "output": "12" }, { "input": "3 2 11\n1 2", "output": "9" }, { "input": "5 4 11\n2 1 3 4", "output": "8" }, { "input": "45 45 2000000000\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "2070" } ]
1,505,223,578
2,147,483,647
Python 3
OK
TESTS
84
62
716,800
n,k,m = list(map(int,input().split())) t = list(map(int,input().split())) t.sort() s = sum(t) mmm = 0 for i in range(n+1): if i*s > m : break tm = m-i*s c = k*i+i for j in range(k): c+=min(tm//t[j],n-i) tm-=min(tm//t[j],n-i)*t[j] mmm = max(mmm,c) print(mmm)
Title: Math Show Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarp takes part in a math show. He is given *n* tasks, each consists of *k* subtasks, numbered 1 through *k*. It takes him *t**j* minutes to solve the *j*-th subtask of any task. Thus, time required to solve a subtask depends only on its index, but not on the task itself. Polycarp can solve subtasks in any order. By solving subtask of arbitrary problem he earns one point. Thus, the number of points for task is equal to the number of solved subtasks in it. Moreover, if Polycarp completely solves the task (solves all *k* of its subtasks), he recieves one extra point. Thus, total number of points he recieves for the complete solution of the task is *k*<=+<=1. Polycarp has *M* minutes of time. What is the maximum number of points he can earn? Input Specification: The first line contains three integer numbers *n*, *k* and *M* (1<=≤<=*n*<=≤<=45, 1<=≤<=*k*<=≤<=45, 0<=≤<=*M*<=≤<=2·109). The second line contains *k* integer numbers, values *t**j* (1<=≤<=*t**j*<=≤<=1000000), where *t**j* is the time in minutes required to solve *j*-th subtask of any task. Output Specification: Print the maximum amount of points Polycarp can earn in *M* minutes. Demo Input: ['3 4 11\n1 2 3 4\n', '5 5 10\n1 2 4 8 16\n'] Demo Output: ['6\n', '7\n'] Note: In the first example Polycarp can complete the first task and spend 1 + 2 + 3 + 4 = 10 minutes. He also has the time to solve one subtask of the second task in one minute. In the second example Polycarp can solve the first subtask of all five tasks and spend 5·1 = 5 minutes. Also he can solve the second subtasks of two tasks and spend 2·2 = 4 minutes. Thus, he earns 5 + 2 = 7 points in total.
```python n,k,m = list(map(int,input().split())) t = list(map(int,input().split())) t.sort() s = sum(t) mmm = 0 for i in range(n+1): if i*s > m : break tm = m-i*s c = k*i+i for j in range(k): c+=min(tm//t[j],n-i) tm-=min(tm//t[j],n-i)*t[j] mmm = max(mmm,c) print(mmm) ```
3
0
none
none
none
0
[ "none" ]
null
null
Something happened in Uzhlyandia again... There are riots on the streets... Famous Uzhlyandian superheroes Shean the Sheep and Stas the Giraffe were called in order to save the situation. Upon the arriving, they found that citizens are worried about maximum values of the Main Uzhlyandian Function *f*, which is defined as follows: In the above formula, 1<=≤<=*l*<=&lt;<=*r*<=≤<=*n* must hold, where *n* is the size of the Main Uzhlyandian Array *a*, and |*x*| means absolute value of *x*. But the heroes skipped their math lessons in school, so they asked you for help. Help them calculate the maximum value of *f* among all possible values of *l* and *r* for the given array *a*.
The first line contains single integer *n* (2<=≤<=*n*<=≤<=105) — the size of the array *a*. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (-109<=≤<=*a**i*<=≤<=109) — the array elements.
Print the only integer — the maximum value of *f*.
[ "5\n1 4 2 3 1\n", "4\n1 5 4 7\n" ]
[ "3", "6" ]
In the first sample case, the optimal value of *f* is reached on intervals [1, 2] and [2, 5]. In the second case maximal value of *f* is reachable only on the whole array.
0
[ { "input": "5\n1 4 2 3 1", "output": "3" }, { "input": "4\n1 5 4 7", "output": "6" }, { "input": "8\n16 14 12 10 8 100 50 0", "output": "92" }, { "input": "2\n1 1", "output": "0" }, { "input": "50\n-5 -9 0 44 -10 37 34 -49 11 -22 -26 44 8 -13 23 -46 34 12 -24 2 -40 -15 -28 38 -40 -42 -42 7 -43 5 2 -11 10 43 9 49 -13 36 2 24 46 50 -15 -26 -6 -6 8 4 -44 -3", "output": "208" }, { "input": "100\n23 64 60 -45 -36 -64 -59 15 -75 69 -30 -7 -20 17 -77 58 93 -76 -98 -22 -31 16 -50 6 -20 -85 1 64 -88 -8 -15 -6 -57 25 91 10 2 -90 74 -66 -42 73 28 49 -85 59 96 79 -25 49 -59 -89 -75 12 -96 -33 -65 -8 -100 -81 17 99 -91 -5 7 -21 1 85 63 86 -26 85 -31 11 -75 35 -82 15 98 93 -55 66 70 36 -38 8 92 -63 -5 60 -78 -7 -22 -1 4 54 36 16 32 -20", "output": "632" }, { "input": "3\n0 0 0", "output": "0" }, { "input": "3\n0 1 -1", "output": "2" }, { "input": "5\n1000000000 0 0 1000000000 -1000000000", "output": "2000000000" }, { "input": "2\n1000000000 -1000000000", "output": "2000000000" }, { "input": "4\n1000000000 0 0 -1000000000", "output": "2000000000" }, { "input": "4\n1 0 1 0", "output": "1" }, { "input": "5\n0 10 20 30 40", "output": "10" }, { "input": "2\n-1000000000 1000000000", "output": "2000000000" }, { "input": "2\n1 2", "output": "1" }, { "input": "9\n1000000000 0 0 1000000000 1000000000 0 0 1000000000 1000000000", "output": "4000000000" }, { "input": "16\n-1000000000 1000000000 1000000000 -1000000000 -1000000000 1000000000 1000000000 -1000000000 -1000000000 1000000000 1000000000 -1000000000 -1000000000 1000000000 1000000000 -1000000000", "output": "16000000000" }, { "input": "6\n1000000000 0 0 1000000000 1000000000 0", "output": "3000000000" }, { "input": "17\n1000000000 0 0 1000000000 1000000000 0 0 1000000000 1000000000 0 0 1000000000 1000000000 0 0 1000000000 1000000000", "output": "8000000000" }, { "input": "11\n1000000000 0 1 1000000000 999999999 1 0 1000000000 999999999 1 1000000000", "output": "4999999991" }, { "input": "4\n1000000000 -1000000000 -1000000000 1000000000", "output": "4000000000" }, { "input": "10\n1000000000 -1000000000 -1000000000 1000000000 1000000000 -1000000000 -1000000000 1000000000 1000000000 -1000000000", "output": "10000000000" } ]
1,490,810,193
6,693
PyPy 3
OK
TESTS
52
280
34,611,200
import sys def solve(): n = int(input()) a = [int(i) for i in input().split()] a_dif = [abs(a[i + 1] - a[i]) for i in range(n - 1)] a1 = [a_dif[i] * (-1)**i for i in range(n - 1)] md1 = 0 m1 = 0 v = 0 for i in range(n - 1): v += a1[i] if v < m1: m1 = v else: md1 = max(v - m1, md1) a2 = [a1[i]*(-1) for i in range(n -1)] md2 = 0 m2 = 0 v = 0 for i in range(n - 1): v += a2[i] if v < m2: m2 = v else: md2 = max(v - m2, md2) ans = max(md1, md2) print(ans) def debug(x, table): for name, val in table.items(): if x is val: print('DEBUG:{} -> {}'.format(name, val), file=sys.stderr) return None if __name__ == '__main__': solve()
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Something happened in Uzhlyandia again... There are riots on the streets... Famous Uzhlyandian superheroes Shean the Sheep and Stas the Giraffe were called in order to save the situation. Upon the arriving, they found that citizens are worried about maximum values of the Main Uzhlyandian Function *f*, which is defined as follows: In the above formula, 1<=≤<=*l*<=&lt;<=*r*<=≤<=*n* must hold, where *n* is the size of the Main Uzhlyandian Array *a*, and |*x*| means absolute value of *x*. But the heroes skipped their math lessons in school, so they asked you for help. Help them calculate the maximum value of *f* among all possible values of *l* and *r* for the given array *a*. Input Specification: The first line contains single integer *n* (2<=≤<=*n*<=≤<=105) — the size of the array *a*. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (-109<=≤<=*a**i*<=≤<=109) — the array elements. Output Specification: Print the only integer — the maximum value of *f*. Demo Input: ['5\n1 4 2 3 1\n', '4\n1 5 4 7\n'] Demo Output: ['3', '6'] Note: In the first sample case, the optimal value of *f* is reached on intervals [1, 2] and [2, 5]. In the second case maximal value of *f* is reachable only on the whole array.
```python import sys def solve(): n = int(input()) a = [int(i) for i in input().split()] a_dif = [abs(a[i + 1] - a[i]) for i in range(n - 1)] a1 = [a_dif[i] * (-1)**i for i in range(n - 1)] md1 = 0 m1 = 0 v = 0 for i in range(n - 1): v += a1[i] if v < m1: m1 = v else: md1 = max(v - m1, md1) a2 = [a1[i]*(-1) for i in range(n -1)] md2 = 0 m2 = 0 v = 0 for i in range(n - 1): v += a2[i] if v < m2: m2 = v else: md2 = max(v - m2, md2) ans = max(md1, md2) print(ans) def debug(x, table): for name, val in table.items(): if x is val: print('DEBUG:{} -> {}'.format(name, val), file=sys.stderr) return None if __name__ == '__main__': solve() ```
3
765
C
Table Tennis Game 2
PROGRAMMING
1,200
[ "math" ]
null
null
Misha and Vanya have played several table tennis sets. Each set consists of several serves, each serve is won by one of the players, he receives one point and the loser receives nothing. Once one of the players scores exactly *k* points, the score is reset and a new set begins. Across all the sets Misha scored *a* points in total, and Vanya scored *b* points. Given this information, determine the maximum number of sets they could have played, or that the situation is impossible. Note that the game consisted of several complete sets.
The first line contains three space-separated integers *k*, *a* and *b* (1<=≤<=*k*<=≤<=109, 0<=≤<=*a*,<=*b*<=≤<=109, *a*<=+<=*b*<=&gt;<=0).
If the situation is impossible, print a single number -1. Otherwise, print the maximum possible number of sets.
[ "11 11 5\n", "11 2 3\n" ]
[ "1\n", "-1\n" ]
Note that the rules of the game in this problem differ from the real table tennis game, for example, the rule of "balance" (the winning player has to be at least two points ahead to win a set) has no power within the present problem.
1,250
[ { "input": "11 11 5", "output": "1" }, { "input": "11 2 3", "output": "-1" }, { "input": "1 5 9", "output": "14" }, { "input": "2 3 3", "output": "2" }, { "input": "1 1000000000 1000000000", "output": "2000000000" }, { "input": "2 3 5", "output": "3" }, { "input": "1000000000 1000000000 1000000000", "output": "2" }, { "input": "1 0 1", "output": "1" }, { "input": "101 99 97", "output": "-1" }, { "input": "1000000000 0 1", "output": "-1" }, { "input": "137 137 136", "output": "1" }, { "input": "255 255 255", "output": "2" }, { "input": "1 0 1000000000", "output": "1000000000" }, { "input": "123 456 789", "output": "9" }, { "input": "666666 6666666 666665", "output": "-1" }, { "input": "1000000000 999999999 999999999", "output": "-1" }, { "input": "100000000 100000001 99999999", "output": "-1" }, { "input": "3 2 1000000000", "output": "-1" }, { "input": "999999999 1000000000 999999998", "output": "-1" }, { "input": "12938621 192872393 102739134", "output": "21" }, { "input": "666666666 1230983 666666666", "output": "1" }, { "input": "123456789 123456789 123456787", "output": "1" }, { "input": "5 6 0", "output": "-1" }, { "input": "11 0 12", "output": "-1" }, { "input": "2 11 0", "output": "-1" }, { "input": "2 1 0", "output": "-1" }, { "input": "10 11 12", "output": "2" }, { "input": "11 12 5", "output": "-1" }, { "input": "11 12 3", "output": "-1" }, { "input": "11 15 4", "output": "-1" }, { "input": "2 3 1", "output": "-1" }, { "input": "11 12 0", "output": "-1" }, { "input": "11 13 2", "output": "-1" }, { "input": "11 23 22", "output": "4" }, { "input": "10 21 0", "output": "-1" }, { "input": "11 23 1", "output": "-1" }, { "input": "11 10 12", "output": "-1" }, { "input": "11 1 12", "output": "-1" }, { "input": "11 5 12", "output": "-1" }, { "input": "11 8 12", "output": "-1" }, { "input": "11 12 1", "output": "-1" }, { "input": "5 4 6", "output": "-1" }, { "input": "10 1 22", "output": "-1" }, { "input": "2 3 0", "output": "-1" }, { "input": "11 23 2", "output": "-1" }, { "input": "2 1000000000 1000000000", "output": "1000000000" }, { "input": "11 0 15", "output": "-1" }, { "input": "11 5 0", "output": "-1" }, { "input": "11 5 15", "output": "-1" }, { "input": "10 0 13", "output": "-1" }, { "input": "4 7 0", "output": "-1" }, { "input": "10 2 8", "output": "-1" }, { "input": "11 5 22", "output": "2" }, { "input": "11 13 0", "output": "-1" }, { "input": "2 0 3", "output": "-1" }, { "input": "10 10 0", "output": "1" }, { "input": "10 11 10", "output": "2" }, { "input": "3 5 4", "output": "2" }, { "input": "11 22 3", "output": "2" }, { "input": "11 12 10", "output": "-1" }, { "input": "10 2 13", "output": "-1" }, { "input": "5 6 1", "output": "-1" }, { "input": "10 21 5", "output": "-1" }, { "input": "10 11 9", "output": "-1" }, { "input": "10 17 7", "output": "-1" }, { "input": "3 4 1", "output": "-1" }, { "input": "4 5 3", "output": "-1" }, { "input": "11 3 23", "output": "-1" }, { "input": "11 3 12", "output": "-1" }, { "input": "2 5 0", "output": "-1" }, { "input": "10 21 2", "output": "-1" }, { "input": "5 1 6", "output": "-1" }, { "input": "10 11 0", "output": "-1" }, { "input": "10 9 11", "output": "-1" }, { "input": "7 10 5", "output": "-1" }, { "input": "5 7 2", "output": "-1" }, { "input": "6 5 7", "output": "-1" }, { "input": "11 16 2", "output": "-1" }, { "input": "11 1000000000 10", "output": "-1" }, { "input": "10 2 21", "output": "-1" }, { "input": "10 15 1", "output": "-1" }, { "input": "5 2 8", "output": "-1" }, { "input": "11 10000000 10", "output": "-1" }, { "input": "10 1 101", "output": "-1" }, { "input": "20 24 2", "output": "-1" }, { "input": "11 24 0", "output": "-1" }, { "input": "11 17 4", "output": "-1" }, { "input": "11 13 1", "output": "-1" }, { "input": "10 11 2", "output": "-1" }, { "input": "11 23 3", "output": "-1" }, { "input": "10 99 0", "output": "-1" }, { "input": "6 7 4", "output": "-1" }, { "input": "11 1 22", "output": "2" }, { "input": "11 2 13", "output": "-1" }, { "input": "2 1 3", "output": "-1" }, { "input": "11 6 18", "output": "-1" }, { "input": "11 122 4", "output": "-1" }, { "input": "11 21 10", "output": "-1" }, { "input": "3 2 4", "output": "-1" }, { "input": "9 11 2", "output": "-1" }, { "input": "11 0 7", "output": "-1" }, { "input": "5 9 4", "output": "-1" }, { "input": "100 105 5", "output": "-1" }, { "input": "11 15 0", "output": "-1" }, { "input": "5 6 4", "output": "-1" }, { "input": "3 4 2", "output": "-1" }, { "input": "2 9 0", "output": "-1" }, { "input": "11 13 11", "output": "2" }, { "input": "11 15 5", "output": "-1" }, { "input": "11 4 15", "output": "-1" }, { "input": "10 1 0", "output": "-1" }, { "input": "11 16 8", "output": "-1" }, { "input": "10 43 0", "output": "-1" }, { "input": "11 13 5", "output": "-1" }, { "input": "11 22 0", "output": "2" }, { "input": "5 6 3", "output": "-1" }, { "input": "2 1 11", "output": "-1" }, { "input": "4 5 1", "output": "-1" }, { "input": "11 23 0", "output": "-1" }, { "input": "11 4 12", "output": "-1" }, { "input": "12 13 1", "output": "-1" }, { "input": "10 19 9", "output": "-1" }, { "input": "3 7 2", "output": "-1" }, { "input": "12 18 0", "output": "-1" }, { "input": "11 25 3", "output": "-1" }, { "input": "11 23 5", "output": "-1" }, { "input": "2 1 5", "output": "-1" }, { "input": "2 0 5", "output": "-1" }, { "input": "11 24 1", "output": "-1" }, { "input": "10 11 4", "output": "-1" }, { "input": "2 0 1", "output": "-1" }, { "input": "10 0 21", "output": "-1" }, { "input": "3 0 7", "output": "-1" }, { "input": "18 11 21", "output": "-1" }, { "input": "3 7 0", "output": "-1" }, { "input": "5 11 0", "output": "-1" }, { "input": "11 5 13", "output": "-1" }, { "input": "11 9 34", "output": "-1" }, { "input": "11 13 9", "output": "-1" }, { "input": "10 0 22", "output": "-1" }, { "input": "5 1 12", "output": "-1" }, { "input": "11 2 12", "output": "-1" }, { "input": "11 9 12", "output": "-1" }, { "input": "11 24 2", "output": "-1" }, { "input": "11 23 6", "output": "-1" }, { "input": "11 20 4", "output": "-1" }, { "input": "2 5 1", "output": "-1" }, { "input": "120 132 133", "output": "2" }, { "input": "11 111 4", "output": "-1" }, { "input": "10 7 11", "output": "-1" }, { "input": "6 13 0", "output": "-1" }, { "input": "5 11 1", "output": "-1" }, { "input": "11 5 27", "output": "-1" }, { "input": "11 15 3", "output": "-1" }, { "input": "11 0 13", "output": "-1" }, { "input": "11 13 10", "output": "-1" }, { "input": "11 25 5", "output": "-1" }, { "input": "4 3 5", "output": "-1" }, { "input": "100 199 100", "output": "2" }, { "input": "11 2 22", "output": "2" }, { "input": "10 20 2", "output": "2" }, { "input": "5 5 0", "output": "1" }, { "input": "10 11 1", "output": "-1" }, { "input": "11 12 2", "output": "-1" }, { "input": "5 16 3", "output": "-1" }, { "input": "12 14 1", "output": "-1" }, { "input": "10 22 2", "output": "-1" }, { "input": "2 4 0", "output": "2" }, { "input": "11 34 7", "output": "-1" }, { "input": "6 13 1", "output": "-1" }, { "input": "11 0 23", "output": "-1" }, { "input": "20 21 19", "output": "-1" }, { "input": "11 33 22", "output": "5" }, { "input": "10 4 41", "output": "-1" }, { "input": "3 4 0", "output": "-1" }, { "input": "11 15 7", "output": "-1" }, { "input": "5 0 6", "output": "-1" }, { "input": "11 3 22", "output": "2" }, { "input": "2 6 0", "output": "3" }, { "input": "10 11 11", "output": "2" }, { "input": "11 33 0", "output": "3" }, { "input": "4 6 2", "output": "-1" }, { "input": "11 76 2", "output": "-1" }, { "input": "7 9 4", "output": "-1" }, { "input": "10 43 1", "output": "-1" }, { "input": "22 25 5", "output": "-1" }, { "input": "3 5 2", "output": "-1" }, { "input": "11 1 24", "output": "-1" }, { "input": "12 25 3", "output": "-1" }, { "input": "11 0 22", "output": "2" }, { "input": "4 2 5", "output": "-1" }, { "input": "11 13 3", "output": "-1" }, { "input": "11 12 9", "output": "-1" }, { "input": "11 35 1", "output": "-1" }, { "input": "5 3 6", "output": "-1" }, { "input": "5 11 4", "output": "-1" }, { "input": "12 8 14", "output": "-1" }, { "input": "10 12 9", "output": "-1" }, { "input": "11 12 13", "output": "2" }, { "input": "11 15 2", "output": "-1" }, { "input": "11 23 4", "output": "-1" }, { "input": "5 3 11", "output": "-1" }, { "input": "6 13 2", "output": "-1" }, { "input": "4 1 0", "output": "-1" }, { "input": "11 32 10", "output": "-1" }, { "input": "2 11 1", "output": "-1" }, { "input": "10 11 7", "output": "-1" }, { "input": "11 26 0", "output": "-1" }, { "input": "100 205 5", "output": "-1" }, { "input": "4 0 2", "output": "-1" }, { "input": "10 11 8", "output": "-1" }, { "input": "11 22 5", "output": "2" }, { "input": "4 0 5", "output": "-1" }, { "input": "11 87 22", "output": "9" }, { "input": "4 8 0", "output": "2" }, { "input": "9 8 17", "output": "-1" }, { "input": "10 20 0", "output": "2" }, { "input": "10 9 19", "output": "-1" }, { "input": "12 2 13", "output": "-1" }, { "input": "11 24 5", "output": "-1" }, { "input": "10 1 11", "output": "-1" }, { "input": "4 0 9", "output": "-1" }, { "input": "3 0 1", "output": "-1" }, { "input": "11 12 4", "output": "-1" }, { "input": "3 8 2", "output": "-1" }, { "input": "11 17 10", "output": "-1" }, { "input": "6 1 13", "output": "-1" }, { "input": "11 25 0", "output": "-1" }, { "input": "12 0 13", "output": "-1" }, { "input": "10 5 20", "output": "2" }, { "input": "11 89 2", "output": "-1" }, { "input": "2 4 1", "output": "2" }, { "input": "10 31 0", "output": "-1" }, { "input": "11 34 1", "output": "-1" }, { "input": "999 6693 8331", "output": "14" }, { "input": "10 55 1", "output": "-1" }, { "input": "11 12 8", "output": "-1" }, { "input": "1 9 22", "output": "31" }, { "input": "7572 9186 895", "output": "-1" }, { "input": "3 2 11", "output": "-1" }, { "input": "2 1 4", "output": "2" }, { "input": "11 10 19", "output": "-1" }, { "input": "100 199 99", "output": "-1" }, { "input": "2537 8926 1523", "output": "-1" }, { "input": "11 0 5", "output": "-1" }, { "input": "5 1 11", "output": "-1" }, { "input": "12 13 5", "output": "-1" }, { "input": "10 12 0", "output": "-1" }, { "input": "5 4 7", "output": "-1" }, { "input": "12 25 1", "output": "-1" }, { "input": "7 9 0", "output": "-1" }, { "input": "4 15 0", "output": "-1" }, { "input": "5 11 2", "output": "-1" }, { "input": "11 58 3", "output": "-1" }, { "input": "10 11 5", "output": "-1" }, { "input": "10 3 1003", "output": "-1" }, { "input": "11 14 0", "output": "-1" }, { "input": "11 8 23", "output": "-1" }, { "input": "11 22 4", "output": "2" }, { "input": "5 2 0", "output": "-1" }, { "input": "11 1 35", "output": "-1" }, { "input": "12 25 5", "output": "-1" }, { "input": "11 37 4", "output": "-1" }, { "input": "20 42 3", "output": "-1" }, { "input": "10 12 2", "output": "-1" }, { "input": "4 1 5", "output": "-1" }, { "input": "5 16 0", "output": "-1" }, { "input": "11 13 7", "output": "-1" }, { "input": "5 0 3", "output": "-1" }, { "input": "11 2 11", "output": "1" }, { "input": "3 2 2000", "output": "-1" }, { "input": "3 0 4241", "output": "-1" }, { "input": "2 12 11", "output": "11" }, { "input": "10 2 82", "output": "-1" }, { "input": "11 0 11", "output": "1" }, { "input": "11 20 20", "output": "2" }, { "input": "5 0 10", "output": "2" }, { "input": "11 1 0", "output": "-1" }, { "input": "11 13 13", "output": "2" } ]
1,493,392,405
2,147,483,647
Python 3
OK
TESTS
279
77
5,529,600
#!/usr/bin/env python3 from sys import stdin,stdout def ri(): return map(int, stdin.readline().split()) k, a, b = ri() an = a//k ar = a%k bn = b//k br = b%k if an == 0 and br or bn == 0 and ar: print(-1) exit() ans = an+bn if ans: print(ans) else: print(-1)
Title: Table Tennis Game 2 Time Limit: None seconds Memory Limit: None megabytes Problem Description: Misha and Vanya have played several table tennis sets. Each set consists of several serves, each serve is won by one of the players, he receives one point and the loser receives nothing. Once one of the players scores exactly *k* points, the score is reset and a new set begins. Across all the sets Misha scored *a* points in total, and Vanya scored *b* points. Given this information, determine the maximum number of sets they could have played, or that the situation is impossible. Note that the game consisted of several complete sets. Input Specification: The first line contains three space-separated integers *k*, *a* and *b* (1<=≤<=*k*<=≤<=109, 0<=≤<=*a*,<=*b*<=≤<=109, *a*<=+<=*b*<=&gt;<=0). Output Specification: If the situation is impossible, print a single number -1. Otherwise, print the maximum possible number of sets. Demo Input: ['11 11 5\n', '11 2 3\n'] Demo Output: ['1\n', '-1\n'] Note: Note that the rules of the game in this problem differ from the real table tennis game, for example, the rule of "balance" (the winning player has to be at least two points ahead to win a set) has no power within the present problem.
```python #!/usr/bin/env python3 from sys import stdin,stdout def ri(): return map(int, stdin.readline().split()) k, a, b = ri() an = a//k ar = a%k bn = b//k br = b%k if an == 0 and br or bn == 0 and ar: print(-1) exit() ans = an+bn if ans: print(ans) else: print(-1) ```
3
102
B
Sum of Digits
PROGRAMMING
1,000
[ "implementation" ]
B. Sum of Digits
2
265
Having watched the last Harry Potter film, little Gerald also decided to practice magic. He found in his father's magical book a spell that turns any number in the sum of its digits. At the moment Gerald learned that, he came across a number *n*. How many times can Gerald put a spell on it until the number becomes one-digit?
The first line contains the only integer *n* (0<=≤<=*n*<=≤<=10100000). It is guaranteed that *n* doesn't contain any leading zeroes.
Print the number of times a number can be replaced by the sum of its digits until it only contains one digit.
[ "0\n", "10\n", "991\n" ]
[ "0\n", "1\n", "3\n" ]
In the first sample the number already is one-digit — Herald can't cast a spell. The second test contains number 10. After one casting of a spell it becomes 1, and here the process is completed. Thus, Gerald can only cast the spell once. The third test contains number 991. As one casts a spell the following transformations take place: 991 → 19 → 10 → 1. After three transformations the number becomes one-digit.
1,000
[ { "input": "0", "output": "0" }, { "input": "10", "output": "1" }, { "input": "991", "output": "3" }, { "input": "99", "output": "2" }, { "input": "100", "output": "1" }, { "input": "123456789", "output": "2" }, { "input": "32", "output": "1" }, { "input": "86", "output": "2" }, { "input": "2", "output": "0" }, { "input": "8", "output": "0" }, { "input": "34", "output": "1" }, { "input": "13", "output": "1" }, { "input": "28", "output": "2" }, { "input": "23", "output": "1" }, { "input": "57", "output": "2" }, { "input": "29", "output": "2" }, { "input": "353869285", "output": "3" }, { "input": "549548646", "output": "2" }, { "input": "858893424", "output": "2" }, { "input": "644818852", "output": "3" }, { "input": "360322525", "output": "3" }, { "input": "122937520", "output": "2" }, { "input": "288403032", "output": "2" }, { "input": "677257481", "output": "3" }, { "input": "58059561", "output": "3" }, { "input": "211288847", "output": "2" }, { "input": "339900034079539584", "output": "2" }, { "input": "784084029310269952", "output": "3" }, { "input": "774730557264864000", "output": "3" }, { "input": "478233807148352256", "output": "3" }, { "input": "165646874056812544", "output": "3" }, { "input": "477533739511673792", "output": "3" }, { "input": "660119944377002240", "output": "3" }, { "input": "448375218506078080", "output": "3" }, { "input": "77213334785795616", "output": "3" }, { "input": "165767221702271872", "output": "3" }, { "input": "1", "output": "0" }, { "input": "5", "output": "0" }, { "input": "8", "output": "0" }, { "input": "156161456146164104103460452045416165146141414651641564105461465156445621465146514562146145465165145145614561465145614561", "output": "3" }, { "input": "9", "output": "0" } ]
1,658,857,335
2,147,483,647
Python 3
OK
TESTS
51
154
0
num = input() count = 0 while len(num) > 1: result = 0 for i in num: result += int(i) count += 1 num = str(result) print(count)
Title: Sum of Digits Time Limit: 2 seconds Memory Limit: 265 megabytes Problem Description: Having watched the last Harry Potter film, little Gerald also decided to practice magic. He found in his father's magical book a spell that turns any number in the sum of its digits. At the moment Gerald learned that, he came across a number *n*. How many times can Gerald put a spell on it until the number becomes one-digit? Input Specification: The first line contains the only integer *n* (0<=≤<=*n*<=≤<=10100000). It is guaranteed that *n* doesn't contain any leading zeroes. Output Specification: Print the number of times a number can be replaced by the sum of its digits until it only contains one digit. Demo Input: ['0\n', '10\n', '991\n'] Demo Output: ['0\n', '1\n', '3\n'] Note: In the first sample the number already is one-digit — Herald can't cast a spell. The second test contains number 10. After one casting of a spell it becomes 1, and here the process is completed. Thus, Gerald can only cast the spell once. The third test contains number 991. As one casts a spell the following transformations take place: 991 → 19 → 10 → 1. After three transformations the number becomes one-digit.
```python num = input() count = 0 while len(num) > 1: result = 0 for i in num: result += int(i) count += 1 num = str(result) print(count) ```
3.9615
0
none
none
none
0
[ "none" ]
null
null
Bike is interested in permutations. A permutation of length *n* is an integer sequence such that each integer from 0 to (*n*<=-<=1) appears exactly once in it. For example, [0,<=2,<=1] is a permutation of length 3 while both [0,<=2,<=2] and [1,<=2,<=3] is not. A permutation triple of permutations of length *n* (*a*,<=*b*,<=*c*) is called a Lucky Permutation Triple if and only if . The sign *a**i* denotes the *i*-th element of permutation *a*. The modular equality described above denotes that the remainders after dividing *a**i*<=+<=*b**i* by *n* and dividing *c**i* by *n* are equal. Now, he has an integer *n* and wants to find a Lucky Permutation Triple. Could you please help him?
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105).
If no Lucky Permutation Triple of length *n* exists print -1. Otherwise, you need to print three lines. Each line contains *n* space-seperated integers. The first line must contain permutation *a*, the second line — permutation *b*, the third — permutation *c*. If there are multiple solutions, print any of them.
[ "5\n", "2\n" ]
[ "1 4 3 2 0\n1 0 2 4 3\n2 4 0 1 3\n", "-1\n" ]
In Sample 1, the permutation triple ([1, 4, 3, 2, 0], [1, 0, 2, 4, 3], [2, 4, 0, 1, 3]) is Lucky Permutation Triple, as following holds: - <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/a6bf1b9b57809dbec5021f65f89616f259587c07.png" style="max-width: 100.0%;max-height: 100.0%;"/>; - <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/48cc13134296b68f459f69d78e0240859aaec702.png" style="max-width: 100.0%;max-height: 100.0%;"/>; - <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ac44412de7b46833e90348a6b3298f9796e3977c.png" style="max-width: 100.0%;max-height: 100.0%;"/>; - <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/3825b0bb758208dda2ead1c5224c05d89ad9ab55.png" style="max-width: 100.0%;max-height: 100.0%;"/>; - <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/0a72e2da40048a507839927a211267ac01c9bf89.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In Sample 2, you can easily notice that no lucky permutation triple exists.
0
[ { "input": "5", "output": "1 4 3 2 0\n1 0 2 4 3\n2 4 0 1 3" }, { "input": "2", "output": "-1" }, { "input": "8", "output": "-1" }, { "input": "9", "output": "0 1 2 3 4 5 6 7 8 \n0 1 2 3 4 5 6 7 8 \n0 2 4 6 8 1 3 5 7 " }, { "input": "2", "output": "-1" }, { "input": "77", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 \n0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 \n0 2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 4..." }, { "input": "6", "output": "-1" }, { "input": "87", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 \n0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 \n0 2 4..." }, { "input": "72", "output": "-1" }, { "input": "1", "output": "0 \n0 \n0 " }, { "input": "23", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 \n0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 \n0 2 4 6 8 10 12 14 16 18 20 22 1 3 5 7 9 11 13 15 17 19 21 " }, { "input": "52", "output": "-1" }, { "input": "32", "output": "-1" }, { "input": "25", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 \n0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 \n0 2 4 6 8 10 12 14 16 18 20 22 24 1 3 5 7 9 11 13 15 17 19 21 23 " }, { "input": "54", "output": "-1" }, { "input": "39", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 \n0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 \n0 2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 " }, { "input": "20", "output": "-1" }, { "input": "53", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 \n0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 \n0 2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 50 52 1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 " }, { "input": "34", "output": "-1" }, { "input": "23", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 \n0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 \n0 2 4 6 8 10 12 14 16 18 20 22 1 3 5 7 9 11 13 15 17 19 21 " }, { "input": "37123", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "41904", "output": "-1" }, { "input": "46684", "output": "-1" }, { "input": "67817", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "72598", "output": "-1" }, { "input": "85891", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "74320", "output": "-1" }, { "input": "11805", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "16586", "output": "-1" }, { "input": "5014", "output": "-1" }, { "input": "73268", "output": "-1" }, { "input": "61697", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "99182", "output": "-1" }, { "input": "79771", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "68199", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "5684", "output": "-1" }, { "input": "10465", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "31598", "output": "-1" }, { "input": "36379", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "16968", "output": "-1" }, { "input": "93061", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "73650", "output": "-1" }, { "input": "94783", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "99564", "output": "-1" }, { "input": "37049", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "25478", "output": "-1" }, { "input": "30259", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "43551", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "31980", "output": "-1" }, { "input": "69465", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "1", "output": "0 \n0 \n0 " }, { "input": "100000", "output": "-1" }, { "input": "99999", "output": "0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 1..." }, { "input": "99998", "output": "-1" } ]
1,676,978,927
2,147,483,647
Python 3
OK
TESTS
54
748
5,324,800
def main(): n = int(input()) if n % 2 == 0: print(-1) return A = [i for i in range(n)] A1 = [A[n - 1]] for i in A: A1.append(A[i]) A1.pop(-1) A2 = [] for i in range(n): A2.append((A[i] + A1[i]) % n) print(*A) print(*A1) print(*A2) if __name__ == '__main__': main()
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Bike is interested in permutations. A permutation of length *n* is an integer sequence such that each integer from 0 to (*n*<=-<=1) appears exactly once in it. For example, [0,<=2,<=1] is a permutation of length 3 while both [0,<=2,<=2] and [1,<=2,<=3] is not. A permutation triple of permutations of length *n* (*a*,<=*b*,<=*c*) is called a Lucky Permutation Triple if and only if . The sign *a**i* denotes the *i*-th element of permutation *a*. The modular equality described above denotes that the remainders after dividing *a**i*<=+<=*b**i* by *n* and dividing *c**i* by *n* are equal. Now, he has an integer *n* and wants to find a Lucky Permutation Triple. Could you please help him? Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105). Output Specification: If no Lucky Permutation Triple of length *n* exists print -1. Otherwise, you need to print three lines. Each line contains *n* space-seperated integers. The first line must contain permutation *a*, the second line — permutation *b*, the third — permutation *c*. If there are multiple solutions, print any of them. Demo Input: ['5\n', '2\n'] Demo Output: ['1 4 3 2 0\n1 0 2 4 3\n2 4 0 1 3\n', '-1\n'] Note: In Sample 1, the permutation triple ([1, 4, 3, 2, 0], [1, 0, 2, 4, 3], [2, 4, 0, 1, 3]) is Lucky Permutation Triple, as following holds: - <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/a6bf1b9b57809dbec5021f65f89616f259587c07.png" style="max-width: 100.0%;max-height: 100.0%;"/>; - <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/48cc13134296b68f459f69d78e0240859aaec702.png" style="max-width: 100.0%;max-height: 100.0%;"/>; - <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ac44412de7b46833e90348a6b3298f9796e3977c.png" style="max-width: 100.0%;max-height: 100.0%;"/>; - <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/3825b0bb758208dda2ead1c5224c05d89ad9ab55.png" style="max-width: 100.0%;max-height: 100.0%;"/>; - <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/0a72e2da40048a507839927a211267ac01c9bf89.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In Sample 2, you can easily notice that no lucky permutation triple exists.
```python def main(): n = int(input()) if n % 2 == 0: print(-1) return A = [i for i in range(n)] A1 = [A[n - 1]] for i in A: A1.append(A[i]) A1.pop(-1) A2 = [] for i in range(n): A2.append((A[i] + A1[i]) % n) print(*A) print(*A1) print(*A2) if __name__ == '__main__': main() ```
3
897
A
Scarborough Fair
PROGRAMMING
800
[ "implementation" ]
null
null
Parsley, sage, rosemary and thyme. Remember me to one who lives there. He once was the true love of mine. Willem is taking the girl to the highest building in island No.28, however, neither of them knows how to get there. Willem asks his friend, Grick for directions, Grick helped them, and gave them a task. Although the girl wants to help, Willem insists on doing it by himself. Grick gave Willem a string of length *n*. Willem needs to do *m* operations, each operation has four parameters *l*,<=*r*,<=*c*1,<=*c*2, which means that all symbols *c*1 in range [*l*,<=*r*] (from *l*-th to *r*-th, including *l* and *r*) are changed into *c*2. String is 1-indexed. Grick wants to know the final string after all the *m* operations.
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100). The second line contains a string *s* of length *n*, consisting of lowercase English letters. Each of the next *m* lines contains four parameters *l*,<=*r*,<=*c*1,<=*c*2 (1<=≤<=*l*<=≤<=*r*<=≤<=*n*, *c*1,<=*c*2 are lowercase English letters), separated by space.
Output string *s* after performing *m* operations described above.
[ "3 1\nioi\n1 1 i n\n", "5 3\nwxhak\n3 3 h x\n1 5 x a\n1 3 w g\n" ]
[ "noi", "gaaak" ]
For the second example: After the first operation, the string is wxxak. After the second operation, the string is waaak. After the third operation, the string is gaaak.
500
[ { "input": "3 1\nioi\n1 1 i n", "output": "noi" }, { "input": "5 3\nwxhak\n3 3 h x\n1 5 x a\n1 3 w g", "output": "gaaak" }, { "input": "9 51\nbhfbdcgff\n2 3 b b\n2 8 e f\n3 8 g f\n5 7 d a\n1 5 e b\n3 4 g b\n6 7 c d\n3 6 e g\n3 6 e h\n5 6 a e\n7 9 a c\n4 9 a h\n3 7 c b\n6 9 b g\n1 7 h b\n4 5 a e\n3 9 f a\n1 2 c h\n4 8 a c\n3 5 e d\n3 4 g f\n2 3 d h\n2 3 d e\n1 7 d g\n2 6 e g\n2 3 d g\n5 5 h h\n2 8 g d\n8 9 a f\n5 9 c e\n1 7 f d\n1 6 e e\n5 7 c a\n8 9 b b\n2 6 e b\n6 6 g h\n1 2 b b\n1 5 a f\n5 8 f h\n1 5 e g\n3 9 f h\n6 8 g a\n4 6 h g\n1 5 f a\n5 6 a c\n4 8 e d\n1 4 d g\n7 8 b f\n5 6 h b\n3 9 c e\n1 9 b a", "output": "aahaddddh" }, { "input": "28 45\ndcbbaddjhbeefjadjchgkhgggfha\n10 25 c a\n13 19 a f\n12 28 e d\n12 27 e a\n9 20 b e\n7 17 g d\n22 26 j j\n8 16 c g\n14 16 a d\n3 10 f c\n10 26 d b\n8 17 i e\n10 19 d i\n6 21 c j\n7 22 b k\n17 19 a i\n4 18 j k\n8 25 a g\n10 27 j e\n9 18 g d\n16 23 h a\n17 26 k e\n8 16 h f\n1 15 d f\n22 28 k k\n11 20 c k\n6 11 b h\n17 17 e i\n15 22 g h\n8 18 c f\n4 16 e a\n8 25 b c\n6 24 d g\n5 9 f j\n12 19 i h\n4 25 e f\n15 25 c j\n15 27 e e\n11 20 b f\n19 27 e k\n2 21 d a\n9 27 k e\n14 24 b a\n3 6 i g\n2 26 k f", "output": "fcbbajjfjaaefefehfahfagggfha" }, { "input": "87 5\nnfinedeojadjmgafnaogekfjkjfncnliagfchjfcmellgigjjcaaoeakdolchjcecljdeblmheimkibkgdkcdml\n47 56 a k\n51 81 o d\n5 11 j h\n48 62 j d\n16 30 k m", "output": "nfinedeohadjmgafnaogemfjmjfncnliagfchjfcmellgigddckkdekkddlchdcecljdeblmheimkibkgdkcdml" }, { "input": "5 16\nacfbb\n1 2 e f\n2 5 a f\n2 3 b e\n4 4 f a\n2 3 f a\n1 2 b e\n4 5 c d\n2 4 e c\n1 4 e a\n1 3 d c\n3 5 e b\n3 5 e b\n2 2 e d\n1 3 e c\n3 3 a e\n1 5 a a", "output": "acebb" }, { "input": "94 13\nbcaaaaaaccacddcdaacbdaabbcbaddbccbccbbbddbadddcccbddadddaadbdababadaacdcdbcdadabdcdcbcbcbcbbcd\n52 77 d d\n21 92 d b\n45 48 c b\n20 25 d a\n57 88 d b\n3 91 b d\n64 73 a a\n5 83 b d\n2 69 c c\n28 89 a b\n49 67 c b\n41 62 a c\n49 87 b c", "output": "bcaaaaaaccacddcdaacddaaddcdbdddccdccddddddbdddddcdddcdddccdddcdcdcdcccdcddcdcdcddcdcdcdcdcdbcd" }, { "input": "67 39\nacbcbccccbabaabcabcaaaaaaccbcbbcbaaaacbbcccbcbabbcacccbbabbabbabaac\n4 36 a b\n25 38 a a\n3 44 b c\n35 57 b a\n4 8 a c\n20 67 c a\n30 66 b b\n27 40 a a\n2 56 a b\n10 47 c a\n22 65 c b\n29 42 a b\n1 46 c b\n57 64 b c\n20 29 b a\n14 51 c a\n12 55 b b\n20 20 a c\n2 57 c a\n22 60 c b\n16 51 c c\n31 64 a c\n17 30 c a\n23 36 c c\n28 67 a c\n37 40 a c\n37 50 b c\n29 48 c b\n2 34 b c\n21 53 b a\n26 63 a c\n23 28 c a\n51 56 c b\n32 61 b b\n64 67 b b\n21 67 b c\n8 53 c c\n40 62 b b\n32 38 c c", "output": "accccccccaaaaaaaaaaaaaaaaaaaccccccccccccccccccccccccccccccccccccccc" }, { "input": "53 33\nhhcbhfafeececbhadfbdbehdfacfchbhdbfebdfeghebfcgdhehfh\n27 41 h g\n18 35 c b\n15 46 h f\n48 53 e g\n30 41 b c\n12 30 b f\n10 37 e f\n18 43 a h\n10 52 d a\n22 48 c e\n40 53 f d\n7 12 b h\n12 51 f a\n3 53 g a\n19 41 d h\n22 29 b h\n2 30 a b\n26 28 e h\n25 35 f a\n19 31 h h\n44 44 d e\n19 22 e c\n29 44 d h\n25 33 d h\n3 53 g c\n18 44 h b\n19 28 f e\n3 22 g h\n8 17 c a\n37 51 d d\n3 28 e h\n27 50 h h\n27 46 f b", "output": "hhcbhfbfhfababbbbbbbbbbbbbbbbbeaaeaaeaaeabebdeaahahdh" }, { "input": "83 10\nfhbecdgadecabbbecedcgfdcefcbgechbedagecgdgfgdaahchdgchbeaedgafdefecdchceececfcdhcdh\n9 77 e e\n26 34 b g\n34 70 b a\n40 64 e g\n33 78 h f\n14 26 a a\n17 70 d g\n56 65 a c\n8 41 d c\n11 82 c b", "output": "fhbecdgacebabbbebegbgfgbefbggebhgegagebgggfggaafbfggbfagbgggbfggfebgbfbeebebfbdhbdh" }, { "input": "1 4\ne\n1 1 c e\n1 1 e a\n1 1 e c\n1 1 d a", "output": "a" }, { "input": "71 21\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\n61 61 a a\n32 56 a a\n10 67 a a\n7 32 a a\n26 66 a a\n41 55 a a\n49 55 a a\n4 61 a a\n53 59 a a\n37 58 a a\n7 63 a a\n39 40 a a\n51 64 a a\n27 37 a a\n22 71 a a\n4 45 a a\n7 8 a a\n43 46 a a\n19 28 a a\n51 54 a a\n14 67 a a", "output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa" }, { "input": "30 4\neaaddabedcbbcccddbabdecadcecce\n2 17 c a\n16 29 e e\n16 21 c b\n7 11 b c", "output": "eaaddacedacbaaaddbabdecadcecce" }, { "input": "48 30\naaaabaabbaababbbaabaabaababbabbbaabbbaabaaaaaaba\n3 45 a b\n1 14 a a\n15 32 a b\n37 47 a b\n9 35 a b\n36 39 b b\n6 26 a b\n36 44 a a\n28 44 b a\n29 31 b a\n20 39 a a\n45 45 a b\n21 32 b b\n7 43 a b\n14 48 a b\n14 33 a b\n39 44 a a\n9 36 b b\n4 23 b b\n9 42 b b\n41 41 b a\n30 47 a b\n8 42 b a\n14 38 b b\n3 15 a a\n35 47 b b\n14 34 a b\n38 43 a b\n1 35 b a\n16 28 b a", "output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbb" }, { "input": "89 29\nbabaabaaabaaaababbbbbbbabbbaaaaababbaababababbababaaabbababaaabbbbaaabaaaaaabaaabaabbabab\n39 70 b b\n3 56 b b\n5 22 b a\n4 39 a b\n41 87 b b\n34 41 a a\n10 86 a b\n29 75 a b\n2 68 a a\n27 28 b b\n42 51 b a\n18 61 a a\n6 67 b a\n47 63 a a\n8 68 a b\n4 74 b a\n19 65 a b\n8 55 a b\n5 30 a a\n3 65 a b\n16 57 a b\n34 56 b a\n1 70 a b\n59 68 b b\n29 57 b a\n47 49 b b\n49 73 a a\n32 61 b b\n29 42 a a", "output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbaaaabbbbbbbbbbbbbab" }, { "input": "59 14\nfbebcfabdefbaaedcefdeecababcabebadfbccaaedaebfdaefdbbcbebbe\n5 32 e f\n8 46 e e\n31 43 e f\n3 10 e a\n53 54 f d\n55 59 d a\n39 58 e b\n54 56 f a\n9 40 b e\n28 37 d a\n7 35 e b\n7 56 c f\n23 26 e a\n15 44 e d", "output": "fbabcfabdffbaafdfffdfffababfabfbaafdffaafdabbfdabfdbbfbbbbe" }, { "input": "7 17\nbbaabab\n3 5 a b\n5 7 a a\n5 5 a a\n4 4 b a\n7 7 a a\n5 6 b b\n1 3 b a\n6 7 a b\n4 6 a b\n6 6 a a\n2 4 b a\n1 7 b a\n4 6 b b\n2 5 b b\n2 5 a b\n1 4 a a\n4 4 b a", "output": "abbabaa" }, { "input": "100 1\ndebaaagbfdgehagadabfgheegggfghghgeeeabgceffeffggcbcegfgebbdhebhfagcgadcbdbabddbcadgbgdebdfehceehcaef\n13 99 f c", "output": "debaaagbfdgehagadabcgheegggcghghgeeeabgcecceccggcbcegcgebbdhebhcagcgadcbdbabddbcadgbgdebdcehceehcaef" }, { "input": "1 1\na\n1 1 a b", "output": "b" }, { "input": "100 1\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\n1 100 a b", "output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb" }, { "input": "2 2\naa\n1 2 a b\n1 2 b c", "output": "cc" }, { "input": "3 3\naaa\n1 3 a b\n1 3 b c\n1 3 c d", "output": "ddd" }, { "input": "2 2\naa\n2 2 a b\n1 1 a b", "output": "bb" } ]
1,649,938,288
2,147,483,647
Python 3
OK
TESTS
47
46
0
n,m=list(map(int,input().split())) s=input() k=list(s) ans="" for i in range(m): l,r,c1,c2=list(map(str,input().split())) for j in range(int(l)-1,int(r)): if(k[j]==c1): k[j]=c2 # print(k) ans="" for ele in k: ans+=ele print(ans)
Title: Scarborough Fair Time Limit: None seconds Memory Limit: None megabytes Problem Description: Parsley, sage, rosemary and thyme. Remember me to one who lives there. He once was the true love of mine. Willem is taking the girl to the highest building in island No.28, however, neither of them knows how to get there. Willem asks his friend, Grick for directions, Grick helped them, and gave them a task. Although the girl wants to help, Willem insists on doing it by himself. Grick gave Willem a string of length *n*. Willem needs to do *m* operations, each operation has four parameters *l*,<=*r*,<=*c*1,<=*c*2, which means that all symbols *c*1 in range [*l*,<=*r*] (from *l*-th to *r*-th, including *l* and *r*) are changed into *c*2. String is 1-indexed. Grick wants to know the final string after all the *m* operations. Input Specification: The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100). The second line contains a string *s* of length *n*, consisting of lowercase English letters. Each of the next *m* lines contains four parameters *l*,<=*r*,<=*c*1,<=*c*2 (1<=≤<=*l*<=≤<=*r*<=≤<=*n*, *c*1,<=*c*2 are lowercase English letters), separated by space. Output Specification: Output string *s* after performing *m* operations described above. Demo Input: ['3 1\nioi\n1 1 i n\n', '5 3\nwxhak\n3 3 h x\n1 5 x a\n1 3 w g\n'] Demo Output: ['noi', 'gaaak'] Note: For the second example: After the first operation, the string is wxxak. After the second operation, the string is waaak. After the third operation, the string is gaaak.
```python n,m=list(map(int,input().split())) s=input() k=list(s) ans="" for i in range(m): l,r,c1,c2=list(map(str,input().split())) for j in range(int(l)-1,int(r)): if(k[j]==c1): k[j]=c2 # print(k) ans="" for ele in k: ans+=ele print(ans) ```
3
6
C
Alice, Bob and Chocolate
PROGRAMMING
1,200
[ "greedy", "two pointers" ]
C. Alice, Bob and Chocolate
2
64
Alice and Bob like games. And now they are ready to start a new game. They have placed *n* chocolate bars in a line. Alice starts to eat chocolate bars one by one from left to right, and Bob — from right to left. For each chocololate bar the time, needed for the player to consume it, is known (Alice and Bob eat them with equal speed). When the player consumes a chocolate bar, he immediately starts with another. It is not allowed to eat two chocolate bars at the same time, to leave the bar unfinished and to make pauses. If both players start to eat the same bar simultaneously, Bob leaves it to Alice as a true gentleman. How many bars each of the players will consume?
The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the amount of bars on the table. The second line contains a sequence *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000), where *t**i* is the time (in seconds) needed to consume the *i*-th bar (in the order from left to right).
Print two numbers *a* and *b*, where *a* is the amount of bars consumed by Alice, and *b* is the amount of bars consumed by Bob.
[ "5\n2 9 8 2 7\n" ]
[ "2 3\n" ]
none
0
[ { "input": "5\n2 9 8 2 7", "output": "2 3" }, { "input": "1\n1", "output": "1 0" }, { "input": "2\n1 1", "output": "1 1" }, { "input": "3\n1 1 1", "output": "2 1" }, { "input": "4\n1 1 1 1", "output": "2 2" }, { "input": "1\n6", "output": "1 0" }, { "input": "2\n8 2", "output": "1 1" }, { "input": "3\n6 8 4", "output": "1 2" }, { "input": "4\n4 3 2 8", "output": "3 1" }, { "input": "5\n1 9 8 2 7", "output": "2 3" }, { "input": "6\n1 4 7 3 2 1", "output": "3 3" }, { "input": "11\n7 9 1 8 7 1 7 1 4 8 1", "output": "4 7" }, { "input": "12\n4 2 7 1 9 5 6 2 7 8 5 7", "output": "7 5" }, { "input": "13\n9 9 9 9 9 9 9 9 9 9 9 9 9", "output": "7 6" } ]
1,575,810,325
2,147,483,647
Python 3
OK
TESTS
40
342
7,168,000
n=int(input()) p=[int(x) for x in input().split()] s=sum(p) t=0 e=0 if n==1: print(1,0) else: for i in range (0,n): t=t+p[i] if t<s/2 and t+p[i+1]>=s/2: e=i break if s/2-t<t+p[e+1]-s/2: print(e+1,n-e-1) else: print(e+2,n-e-2)
Title: Alice, Bob and Chocolate Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: Alice and Bob like games. And now they are ready to start a new game. They have placed *n* chocolate bars in a line. Alice starts to eat chocolate bars one by one from left to right, and Bob — from right to left. For each chocololate bar the time, needed for the player to consume it, is known (Alice and Bob eat them with equal speed). When the player consumes a chocolate bar, he immediately starts with another. It is not allowed to eat two chocolate bars at the same time, to leave the bar unfinished and to make pauses. If both players start to eat the same bar simultaneously, Bob leaves it to Alice as a true gentleman. How many bars each of the players will consume? Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the amount of bars on the table. The second line contains a sequence *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000), where *t**i* is the time (in seconds) needed to consume the *i*-th bar (in the order from left to right). Output Specification: Print two numbers *a* and *b*, where *a* is the amount of bars consumed by Alice, and *b* is the amount of bars consumed by Bob. Demo Input: ['5\n2 9 8 2 7\n'] Demo Output: ['2 3\n'] Note: none
```python n=int(input()) p=[int(x) for x in input().split()] s=sum(p) t=0 e=0 if n==1: print(1,0) else: for i in range (0,n): t=t+p[i] if t<s/2 and t+p[i+1]>=s/2: e=i break if s/2-t<t+p[e+1]-s/2: print(e+1,n-e-1) else: print(e+2,n-e-2) ```
3.861094
61
A
Ultra-Fast Mathematician
PROGRAMMING
800
[ "implementation" ]
A. Ultra-Fast Mathematician
2
256
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Write one line — the corresponding answer. Do not omit the leading 0s.
[ "1010100\n0100101\n", "000\n111\n", "1110\n1010\n", "01110\n01100\n" ]
[ "1110001\n", "111\n", "0100\n", "00010\n" ]
none
500
[ { "input": "1010100\n0100101", "output": "1110001" }, { "input": "000\n111", "output": "111" }, { "input": "1110\n1010", "output": "0100" }, { "input": "01110\n01100", "output": "00010" }, { "input": "011101\n000001", "output": "011100" }, { "input": "10\n01", "output": "11" }, { "input": "00111111\n11011101", "output": "11100010" }, { "input": "011001100\n101001010", "output": "110000110" }, { "input": "1100100001\n0110101100", "output": "1010001101" }, { "input": "00011101010\n10010100101", "output": "10001001111" }, { "input": "100000101101\n111010100011", "output": "011010001110" }, { "input": "1000001111010\n1101100110001", "output": "0101101001011" }, { "input": "01011111010111\n10001110111010", "output": "11010001101101" }, { "input": "110010000111100\n001100101011010", "output": "111110101100110" }, { "input": "0010010111110000\n0000000011010110", "output": "0010010100100110" }, { "input": "00111110111110000\n01111100001100000", "output": "01000010110010000" }, { "input": "101010101111010001\n001001111101111101", "output": "100011010010101100" }, { "input": "0110010101111100000\n0011000101000000110", "output": "0101010000111100110" }, { "input": "11110100011101010111\n00001000011011000000", "output": "11111100000110010111" }, { "input": "101010101111101101001\n111010010010000011111", "output": "010000111101101110110" }, { "input": "0000111111100011000010\n1110110110110000001010", "output": "1110001001010011001000" }, { "input": "10010010101000110111000\n00101110100110111000111", "output": "10111100001110001111111" }, { "input": "010010010010111100000111\n100100111111100011001110", "output": "110110101101011111001001" }, { "input": "0101110100100111011010010\n0101100011010111001010001", "output": "0000010111110000010000011" }, { "input": "10010010100011110111111011\n10000110101100000001000100", "output": "00010100001111110110111111" }, { "input": "000001111000000100001000000\n011100111101111001110110001", "output": "011101000101111101111110001" }, { "input": "0011110010001001011001011100\n0000101101000011101011001010", "output": "0011011111001010110010010110" }, { "input": "11111000000000010011001101111\n11101110011001010100010000000", "output": "00010110011001000111011101111" }, { "input": "011001110000110100001100101100\n001010000011110000001000101001", "output": "010011110011000100000100000101" }, { "input": "1011111010001100011010110101111\n1011001110010000000101100010101", "output": "0000110100011100011111010111010" }, { "input": "10111000100001000001010110000001\n10111000001100101011011001011000", "output": "00000000101101101010001111011001" }, { "input": "000001010000100001000000011011100\n111111111001010100100001100000111", "output": "111110101001110101100001111011011" }, { "input": "1101000000000010011011101100000110\n1110000001100010011010000011011110", "output": "0011000001100000000001101111011000" }, { "input": "01011011000010100001100100011110001\n01011010111000001010010100001110000", "output": "00000001111010101011110000010000001" }, { "input": "000011111000011001000110111100000100\n011011000110000111101011100111000111", "output": "011000111110011110101101011011000011" }, { "input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000", "output": "1011001001111001001011101010101000010" }, { "input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011", "output": "10001110000010101110000111000011111110" }, { "input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100", "output": "000100001011110000011101110111010001110" }, { "input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001", "output": "1101110101010110000011000000101011110011" }, { "input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100", "output": "11001011110010010000010111001100001001110" }, { "input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110", "output": "001100101000011111111101111011101010111001" }, { "input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001", "output": "0111010010100110110101100010000100010100000" }, { "input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100", "output": "11111110000000100101000100110111001100011001" }, { "input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011", "output": "101011011100100010100011011001101010100100010" }, { "input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001", "output": "1101001100111011010111110110101111001011110111" }, { "input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001", "output": "10010101000101000000011010011110011110011110001" }, { "input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100", "output": "011011011100000000010101110010000000101000111101" }, { "input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100", "output": "0101010111101001011011110110011101010101010100011" }, { "input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011", "output": "11001011010010111000010110011101100100001110111111" }, { "input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011", "output": "111011101010011100001111101001101011110010010110001" }, { "input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001", "output": "0100111110110011111110010010010000110111100101101101" }, { "input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100", "output": "01011001110111010111001100010011010100010000111011000" }, { "input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111", "output": "100011101001001000011011011001111000100000010100100100" }, { "input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110", "output": "1100110010000101101010111111101001001001110101110010110" }, { "input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110", "output": "01000111100111001011110010100011111111110010101100001101" }, { "input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010", "output": "110001010001000011000101110101000100001011111001011001001" }, { "input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111", "output": "1110100010111000101001001011101110011111100111000011011011" }, { "input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110", "output": "01110110101110100100110011010000001000101100101111000111011" }, { "input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011", "output": "111100101000000011101011011001110010101111000110010010000000" }, { "input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111", "output": "0100100010111110010011101010000011111110001110010110010111001" }, { "input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111", "output": "00110100000011001101101100100010110010001100000001100110011101" }, { "input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011", "output": "000000011000111011110011101000010000010100101000000011010110010" }, { "input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010", "output": "0010100110110100111100100100101101010100100111011010001001010101" }, { "input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111", "output": "11010110111100101111101001100001110100010110010110110111100110100" }, { "input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111", "output": "111111010011011100101110100110111111111001111110011010111111110000" }, { "input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110", "output": "1010101010100010001001001001100000111000010010010100010011000100000" }, { "input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000", "output": "00011111011111001000011100010011100011010100101011011000001001111110" }, { "input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111", "output": "001111000011001110100111010101111111011100110011001010010010000111011" }, { "input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101", "output": "0110001100110100010000110111000010011010011000011001010011010100010100" }, { "input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010", "output": "00010000000110110101000011001000000100100110111010011111101010001010000" }, { "input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001", "output": "000100100000000110011100100001010110101001100101110010010011111001110111" }, { "input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000", "output": "1000111100010011010110011101000000101010101100011111100001101111001010010" }, { "input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011", "output": "01000010011110111001011011110000001011000111101101101010010110001010100100" }, { "input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101", "output": "101101110110110010011100001011111100100001110000101100110000100011011100110" }, { "input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001", "output": "1110111111110010111000001100101010101011010100101010100101100011001001111111" }, { "input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111", "output": "10111011000111000101110100101000100111011011100011110110000101010001111010111" }, { "input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110", "output": "110100100110000101010010011010011001100110000111010000010100001011110111111101" }, { "input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111", "output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111" }, { "input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001", "output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001" }, { "input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110", "output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011" }, { "input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111", "output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101" }, { "input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010", "output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101" }, { "input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000", "output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001" }, { "input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011", "output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110" }, { "input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011", "output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011" }, { "input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011", "output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011" }, { "input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010", "output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011" }, { "input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001", "output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110" }, { "input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111", "output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010" }, { "input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011", "output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011" }, { "input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100", "output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000" }, { "input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001", "output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101" }, { "input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110", "output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101" }, { "input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011", "output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110" }, { "input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111", "output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110" }, { "input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000", "output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001" }, { "input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010", "output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101" }, { "input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101", "output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011" }, { "input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011", "output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010" }, { "input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010", "output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011" }, { "input": "0\n0", "output": "0" }, { "input": "0\n1", "output": "1" } ]
1,530,086,075
2,147,483,647
Python 3
OK
TESTS
102
93
0
str1 = list(input()) str2 = list(input()) res = [] for i in range(len(str1)): res.append(int(str1[i]) ^ int(str2[i])) r = ''.join(str(e) for e in res) print(r)
Title: Ultra-Fast Mathematician Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate. Input Specification: There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. Output Specification: Write one line — the corresponding answer. Do not omit the leading 0s. Demo Input: ['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n'] Demo Output: ['1110001\n', '111\n', '0100\n', '00010\n'] Note: none
```python str1 = list(input()) str2 = list(input()) res = [] for i in range(len(str1)): res.append(int(str1[i]) ^ int(str2[i])) r = ''.join(str(e) for e in res) print(r) ```
3.97675
263
A
Beautiful Matrix
PROGRAMMING
800
[ "implementation" ]
null
null
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix: 1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=&lt;<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=&lt;<=5). You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
[ "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n", "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n" ]
[ "3\n", "1\n" ]
none
500
[ { "input": "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "0" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1", "output": "4" }, { "input": "0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "4" }, { "input": "0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "4" }, { "input": "0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0", "output": "4" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0", "output": "3" } ]
1,694,792,433
2,147,483,647
Python 3
OK
TESTS
25
92
0
rows = 5 matrix = [] for i in range(rows): row = list(map(int, input().split())) if 1 in row: my_row = i my_col = row.index(1) matrix.append(row) to_beauty = 0 if my_row > 2: to_beauty = to_beauty + (my_row - 2) elif my_row < 2: to_beauty = to_beauty + (2 - my_row) if my_col > 2: to_beauty = to_beauty + (my_col - 2) elif my_col < 2: to_beauty = to_beauty + (2 - my_col) print(to_beauty)
Title: Beautiful Matrix Time Limit: None seconds Memory Limit: None megabytes Problem Description: You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix: 1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=&lt;<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=&lt;<=5). You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful. Input Specification: The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one. Output Specification: Print a single integer — the minimum number of moves needed to make the matrix beautiful. Demo Input: ['0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n', '0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n'] Demo Output: ['3\n', '1\n'] Note: none
```python rows = 5 matrix = [] for i in range(rows): row = list(map(int, input().split())) if 1 in row: my_row = i my_col = row.index(1) matrix.append(row) to_beauty = 0 if my_row > 2: to_beauty = to_beauty + (my_row - 2) elif my_row < 2: to_beauty = to_beauty + (2 - my_row) if my_col > 2: to_beauty = to_beauty + (my_col - 2) elif my_col < 2: to_beauty = to_beauty + (2 - my_col) print(to_beauty) ```
3
38
A
Army
PROGRAMMING
800
[ "implementation" ]
A. Army
2
256
The Berland Armed Forces System consists of *n* ranks that are numbered using natural numbers from 1 to *n*, where 1 is the lowest rank and *n* is the highest rank. One needs exactly *d**i* years to rise from rank *i* to rank *i*<=+<=1. Reaching a certain rank *i* having not reached all the previous *i*<=-<=1 ranks is impossible. Vasya has just reached a new rank of *a*, but he dreams of holding the rank of *b*. Find for how many more years Vasya should serve in the army until he can finally realize his dream.
The first input line contains an integer *n* (2<=≤<=*n*<=≤<=100). The second line contains *n*<=-<=1 integers *d**i* (1<=≤<=*d**i*<=≤<=100). The third input line contains two integers *a* and *b* (1<=≤<=*a*<=&lt;<=*b*<=≤<=*n*). The numbers on the lines are space-separated.
Print the single number which is the number of years that Vasya needs to rise from rank *a* to rank *b*.
[ "3\n5 6\n1 2\n", "3\n5 6\n1 3\n" ]
[ "5\n", "11\n" ]
none
0
[ { "input": "3\n5 6\n1 2", "output": "5" }, { "input": "3\n5 6\n1 3", "output": "11" }, { "input": "2\n55\n1 2", "output": "55" }, { "input": "3\n85 78\n1 3", "output": "163" }, { "input": "4\n63 4 49\n2 3", "output": "4" }, { "input": "5\n93 83 42 56\n2 5", "output": "181" }, { "input": "6\n22 9 87 89 57\n1 6", "output": "264" }, { "input": "7\n52 36 31 23 74 78\n2 7", "output": "242" }, { "input": "8\n82 14 24 5 91 49 94\n3 8", "output": "263" }, { "input": "9\n12 40 69 39 59 21 59 5\n4 6", "output": "98" }, { "input": "10\n95 81 32 59 71 30 50 61 100\n1 6", "output": "338" }, { "input": "15\n89 55 94 4 15 69 19 60 91 77 3 94 91 62\n3 14", "output": "617" }, { "input": "20\n91 1 41 51 95 67 92 35 23 70 44 91 57 50 21 8 9 71 40\n8 17", "output": "399" }, { "input": "25\n70 95 21 84 97 39 12 98 53 24 78 29 84 65 70 22 100 17 69 27 62 48 35 80\n8 23", "output": "846" }, { "input": "30\n35 69 50 44 19 56 86 56 98 24 21 2 61 24 85 30 2 22 57 35 59 84 12 77 92 53 50 92 9\n1 16", "output": "730" }, { "input": "35\n2 34 47 15 27 61 6 88 67 20 53 65 29 68 77 5 78 86 44 98 32 81 91 79 54 84 95 23 65 97 22 33 42 87\n8 35", "output": "1663" }, { "input": "40\n32 88 59 36 95 45 28 78 73 30 97 13 13 47 48 100 43 21 22 45 88 25 15 13 63 25 72 92 29 5 25 11 50 5 54 51 48 84 23\n7 26", "output": "862" }, { "input": "45\n83 74 73 95 10 31 100 26 29 15 80 100 22 70 31 88 9 56 19 70 2 62 48 30 27 47 52 50 94 44 21 94 23 85 15 3 95 72 43 62 94 89 68 88\n17 40", "output": "1061" }, { "input": "50\n28 8 16 29 19 82 70 51 96 84 74 72 17 69 12 21 37 21 39 3 18 66 19 49 86 96 94 93 2 90 96 84 59 88 58 15 61 33 55 22 35 54 51 29 64 68 29 38 40\n23 28", "output": "344" }, { "input": "60\n24 28 25 21 43 71 64 73 71 90 51 83 69 43 75 43 78 72 56 61 99 7 23 86 9 16 16 94 23 74 18 56 20 72 13 31 75 34 35 86 61 49 4 72 84 7 65 70 66 52 21 38 6 43 69 40 73 46 5\n28 60", "output": "1502" }, { "input": "70\n69 95 34 14 67 61 6 95 94 44 28 94 73 66 39 13 19 71 73 71 28 48 26 22 32 88 38 95 43 59 88 77 80 55 17 95 40 83 67 1 38 95 58 63 56 98 49 2 41 4 73 8 78 41 64 71 60 71 41 61 67 4 4 19 97 14 39 20 27\n9 41", "output": "1767" }, { "input": "80\n65 15 43 6 43 98 100 16 69 98 4 54 25 40 2 35 12 23 38 29 10 89 30 6 4 8 7 96 64 43 11 49 89 38 20 59 54 85 46 16 16 89 60 54 28 37 32 34 67 9 78 30 50 87 58 53 99 48 77 3 5 6 19 99 16 20 31 10 80 76 82 56 56 83 72 81 84 60 28\n18 24", "output": "219" }, { "input": "90\n61 35 100 99 67 87 42 90 44 4 81 65 29 63 66 56 53 22 55 87 39 30 34 42 27 80 29 97 85 28 81 22 50 22 24 75 67 86 78 79 94 35 13 97 48 76 68 66 94 13 82 1 22 85 5 36 86 73 65 97 43 56 35 26 87 25 74 47 81 67 73 75 99 75 53 38 70 21 66 78 38 17 57 40 93 57 68 55 1\n12 44", "output": "1713" }, { "input": "95\n37 74 53 96 65 84 65 72 95 45 6 77 91 35 58 50 51 51 97 30 51 20 79 81 92 10 89 34 40 76 71 54 26 34 73 72 72 28 53 19 95 64 97 10 44 15 12 38 5 63 96 95 86 8 36 96 45 53 81 5 18 18 47 97 65 9 33 53 41 86 37 53 5 40 15 76 83 45 33 18 26 5 19 90 46 40 100 42 10 90 13 81 40 53\n6 15", "output": "570" }, { "input": "96\n51 32 95 75 23 54 70 89 67 3 1 51 4 100 97 30 9 35 56 38 54 77 56 98 43 17 60 43 72 46 87 61 100 65 81 22 74 38 16 96 5 10 54 22 23 22 10 91 9 54 49 82 29 73 33 98 75 8 4 26 24 90 71 42 90 24 94 74 94 10 41 98 56 63 18 43 56 21 26 64 74 33 22 38 67 66 38 60 64 76 53 10 4 65 76\n21 26", "output": "328" }, { "input": "97\n18 90 84 7 33 24 75 55 86 10 96 72 16 64 37 9 19 71 62 97 5 34 85 15 46 72 82 51 52 16 55 68 27 97 42 72 76 97 32 73 14 56 11 86 2 81 59 95 60 93 1 22 71 37 77 100 6 16 78 47 78 62 94 86 16 91 56 46 47 35 93 44 7 86 70 10 29 45 67 62 71 61 74 39 36 92 24 26 65 14 93 92 15 28 79 59\n6 68", "output": "3385" }, { "input": "98\n32 47 26 86 43 42 79 72 6 68 40 46 29 80 24 89 29 7 21 56 8 92 13 33 50 79 5 7 84 85 24 23 1 80 51 21 26 55 96 51 24 2 68 98 81 88 57 100 64 84 54 10 14 2 74 1 89 71 1 20 84 85 17 31 42 58 69 67 48 60 97 90 58 10 21 29 2 21 60 61 68 89 77 39 57 18 61 44 67 100 33 74 27 40 83 29 6\n8 77", "output": "3319" }, { "input": "99\n46 5 16 66 53 12 84 89 26 27 35 68 41 44 63 17 88 43 80 15 59 1 42 50 53 34 75 16 16 55 92 30 28 11 12 71 27 65 11 28 86 47 24 10 60 47 7 53 16 75 6 49 56 66 70 3 20 78 75 41 38 57 89 23 16 74 30 39 1 32 49 84 9 33 25 95 75 45 54 59 17 17 29 40 79 96 47 11 69 86 73 56 91 4 87 47 31 24\n23 36", "output": "514" }, { "input": "100\n63 65 21 41 95 23 3 4 12 23 95 50 75 63 58 34 71 27 75 31 23 94 96 74 69 34 43 25 25 55 44 19 43 86 68 17 52 65 36 29 72 96 84 25 84 23 71 54 6 7 71 7 21 100 99 58 93 35 62 47 36 70 68 9 75 13 35 70 76 36 62 22 52 51 2 87 66 41 54 35 78 62 30 35 65 44 74 93 78 37 96 70 26 32 71 27 85 85 63\n43 92", "output": "2599" }, { "input": "51\n85 38 22 38 42 36 55 24 36 80 49 15 66 91 88 61 46 82 1 61 89 92 6 56 28 8 46 80 56 90 91 38 38 17 69 64 57 68 13 44 45 38 8 72 61 39 87 2 73 88\n15 27", "output": "618" }, { "input": "2\n3\n1 2", "output": "3" }, { "input": "5\n6 8 22 22\n2 3", "output": "8" }, { "input": "6\n3 12 27 28 28\n3 4", "output": "27" }, { "input": "9\n1 2 2 2 2 3 3 5\n3 7", "output": "9" }, { "input": "10\n1 1 1 1 1 1 1 1 1\n6 8", "output": "2" }, { "input": "20\n1 1 1 1 1 1 1 1 2 2 2 2 2 3 3 3 3 3 3\n5 17", "output": "23" }, { "input": "25\n1 1 1 4 5 6 8 11 11 11 11 12 13 14 14 14 15 16 16 17 17 17 19 19\n4 8", "output": "23" }, { "input": "35\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2\n30 31", "output": "2" }, { "input": "45\n1 1 1 1 2 2 2 2 2 2 2 3 3 3 3 3 3 4 5 5 5 5 6 6 6 6 6 6 6 7 7 7 7 8 8 8 9 9 9 9 9 10 10 10\n42 45", "output": "30" }, { "input": "50\n1 8 8 13 14 15 15 16 19 21 22 24 26 31 32 37 45 47 47 47 50 50 51 54 55 56 58 61 61 61 63 63 64 66 66 67 67 70 71 80 83 84 85 92 92 94 95 95 100\n4 17", "output": "285" }, { "input": "60\n1 2 4 4 4 6 6 8 9 10 10 13 14 18 20 20 21 22 23 23 26 29 30 32 33 34 35 38 40 42 44 44 46 48 52 54 56 56 60 60 66 67 68 68 69 73 73 74 80 80 81 81 82 84 86 86 87 89 89\n56 58", "output": "173" }, { "input": "70\n1 2 3 3 4 5 5 7 7 7 8 8 8 8 9 9 10 12 12 12 12 13 16 16 16 16 16 16 17 17 18 18 20 20 21 23 24 25 25 26 29 29 29 29 31 32 32 34 35 36 36 37 37 38 39 39 40 40 40 40 41 41 42 43 44 44 44 45 45\n62 65", "output": "126" }, { "input": "80\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 4 4 4 4 5 5 5 5 5 5 5 6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 12 12\n17 65", "output": "326" }, { "input": "90\n1 1 3 5 8 9 10 11 11 11 11 12 13 14 15 15 15 16 16 19 19 20 22 23 24 25 25 28 29 29 30 31 33 34 35 37 37 38 41 43 43 44 45 47 51 54 55 56 58 58 59 59 60 62 66 67 67 67 68 68 69 70 71 72 73 73 76 77 77 78 78 78 79 79 79 82 83 84 85 85 87 87 89 93 93 93 95 99 99\n28 48", "output": "784" }, { "input": "95\n2 2 3 3 4 6 6 7 7 7 9 10 12 12 12 12 13 14 15 16 17 18 20 20 20 20 21 21 21 21 22 22 22 22 22 23 23 23 25 26 26 27 27 27 28 29 29 30 30 31 32 33 34 36 37 37 38 39 39 39 42 43 43 43 45 47 48 50 50 51 52 53 54 54 54 55 55 55 58 59 60 61 61 61 61 62 62 63 64 65 66 67 67 67\n64 93", "output": "1636" }, { "input": "96\n1 1 2 3 3 5 8 9 9 10 10 10 11 11 11 11 11 12 13 13 13 14 15 15 16 16 17 17 17 17 18 18 20 20 20 21 21 21 23 24 24 25 25 26 27 27 27 27 29 29 29 30 30 30 32 32 32 32 32 32 33 33 34 34 34 35 35 35 36 36 37 37 37 38 39 40 41 41 41 41 42 42 43 43 45 45 45 46 46 47 47 49 50 52 52\n76 96", "output": "898" }, { "input": "98\n2 3 4 4 5 7 8 10 10 10 11 11 12 12 12 12 13 14 15 15 16 16 18 19 19 20 21 21 21 21 22 23 24 25 26 26 27 27 27 27 29 29 30 30 31 31 37 40 40 40 41 41 41 42 43 44 44 44 46 46 47 49 49 50 50 50 51 53 55 55 56 56 56 56 56 57 57 58 59 60 60 60 62 62 63 64 64 64 65 66 66 67 68 70 70 71 71\n8 90", "output": "3016" }, { "input": "99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n66 95", "output": "29" }, { "input": "100\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 10 10 10 10 11 11 11 11 12 12 12 13 13 13 13 13 13 13 13 13 13 14 14 14 14 14 14 15 15 15 15 15 15 16 16 16 17 17\n39 52", "output": "82" }, { "input": "51\n5 7 9 16 19 25 26 29 29 30 31 32 32 41 43 44 47 49 50 50 51 52 54 55 56 63 64 66 67 70 74 74 77 78 79 80 80 85 86 87 89 89 90 92 93 94 94 95 95 97\n3 44", "output": "2268" } ]
1,631,500,963
2,147,483,647
Python 3
OK
TESTS
50
124
6,758,400
n = int(input()) d = list(map(int, input().split())) a, b = map(int, input().split()) ans = 0 while(b>a): ans += d[b-2] b -= 1 print(ans)
Title: Army Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The Berland Armed Forces System consists of *n* ranks that are numbered using natural numbers from 1 to *n*, where 1 is the lowest rank and *n* is the highest rank. One needs exactly *d**i* years to rise from rank *i* to rank *i*<=+<=1. Reaching a certain rank *i* having not reached all the previous *i*<=-<=1 ranks is impossible. Vasya has just reached a new rank of *a*, but he dreams of holding the rank of *b*. Find for how many more years Vasya should serve in the army until he can finally realize his dream. Input Specification: The first input line contains an integer *n* (2<=≤<=*n*<=≤<=100). The second line contains *n*<=-<=1 integers *d**i* (1<=≤<=*d**i*<=≤<=100). The third input line contains two integers *a* and *b* (1<=≤<=*a*<=&lt;<=*b*<=≤<=*n*). The numbers on the lines are space-separated. Output Specification: Print the single number which is the number of years that Vasya needs to rise from rank *a* to rank *b*. Demo Input: ['3\n5 6\n1 2\n', '3\n5 6\n1 3\n'] Demo Output: ['5\n', '11\n'] Note: none
```python n = int(input()) d = list(map(int, input().split())) a, b = map(int, input().split()) ans = 0 while(b>a): ans += d[b-2] b -= 1 print(ans) ```
3.956411
94
B
Friends
PROGRAMMING
1,300
[ "graphs", "implementation", "math" ]
B. Friends
1
256
One day Igor K. stopped programming and took up math. One late autumn evening he was sitting at a table reading a book and thinking about something. The following statement caught his attention: "Among any six people there are either three pairwise acquainted people or three pairwise unacquainted people" Igor just couldn't get why the required minimum is 6 people. "Well, that's the same for five people, too!" — he kept on repeating in his mind. — "Let's take, say, Max, Ilya, Vova — here, they all know each other! And now let's add Dima and Oleg to Vova — none of them is acquainted with each other! Now, that math is just rubbish!" Igor K. took 5 friends of his and wrote down who of them is friends with whom. Now he wants to check whether it is true for the five people that among them there are either three pairwise acquainted or three pairwise not acquainted people.
The first line contains an integer *m* (0<=≤<=*m*<=≤<=10), which is the number of relations of acquaintances among the five friends of Igor's. Each of the following *m* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=5;*a**i*<=≠<=*b**i*), where (*a**i*,<=*b**i*) is a pair of acquainted people. It is guaranteed that each pair of the acquaintances is described exactly once. The acquaintance relation is symmetrical, i.e. if *x* is acquainted with *y*, then *y* is also acquainted with *x*.
Print "FAIL", if among those five people there are no either three pairwise acquainted or three pairwise unacquainted people. Otherwise print "WIN".
[ "4\n1 3\n2 3\n1 4\n5 3\n", "5\n1 2\n2 3\n3 4\n4 5\n5 1\n" ]
[ "WIN\n", "FAIL\n" ]
none
1,000
[ { "input": "4\n1 3\n2 3\n1 4\n5 3", "output": "WIN" }, { "input": "5\n1 2\n2 3\n3 4\n4 5\n5 1", "output": "FAIL" }, { "input": "1\n4 3", "output": "WIN" }, { "input": "6\n1 3\n2 3\n1 2\n5 3\n4 2\n4 5", "output": "WIN" }, { "input": "2\n1 3\n2 5", "output": "WIN" }, { "input": "3\n5 3\n4 3\n4 5", "output": "WIN" }, { "input": "5\n1 3\n3 2\n2 4\n5 4\n1 5", "output": "FAIL" }, { "input": "7\n1 3\n5 1\n1 4\n2 1\n5 3\n4 5\n2 5", "output": "WIN" }, { "input": "5\n5 1\n4 1\n2 3\n4 5\n3 1", "output": "WIN" }, { "input": "0", "output": "WIN" }, { "input": "10\n1 2\n1 3\n1 4\n1 5\n2 3\n2 4\n2 5\n3 4\n3 5\n4 5", "output": "WIN" }, { "input": "4\n1 2\n2 3\n3 4\n4 1", "output": "WIN" }, { "input": "1\n2 1", "output": "WIN" }, { "input": "1\n2 5", "output": "WIN" }, { "input": "2\n2 1\n1 5", "output": "WIN" }, { "input": "2\n4 2\n1 5", "output": "WIN" }, { "input": "2\n3 4\n5 2", "output": "WIN" }, { "input": "2\n1 5\n4 3", "output": "WIN" }, { "input": "3\n4 1\n4 5\n2 1", "output": "WIN" }, { "input": "3\n5 1\n5 3\n2 5", "output": "WIN" }, { "input": "3\n1 2\n4 2\n1 3", "output": "WIN" }, { "input": "3\n3 2\n1 5\n5 3", "output": "WIN" }, { "input": "3\n1 2\n2 4\n3 2", "output": "WIN" }, { "input": "3\n2 1\n1 3\n5 4", "output": "WIN" }, { "input": "4\n4 2\n2 5\n1 4\n4 5", "output": "WIN" }, { "input": "4\n5 2\n2 4\n5 3\n1 5", "output": "WIN" }, { "input": "4\n2 5\n1 3\n4 3\n4 2", "output": "WIN" }, { "input": "4\n1 4\n3 1\n2 3\n1 2", "output": "WIN" }, { "input": "4\n5 4\n2 3\n1 5\n5 2", "output": "WIN" }, { "input": "4\n2 5\n5 4\n1 4\n5 3", "output": "WIN" }, { "input": "4\n2 1\n2 4\n5 1\n4 1", "output": "WIN" }, { "input": "4\n1 2\n1 5\n4 5\n2 3", "output": "WIN" }, { "input": "5\n4 1\n2 4\n3 2\n5 3\n1 5", "output": "FAIL" }, { "input": "5\n1 3\n4 1\n5 2\n2 4\n3 5", "output": "FAIL" }, { "input": "5\n3 5\n4 2\n1 3\n2 1\n5 4", "output": "FAIL" }, { "input": "5\n5 2\n1 3\n4 5\n2 1\n3 4", "output": "FAIL" }, { "input": "5\n2 3\n3 5\n1 2\n4 1\n5 4", "output": "FAIL" }, { "input": "5\n1 2\n4 5\n5 3\n3 1\n2 4", "output": "FAIL" }, { "input": "5\n5 3\n3 2\n2 4\n1 5\n4 1", "output": "FAIL" }, { "input": "5\n3 2\n4 1\n2 5\n1 3\n5 4", "output": "FAIL" }, { "input": "5\n3 5\n1 4\n5 1\n2 3\n4 2", "output": "FAIL" }, { "input": "5\n4 2\n5 3\n2 1\n3 4\n1 5", "output": "FAIL" }, { "input": "5\n3 1\n5 1\n4 5\n2 4\n5 3", "output": "WIN" }, { "input": "5\n5 4\n5 3\n3 1\n1 4\n2 3", "output": "WIN" }, { "input": "5\n4 1\n3 5\n3 4\n5 4\n5 2", "output": "WIN" }, { "input": "5\n4 1\n5 2\n3 1\n4 2\n5 1", "output": "WIN" }, { "input": "5\n2 3\n1 5\n5 3\n2 4\n1 4", "output": "FAIL" }, { "input": "5\n5 4\n5 3\n2 3\n5 2\n5 1", "output": "WIN" }, { "input": "5\n2 4\n3 4\n1 4\n2 1\n3 2", "output": "WIN" }, { "input": "5\n2 3\n3 4\n1 3\n4 1\n5 2", "output": "WIN" }, { "input": "5\n1 2\n2 5\n4 2\n4 3\n3 1", "output": "WIN" }, { "input": "5\n2 1\n2 5\n4 5\n2 3\n3 5", "output": "WIN" }, { "input": "5\n4 1\n5 1\n5 4\n4 3\n5 2", "output": "WIN" }, { "input": "5\n1 3\n2 4\n1 5\n5 2\n4 1", "output": "WIN" }, { "input": "5\n1 5\n3 5\n2 3\n4 1\n3 1", "output": "WIN" }, { "input": "5\n5 2\n3 2\n2 1\n4 3\n4 2", "output": "WIN" }, { "input": "5\n1 3\n4 5\n3 4\n3 5\n5 1", "output": "WIN" }, { "input": "5\n4 5\n2 5\n5 3\n4 2\n4 1", "output": "WIN" }, { "input": "5\n2 5\n1 5\n1 3\n3 5\n1 2", "output": "WIN" }, { "input": "5\n2 4\n1 2\n5 2\n5 3\n4 5", "output": "WIN" }, { "input": "5\n2 1\n4 5\n5 3\n1 5\n1 4", "output": "WIN" }, { "input": "5\n1 3\n2 5\n4 2\n3 4\n4 1", "output": "WIN" }, { "input": "6\n3 2\n2 4\n3 1\n3 5\n5 2\n1 2", "output": "WIN" }, { "input": "6\n2 1\n5 1\n5 4\n3 5\n3 4\n4 1", "output": "WIN" }, { "input": "6\n3 1\n1 4\n5 4\n2 1\n4 2\n1 5", "output": "WIN" }, { "input": "6\n5 1\n5 4\n3 4\n1 3\n1 4\n4 2", "output": "WIN" }, { "input": "6\n1 3\n5 4\n4 2\n2 1\n4 1\n2 3", "output": "WIN" }, { "input": "6\n4 3\n5 3\n4 1\n1 3\n1 2\n2 4", "output": "WIN" }, { "input": "6\n4 1\n3 5\n4 5\n3 1\n4 3\n5 2", "output": "WIN" }, { "input": "6\n2 1\n1 4\n4 5\n5 2\n1 3\n3 2", "output": "WIN" }, { "input": "7\n5 1\n3 5\n2 5\n4 5\n2 3\n3 1\n4 3", "output": "WIN" }, { "input": "7\n5 3\n5 1\n4 2\n4 5\n3 2\n3 4\n1 3", "output": "WIN" }, { "input": "7\n3 5\n1 4\n5 2\n1 5\n1 3\n4 2\n4 3", "output": "WIN" }, { "input": "7\n5 1\n5 4\n2 4\n2 3\n3 5\n2 5\n4 1", "output": "WIN" }, { "input": "7\n1 3\n2 5\n4 3\n2 1\n2 3\n4 5\n2 4", "output": "WIN" }, { "input": "7\n3 1\n4 5\n3 5\n5 1\n2 4\n1 2\n1 4", "output": "WIN" }, { "input": "8\n1 5\n3 1\n2 5\n4 2\n2 1\n4 5\n4 3\n4 1", "output": "WIN" }, { "input": "8\n4 2\n3 1\n4 3\n2 5\n3 2\n4 5\n1 2\n3 5", "output": "WIN" }, { "input": "8\n2 4\n3 2\n2 5\n3 4\n3 1\n5 1\n4 5\n5 3", "output": "WIN" }, { "input": "8\n2 3\n1 5\n1 3\n4 5\n2 4\n1 4\n3 5\n3 4", "output": "WIN" }, { "input": "9\n3 5\n3 2\n1 5\n4 3\n5 4\n1 4\n1 3\n4 2\n5 2", "output": "WIN" }, { "input": "9\n3 5\n2 5\n5 1\n4 5\n1 3\n3 2\n1 4\n4 3\n4 2", "output": "WIN" }, { "input": "3\n3 4\n4 5\n5 3", "output": "WIN" }, { "input": "3\n1 2\n1 3\n4 5", "output": "WIN" }, { "input": "3\n2 3\n3 5\n2 5", "output": "WIN" } ]
1,631,472,352
2,147,483,647
Python 3
OK
TESTS
85
77
6,963,200
# # Joseph Matsushita # Problem I # # Time Complexity: # The nature of the problem prevents the time complexity from rising above O(1). # There are always 5 people, and the only scenario that requires any serious # testing is when there are 5 pairs of acquaintances, which we can guarantee # will run the same amount of time every time. # # Space Complexity: # Once again, due to the problem constraints the space complexity is O(1). # We can guarantee that this program will only take a constant amount of memory. # # Argument: # Can't exactly do much better than constant time and space complexity. The # small scale nature of the problem and the limited scenarios that need to be # checked allow us to quickly figure out the answer without any complex # algorithms. There is a loop, but it will run exactly 5 times when it's needed. # n = int(input()) win = True #assume it's true if(n == 5): #the fail scenarios require exactly 5 edges adj = [0 for i in range(5)] for i in range(5): #create an adjacency list edge = list(map(int, input().split())) adj[edge[0]-1] += 1 adj[edge[1]-1] += 1 if adj.count(2) == 5: #only failure scenario requires everyone has exactly win = False #two acquaintances if(win): print("WIN") else: print("FAIL")
Title: Friends Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: One day Igor K. stopped programming and took up math. One late autumn evening he was sitting at a table reading a book and thinking about something. The following statement caught his attention: "Among any six people there are either three pairwise acquainted people or three pairwise unacquainted people" Igor just couldn't get why the required minimum is 6 people. "Well, that's the same for five people, too!" — he kept on repeating in his mind. — "Let's take, say, Max, Ilya, Vova — here, they all know each other! And now let's add Dima and Oleg to Vova — none of them is acquainted with each other! Now, that math is just rubbish!" Igor K. took 5 friends of his and wrote down who of them is friends with whom. Now he wants to check whether it is true for the five people that among them there are either three pairwise acquainted or three pairwise not acquainted people. Input Specification: The first line contains an integer *m* (0<=≤<=*m*<=≤<=10), which is the number of relations of acquaintances among the five friends of Igor's. Each of the following *m* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=5;*a**i*<=≠<=*b**i*), where (*a**i*,<=*b**i*) is a pair of acquainted people. It is guaranteed that each pair of the acquaintances is described exactly once. The acquaintance relation is symmetrical, i.e. if *x* is acquainted with *y*, then *y* is also acquainted with *x*. Output Specification: Print "FAIL", if among those five people there are no either three pairwise acquainted or three pairwise unacquainted people. Otherwise print "WIN". Demo Input: ['4\n1 3\n2 3\n1 4\n5 3\n', '5\n1 2\n2 3\n3 4\n4 5\n5 1\n'] Demo Output: ['WIN\n', 'FAIL\n'] Note: none
```python # # Joseph Matsushita # Problem I # # Time Complexity: # The nature of the problem prevents the time complexity from rising above O(1). # There are always 5 people, and the only scenario that requires any serious # testing is when there are 5 pairs of acquaintances, which we can guarantee # will run the same amount of time every time. # # Space Complexity: # Once again, due to the problem constraints the space complexity is O(1). # We can guarantee that this program will only take a constant amount of memory. # # Argument: # Can't exactly do much better than constant time and space complexity. The # small scale nature of the problem and the limited scenarios that need to be # checked allow us to quickly figure out the answer without any complex # algorithms. There is a loop, but it will run exactly 5 times when it's needed. # n = int(input()) win = True #assume it's true if(n == 5): #the fail scenarios require exactly 5 edges adj = [0 for i in range(5)] for i in range(5): #create an adjacency list edge = list(map(int, input().split())) adj[edge[0]-1] += 1 adj[edge[1]-1] += 1 if adj.count(2) == 5: #only failure scenario requires everyone has exactly win = False #two acquaintances if(win): print("WIN") else: print("FAIL") ```
3.94853
915
C
Permute Digits
PROGRAMMING
1,700
[ "dp", "greedy" ]
null
null
You are given two positive integer numbers *a* and *b*. Permute (change order) of the digits of *a* to construct maximal number not exceeding *b*. No number in input and/or output can start with the digit 0. It is allowed to leave *a* as it is.
The first line contains integer *a* (1<=≤<=*a*<=≤<=1018). The second line contains integer *b* (1<=≤<=*b*<=≤<=1018). Numbers don't have leading zeroes. It is guaranteed that answer exists.
Print the maximum possible number that is a permutation of digits of *a* and is not greater than *b*. The answer can't have any leading zeroes. It is guaranteed that the answer exists. The number in the output should have exactly the same length as number *a*. It should be a permutation of digits of *a*.
[ "123\n222\n", "3921\n10000\n", "4940\n5000\n" ]
[ "213\n", "9321\n", "4940\n" ]
none
0
[ { "input": "123\n222", "output": "213" }, { "input": "3921\n10000", "output": "9321" }, { "input": "4940\n5000", "output": "4940" }, { "input": "23923472834\n23589234723", "output": "23498743322" }, { "input": "102391019\n491010301", "output": "399211100" }, { "input": "123456789123456789\n276193619183618162", "output": "276193618987554432" }, { "input": "1000000000000000000\n1000000000000000000", "output": "1000000000000000000" }, { "input": "1\n1000000000000000000", "output": "1" }, { "input": "999999999999999999\n1000000000000000000", "output": "999999999999999999" }, { "input": "2475345634895\n3455834583479", "output": "3455834579642" }, { "input": "15778899\n98715689", "output": "98598771" }, { "input": "4555\n5454", "output": "4555" }, { "input": "122112\n221112", "output": "221112" }, { "input": "199999999999991\n191000000000000", "output": "119999999999999" }, { "input": "13\n31", "output": "31" }, { "input": "212\n211", "output": "122" }, { "input": "222234\n322223", "output": "243222" }, { "input": "123456789\n987654311", "output": "987654231" }, { "input": "20123\n21022", "output": "20321" }, { "input": "10101\n11000", "output": "10110" }, { "input": "592\n924", "output": "592" }, { "input": "5654456\n5634565", "output": "5566544" }, { "input": "655432\n421631", "output": "365542" }, { "input": "200\n200", "output": "200" }, { "input": "123456789987654321\n121111111111111111", "output": "119988776655443322" }, { "input": "12345\n21344", "output": "15432" }, { "input": "120\n200", "output": "120" }, { "input": "123\n212", "output": "132" }, { "input": "2184645\n5213118", "output": "5186442" }, { "input": "9912346\n9912345", "output": "9694321" }, { "input": "5003\n5000", "output": "3500" }, { "input": "12345\n31234", "output": "25431" }, { "input": "5001\n5000", "output": "1500" }, { "input": "53436\n53425", "output": "53364" }, { "input": "9329\n3268", "output": "2993" }, { "input": "1234567890\n9000000001", "output": "8976543210" }, { "input": "321\n212", "output": "132" }, { "input": "109823464\n901234467", "output": "896443210" }, { "input": "6543\n6542", "output": "6534" }, { "input": "555441\n555100", "output": "554541" }, { "input": "472389479\n327489423", "output": "327487994" }, { "input": "45645643756464352\n53465475637456247", "output": "53465475636654442" }, { "input": "254\n599", "output": "542" }, { "input": "5232222345652321\n5000000000000000", "output": "4655533322222221" }, { "input": "201\n200", "output": "120" }, { "input": "14362799391220361\n45160821596433661", "output": "43999766332221110" }, { "input": "3453\n5304", "output": "4533" }, { "input": "989\n998", "output": "998" }, { "input": "5200000000234\n5200000000311", "output": "5200000000243" }, { "input": "5555132\n1325442", "output": "1255553" }, { "input": "123\n211", "output": "132" }, { "input": "65689\n66123", "output": "65986" }, { "input": "123451234567890\n123456789012345", "output": "123456789012345" }, { "input": "22115\n22015", "output": "21521" }, { "input": "123\n311", "output": "231" }, { "input": "12222\n21111", "output": "12222" }, { "input": "765\n567", "output": "567" }, { "input": "9087645\n9087640", "output": "9087564" }, { "input": "1111111122222333\n2220000000000000", "output": "2213332221111111" }, { "input": "7901\n7108", "output": "7091" }, { "input": "215489\n215488", "output": "214985" }, { "input": "102\n200", "output": "120" }, { "input": "19260817\n20011213", "output": "19876210" }, { "input": "12345\n53200", "output": "53142" }, { "input": "1040003001\n1040003000", "output": "1040001300" }, { "input": "295\n924", "output": "592" }, { "input": "20000000000000001\n20000000000000000", "output": "12000000000000000" }, { "input": "99988877\n99887766", "output": "99879887" }, { "input": "12\n12", "output": "12" }, { "input": "199999999999999999\n900000000000000000", "output": "199999999999999999" }, { "input": "1234\n4310", "output": "4231" }, { "input": "100011\n100100", "output": "100011" }, { "input": "328899\n328811", "output": "299883" }, { "input": "646722972346\n397619201220", "output": "397476664222" }, { "input": "1203\n1200", "output": "1032" }, { "input": "1\n2", "output": "1" }, { "input": "1112\n2110", "output": "1211" }, { "input": "4545\n5540", "output": "5454" }, { "input": "3053\n5004", "output": "3530" }, { "input": "3503\n5004", "output": "3530" }, { "input": "351731653766064847\n501550303749042658", "output": "501548777666643331" }, { "input": "10123456789013451\n26666666666666666", "output": "26598754433111100" }, { "input": "1110111\n1100000", "output": "1011111" }, { "input": "30478\n32265", "output": "30874" }, { "input": "456546546549874615\n441554543131214545", "output": "441554498766665554" }, { "input": "214\n213", "output": "142" }, { "input": "415335582799619283\n133117803602859310", "output": "132999887655543321" }, { "input": "787\n887", "output": "877" }, { "input": "3333222288889999\n3333222288881111", "output": "3332999988883222" }, { "input": "495779862481416791\n836241745208800994", "output": "829998777665444111" }, { "input": "139\n193", "output": "193" }, { "input": "9568\n6500", "output": "5986" }, { "input": "3208899\n3228811", "output": "3209988" }, { "input": "27778\n28710", "output": "27877" }, { "input": "62345\n46415", "output": "46352" }, { "input": "405739873179209\n596793907108871", "output": "594998777332100" }, { "input": "365\n690", "output": "653" }, { "input": "8388731334391\n4710766672578", "output": "4398887333311" }, { "input": "1230\n1200", "output": "1032" }, { "input": "1025\n5000", "output": "2510" }, { "input": "4207799\n4027711", "output": "2997740" }, { "input": "4444222277779999\n4444222277771111", "output": "4442999977774222" }, { "input": "7430\n3047", "output": "3047" }, { "input": "649675735\n540577056", "output": "539776654" }, { "input": "26\n82", "output": "62" }, { "input": "241285\n207420", "output": "185422" }, { "input": "3\n3", "output": "3" }, { "input": "12\n21", "output": "21" }, { "input": "481287\n826607", "output": "824871" }, { "input": "40572351\n59676984", "output": "57543210" }, { "input": "268135787269\n561193454469", "output": "539887766221" }, { "input": "4\n9", "output": "4" }, { "input": "5\n6", "output": "5" }, { "input": "60579839\n33370073", "output": "30998765" }, { "input": "49939\n39200", "output": "34999" }, { "input": "2224\n4220", "output": "2422" }, { "input": "427799\n427711", "output": "299774" }, { "input": "49\n90", "output": "49" }, { "input": "93875\n82210", "output": "79853" }, { "input": "78831\n7319682", "output": "88731" }, { "input": "937177\n7143444", "output": "977731" }, { "input": "499380628\n391990337", "output": "390988642" }, { "input": "2090909\n2900000", "output": "2099900" }, { "input": "112233445566778890\n987654321987654320", "output": "987654321876543210" }, { "input": "48257086\n80903384", "output": "80876542" }, { "input": "112233445566778890\n900654321987654320", "output": "898776655443322110" }, { "input": "112233445566778890\n123456789123456788", "output": "123456789123456780" }, { "input": "5207799\n5027711", "output": "2997750" }, { "input": "200000000000000001\n200000000000000000", "output": "120000000000000000" }, { "input": "597402457\n797455420", "output": "797455420" }, { "input": "90\n94", "output": "90" }, { "input": "86888\n88683", "output": "86888" }, { "input": "419155888\n588151913", "output": "588151894" }, { "input": "408919130\n191830070", "output": "191830049" }, { "input": "524975\n554924", "output": "554792" }, { "input": "53029\n30524", "output": "30295" }, { "input": "5549\n5542", "output": "5495" }, { "input": "6\n9", "output": "6" }, { "input": "87\n810", "output": "87" }, { "input": "920491855\n281495062", "output": "281495059" }, { "input": "6691\n6910", "output": "6691" }, { "input": "533\n335", "output": "335" }, { "input": "999999999999999998\n999999999999999997", "output": "999999999999999989" }, { "input": "21111111111111111\n21111111111111110", "output": "12111111111111111" }, { "input": "2\n12", "output": "2" }, { "input": "76544\n45744", "output": "45674" }, { "input": "2000000000000001\n2000000000000000", "output": "1200000000000000" }, { "input": "740867\n467701", "output": "467087" }, { "input": "2\n6", "output": "2" }, { "input": "103\n130", "output": "130" }, { "input": "2423712\n8466235", "output": "7432221" }, { "input": "84\n48", "output": "48" }, { "input": "1210\n12113", "output": "2110" }, { "input": "2430\n20786", "output": "4320" }, { "input": "100\n999", "output": "100" }, { "input": "19325\n21903", "output": "21593" }, { "input": "1969\n23251", "output": "9961" } ]
1,617,828,790
2,147,483,647
PyPy 3
OK
TESTS
157
109
1,536,000
from collections import Counter def mx(f): res = [] for k in sorted(f.keys(), reverse=True): for _ in range(f[k]): res.append(k) return res def solve(n, a, b): res = None for k in range(n + 1): aa = Counter(a) cur = [] for i in range(k): if aa[b[i]] == 0: return res cur.append(b[i]) aa[b[i]] -= 1 if k < n: for e in range(b[k] - 1, -1, -1): if aa[e] > 0: cur.append(e) aa[e] -= 1 cur.extend(mx(aa)) break if len(cur) < n: continue res = cur return res a = Counter(map(int, input())) b = list(map(int, input())) if sum(a.values()) < len(b): res = mx(a) else: res = solve(len(b), a, b) print(''.join(map(str, res)))
Title: Permute Digits Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given two positive integer numbers *a* and *b*. Permute (change order) of the digits of *a* to construct maximal number not exceeding *b*. No number in input and/or output can start with the digit 0. It is allowed to leave *a* as it is. Input Specification: The first line contains integer *a* (1<=≤<=*a*<=≤<=1018). The second line contains integer *b* (1<=≤<=*b*<=≤<=1018). Numbers don't have leading zeroes. It is guaranteed that answer exists. Output Specification: Print the maximum possible number that is a permutation of digits of *a* and is not greater than *b*. The answer can't have any leading zeroes. It is guaranteed that the answer exists. The number in the output should have exactly the same length as number *a*. It should be a permutation of digits of *a*. Demo Input: ['123\n222\n', '3921\n10000\n', '4940\n5000\n'] Demo Output: ['213\n', '9321\n', '4940\n'] Note: none
```python from collections import Counter def mx(f): res = [] for k in sorted(f.keys(), reverse=True): for _ in range(f[k]): res.append(k) return res def solve(n, a, b): res = None for k in range(n + 1): aa = Counter(a) cur = [] for i in range(k): if aa[b[i]] == 0: return res cur.append(b[i]) aa[b[i]] -= 1 if k < n: for e in range(b[k] - 1, -1, -1): if aa[e] > 0: cur.append(e) aa[e] -= 1 cur.extend(mx(aa)) break if len(cur) < n: continue res = cur return res a = Counter(map(int, input())) b = list(map(int, input())) if sum(a.values()) < len(b): res = mx(a) else: res = solve(len(b), a, b) print(''.join(map(str, res))) ```
3
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,644,036,557
2,147,483,647
Python 3
OK
TESTS
30
92
0
string=input() cnt1 = 0 cnt2 = 0 for i in string: if(i.islower()): cnt1=cnt1+1 elif(i.isupper()): cnt2 = cnt2+1 if cnt1 > cnt2: print(string.lower()) elif cnt1 < cnt2 : print(string.upper()) else: print(string.lower())
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python string=input() cnt1 = 0 cnt2 = 0 for i in string: if(i.islower()): cnt1=cnt1+1 elif(i.isupper()): cnt2 = cnt2+1 if cnt1 > cnt2: print(string.lower()) elif cnt1 < cnt2 : print(string.upper()) else: print(string.lower()) ```
3.977
48
A
Rock-paper-scissors
PROGRAMMING
900
[ "implementation", "schedules" ]
A. Rock-paper-scissors
2
256
Uncle Fyodor, Matroskin the Cat and Sharic the Dog live their simple but happy lives in Prostokvashino. Sometimes they receive parcels from Uncle Fyodor’s parents and sometimes from anonymous benefactors, in which case it is hard to determine to which one of them the package has been sent. A photographic rifle is obviously for Sharic who loves hunting and fish is for Matroskin, but for whom was a new video game console meant? Every one of the three friends claimed that the present is for him and nearly quarreled. Uncle Fyodor had an idea how to solve the problem justly: they should suppose that the console was sent to all three of them and play it in turns. Everybody got relieved but then yet another burning problem popped up — who will play first? This time Matroskin came up with a brilliant solution, suggesting the most fair way to find it out: play rock-paper-scissors together. The rules of the game are very simple. On the count of three every player shows a combination with his hand (or paw). The combination corresponds to one of three things: a rock, scissors or paper. Some of the gestures win over some other ones according to well-known rules: the rock breaks the scissors, the scissors cut the paper, and the paper gets wrapped over the stone. Usually there are two players. Yet there are three friends, that’s why they decided to choose the winner like that: If someone shows the gesture that wins over the other two players, then that player wins. Otherwise, another game round is required. Write a program that will determine the winner by the gestures they have shown.
The first input line contains the name of the gesture that Uncle Fyodor showed, the second line shows which gesture Matroskin showed and the third line shows Sharic’s gesture.
Print "F" (without quotes) if Uncle Fyodor wins. Print "M" if Matroskin wins and "S" if Sharic wins. If it is impossible to find the winner, print "?".
[ "rock\nrock\nrock\n", "paper\nrock\nrock\n", "scissors\nrock\nrock\n", "scissors\npaper\nrock\n" ]
[ "?\n", "F\n", "?\n", "?\n" ]
none
0
[ { "input": "rock\nrock\nrock", "output": "?" }, { "input": "paper\nrock\nrock", "output": "F" }, { "input": "scissors\nrock\nrock", "output": "?" }, { "input": "scissors\npaper\nrock", "output": "?" }, { "input": "paper\npaper\nrock", "output": "?" }, { "input": "rock\npaper\nrock", "output": "M" }, { "input": "rock\nscissors\nrock", "output": "?" }, { "input": "paper\nscissors\nrock", "output": "?" }, { "input": "scissors\nscissors\nrock", "output": "S" }, { "input": "rock\nrock\npaper", "output": "S" }, { "input": "paper\nrock\npaper", "output": "?" }, { "input": "scissors\nrock\npaper", "output": "?" }, { "input": "rock\npaper\npaper", "output": "?" }, { "input": "paper\npaper\npaper", "output": "?" }, { "input": "scissors\npaper\npaper", "output": "F" }, { "input": "rock\nscissors\npaper", "output": "?" }, { "input": "paper\nscissors\npaper", "output": "M" }, { "input": "scissors\nscissors\npaper", "output": "?" }, { "input": "rock\nrock\nscissors", "output": "?" }, { "input": "paper\nrock\nscissors", "output": "?" }, { "input": "scissors\nrock\nscissors", "output": "M" }, { "input": "rock\npaper\nscissors", "output": "?" }, { "input": "paper\npaper\nscissors", "output": "S" }, { "input": "scissors\npaper\nscissors", "output": "?" }, { "input": "rock\nscissors\nscissors", "output": "F" }, { "input": "paper\nscissors\nscissors", "output": "?" }, { "input": "scissors\nscissors\nscissors", "output": "?" } ]
1,555,102,560
2,147,483,647
Python 3
OK
TESTS
27
216
0
ROCK = "rock" PAPER = "paper" SCISSORS = "scissors" SCORE = {ROCK: 0, PAPER: 1, SCISSORS: 2} fyodor = SCORE[input()] matroskin = SCORE[input()] sharic = SCORE[input()] def wins(move1, move2): return (3 + move1 - move2) % 3 == 1 if wins(fyodor, matroskin) and wins(fyodor, sharic): print("F") elif wins(matroskin, fyodor) and wins(matroskin, sharic): print("M") elif wins(sharic, fyodor) and wins(sharic, matroskin): print("S") else: print("?")
Title: Rock-paper-scissors Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Uncle Fyodor, Matroskin the Cat and Sharic the Dog live their simple but happy lives in Prostokvashino. Sometimes they receive parcels from Uncle Fyodor’s parents and sometimes from anonymous benefactors, in which case it is hard to determine to which one of them the package has been sent. A photographic rifle is obviously for Sharic who loves hunting and fish is for Matroskin, but for whom was a new video game console meant? Every one of the three friends claimed that the present is for him and nearly quarreled. Uncle Fyodor had an idea how to solve the problem justly: they should suppose that the console was sent to all three of them and play it in turns. Everybody got relieved but then yet another burning problem popped up — who will play first? This time Matroskin came up with a brilliant solution, suggesting the most fair way to find it out: play rock-paper-scissors together. The rules of the game are very simple. On the count of three every player shows a combination with his hand (or paw). The combination corresponds to one of three things: a rock, scissors or paper. Some of the gestures win over some other ones according to well-known rules: the rock breaks the scissors, the scissors cut the paper, and the paper gets wrapped over the stone. Usually there are two players. Yet there are three friends, that’s why they decided to choose the winner like that: If someone shows the gesture that wins over the other two players, then that player wins. Otherwise, another game round is required. Write a program that will determine the winner by the gestures they have shown. Input Specification: The first input line contains the name of the gesture that Uncle Fyodor showed, the second line shows which gesture Matroskin showed and the third line shows Sharic’s gesture. Output Specification: Print "F" (without quotes) if Uncle Fyodor wins. Print "M" if Matroskin wins and "S" if Sharic wins. If it is impossible to find the winner, print "?". Demo Input: ['rock\nrock\nrock\n', 'paper\nrock\nrock\n', 'scissors\nrock\nrock\n', 'scissors\npaper\nrock\n'] Demo Output: ['?\n', 'F\n', '?\n', '?\n'] Note: none
```python ROCK = "rock" PAPER = "paper" SCISSORS = "scissors" SCORE = {ROCK: 0, PAPER: 1, SCISSORS: 2} fyodor = SCORE[input()] matroskin = SCORE[input()] sharic = SCORE[input()] def wins(move1, move2): return (3 + move1 - move2) % 3 == 1 if wins(fyodor, matroskin) and wins(fyodor, sharic): print("F") elif wins(matroskin, fyodor) and wins(matroskin, sharic): print("M") elif wins(sharic, fyodor) and wins(sharic, matroskin): print("S") else: print("?") ```
3.946
119
A
Epic Game
PROGRAMMING
800
[ "implementation" ]
null
null
Simon and Antisimon play a game. Initially each player receives one fixed positive integer that doesn't change throughout the game. Simon receives number *a* and Antisimon receives number *b*. They also have a heap of *n* stones. The players take turns to make a move and Simon starts. During a move a player should take from the heap the number of stones equal to the greatest common divisor of the fixed number he has received and the number of stones left in the heap. A player loses when he cannot take the required number of stones (i. e. the heap has strictly less stones left than one needs to take). Your task is to determine by the given *a*, *b* and *n* who wins the game.
The only string contains space-separated integers *a*, *b* and *n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=100) — the fixed numbers Simon and Antisimon have received correspondingly and the initial number of stones in the pile.
If Simon wins, print "0" (without the quotes), otherwise print "1" (without the quotes).
[ "3 5 9\n", "1 1 100\n" ]
[ "0", "1" ]
The greatest common divisor of two non-negative integers *a* and *b* is such maximum positive integer *k*, that *a* is divisible by *k* without remainder and similarly, *b* is divisible by *k* without remainder. Let *gcd*(*a*, *b*) represent the operation of calculating the greatest common divisor of numbers *a* and *b*. Specifically, *gcd*(*x*, 0) = *gcd*(0, *x*) = *x*. In the first sample the game will go like that: - Simon should take *gcd*(3, 9) = 3 stones from the heap. After his move the heap has 6 stones left.- Antisimon should take *gcd*(5, 6) = 1 stone from the heap. After his move the heap has 5 stones left.- Simon should take *gcd*(3, 5) = 1 stone from the heap. After his move the heap has 4 stones left.- Antisimon should take *gcd*(5, 4) = 1 stone from the heap. After his move the heap has 3 stones left.- Simon should take *gcd*(3, 3) = 3 stones from the heap. After his move the heap has 0 stones left.- Antisimon should take *gcd*(5, 0) = 5 stones from the heap. As 0 &lt; 5, it is impossible and Antisimon loses. In the second sample each player during each move takes one stone from the heap. As *n* is even, Antisimon takes the last stone and Simon can't make a move after that.
500
[ { "input": "3 5 9", "output": "0" }, { "input": "1 1 100", "output": "1" }, { "input": "23 12 16", "output": "1" }, { "input": "95 26 29", "output": "1" }, { "input": "73 32 99", "output": "1" }, { "input": "1 1 1", "output": "0" }, { "input": "41 12 65", "output": "1" }, { "input": "13 61 100", "output": "1" }, { "input": "100 100 10", "output": "0" }, { "input": "12 24 26", "output": "1" }, { "input": "73 21 96", "output": "1" }, { "input": "17 22 81", "output": "1" }, { "input": "14 88 97", "output": "1" }, { "input": "42 81 17", "output": "0" }, { "input": "34 36 19", "output": "1" }, { "input": "21 87 12", "output": "1" }, { "input": "97 92 98", "output": "1" }, { "input": "49 25 62", "output": "1" }, { "input": "29 17 44", "output": "1" }, { "input": "10 1 10", "output": "0" }, { "input": "99 98 100", "output": "1" }, { "input": "100 100 1", "output": "0" }, { "input": "11 99 55", "output": "0" }, { "input": "8 13 21", "output": "0" }, { "input": "34 55 89", "output": "0" }, { "input": "21 34 55", "output": "1" }, { "input": "13 21 34", "output": "1" }, { "input": "34 21 55", "output": "0" }, { "input": "10 20 84", "output": "1" }, { "input": "4 2 5", "output": "0" }, { "input": "3 2 3", "output": "0" }, { "input": "31 23 1", "output": "0" }, { "input": "100 100 100", "output": "0" }, { "input": "100 1 100", "output": "0" }, { "input": "1 100 100", "output": "1" }, { "input": "1 1 100", "output": "1" }, { "input": "17 23 100", "output": "1" }, { "input": "99 98 100", "output": "1" }, { "input": "1 1 2", "output": "1" }, { "input": "2 1 1", "output": "0" }, { "input": "1 2 1", "output": "0" }, { "input": "2 1 2", "output": "0" }, { "input": "10 10 3", "output": "1" }, { "input": "2 2 1", "output": "0" }, { "input": "9 5 1", "output": "0" } ]
1,571,807,542
2,147,483,647
Python 3
OK
TESTS
45
218
0
def gcd(a,b): if a==0: return b else: return gcd(b%a,a) (a,b,n)=map(int,input().split()) f=0 while n>0: n-=gcd(a,n) if(n<=0): f=0 break n-=gcd(b,n) if(n<=0): f=1 break print(f)
Title: Epic Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Simon and Antisimon play a game. Initially each player receives one fixed positive integer that doesn't change throughout the game. Simon receives number *a* and Antisimon receives number *b*. They also have a heap of *n* stones. The players take turns to make a move and Simon starts. During a move a player should take from the heap the number of stones equal to the greatest common divisor of the fixed number he has received and the number of stones left in the heap. A player loses when he cannot take the required number of stones (i. e. the heap has strictly less stones left than one needs to take). Your task is to determine by the given *a*, *b* and *n* who wins the game. Input Specification: The only string contains space-separated integers *a*, *b* and *n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=100) — the fixed numbers Simon and Antisimon have received correspondingly and the initial number of stones in the pile. Output Specification: If Simon wins, print "0" (without the quotes), otherwise print "1" (without the quotes). Demo Input: ['3 5 9\n', '1 1 100\n'] Demo Output: ['0', '1'] Note: The greatest common divisor of two non-negative integers *a* and *b* is such maximum positive integer *k*, that *a* is divisible by *k* without remainder and similarly, *b* is divisible by *k* without remainder. Let *gcd*(*a*, *b*) represent the operation of calculating the greatest common divisor of numbers *a* and *b*. Specifically, *gcd*(*x*, 0) = *gcd*(0, *x*) = *x*. In the first sample the game will go like that: - Simon should take *gcd*(3, 9) = 3 stones from the heap. After his move the heap has 6 stones left.- Antisimon should take *gcd*(5, 6) = 1 stone from the heap. After his move the heap has 5 stones left.- Simon should take *gcd*(3, 5) = 1 stone from the heap. After his move the heap has 4 stones left.- Antisimon should take *gcd*(5, 4) = 1 stone from the heap. After his move the heap has 3 stones left.- Simon should take *gcd*(3, 3) = 3 stones from the heap. After his move the heap has 0 stones left.- Antisimon should take *gcd*(5, 0) = 5 stones from the heap. As 0 &lt; 5, it is impossible and Antisimon loses. In the second sample each player during each move takes one stone from the heap. As *n* is even, Antisimon takes the last stone and Simon can't make a move after that.
```python def gcd(a,b): if a==0: return b else: return gcd(b%a,a) (a,b,n)=map(int,input().split()) f=0 while n>0: n-=gcd(a,n) if(n<=0): f=0 break n-=gcd(b,n) if(n<=0): f=1 break print(f) ```
3
682
A
Alyona and Numbers
PROGRAMMING
1,100
[ "constructive algorithms", "math", "number theory" ]
null
null
After finishing eating her bun, Alyona came up with two integers *n* and *m*. She decided to write down two columns of integers — the first column containing integers from 1 to *n* and the second containing integers from 1 to *m*. Now the girl wants to count how many pairs of integers she can choose, one from the first column and the other from the second column, such that their sum is divisible by 5. Formally, Alyona wants to count the number of pairs of integers (*x*,<=*y*) such that 1<=≤<=*x*<=≤<=*n*, 1<=≤<=*y*<=≤<=*m* and equals 0. As usual, Alyona has some troubles and asks you to help.
The only line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1<=000<=000).
Print the only integer — the number of pairs of integers (*x*,<=*y*) such that 1<=≤<=*x*<=≤<=*n*, 1<=≤<=*y*<=≤<=*m* and (*x*<=+<=*y*) is divisible by 5.
[ "6 12\n", "11 14\n", "1 5\n", "3 8\n", "5 7\n", "21 21\n" ]
[ "14\n", "31\n", "1\n", "5\n", "7\n", "88\n" ]
Following pairs are suitable in the first sample case: - for *x* = 1 fits *y* equal to 4 or 9; - for *x* = 2 fits *y* equal to 3 or 8; - for *x* = 3 fits *y* equal to 2, 7 or 12; - for *x* = 4 fits *y* equal to 1, 6 or 11; - for *x* = 5 fits *y* equal to 5 or 10; - for *x* = 6 fits *y* equal to 4 or 9. Only the pair (1, 4) is suitable in the third sample case.
500
[ { "input": "6 12", "output": "14" }, { "input": "11 14", "output": "31" }, { "input": "1 5", "output": "1" }, { "input": "3 8", "output": "5" }, { "input": "5 7", "output": "7" }, { "input": "21 21", "output": "88" }, { "input": "10 15", "output": "30" }, { "input": "1 1", "output": "0" }, { "input": "1 1000000", "output": "200000" }, { "input": "1000000 1", "output": "200000" }, { "input": "1000000 1000000", "output": "200000000000" }, { "input": "944 844", "output": "159348" }, { "input": "368 984", "output": "72423" }, { "input": "792 828", "output": "131155" }, { "input": "920 969", "output": "178296" }, { "input": "640 325", "output": "41600" }, { "input": "768 170", "output": "26112" }, { "input": "896 310", "output": "55552" }, { "input": "320 154", "output": "9856" }, { "input": "744 999", "output": "148652" }, { "input": "630 843", "output": "106218" }, { "input": "54 688", "output": "7431" }, { "input": "478 828", "output": "79157" }, { "input": "902 184", "output": "33194" }, { "input": "31 29", "output": "180" }, { "input": "751 169", "output": "25384" }, { "input": "879 14", "output": "2462" }, { "input": "7 858", "output": "1201" }, { "input": "431 702", "output": "60512" }, { "input": "855 355", "output": "60705" }, { "input": "553 29", "output": "3208" }, { "input": "721767 525996", "output": "75929310986" }, { "input": "805191 74841", "output": "12052259926" }, { "input": "888615 590981", "output": "105030916263" }, { "input": "4743 139826", "output": "132638943" }, { "input": "88167 721374", "output": "12720276292" }, { "input": "171591 13322", "output": "457187060" }, { "input": "287719 562167", "output": "32349225415" }, { "input": "371143 78307", "output": "5812618980" }, { "input": "487271 627151", "output": "61118498984" }, { "input": "261436 930642", "output": "48660664382" }, { "input": "377564 446782", "output": "33737759810" }, { "input": "460988 28330", "output": "2611958008" }, { "input": "544412 352983", "output": "38433636199" }, { "input": "660540 869123", "output": "114818101284" }, { "input": "743964 417967", "output": "62190480238" }, { "input": "827388 966812", "output": "159985729411" }, { "input": "910812 515656", "output": "93933134534" }, { "input": "26940 64501", "output": "347531388" }, { "input": "110364 356449", "output": "7867827488" }, { "input": "636358 355531", "output": "45248999219" }, { "input": "752486 871672", "output": "131184195318" }, { "input": "803206 420516", "output": "67552194859" }, { "input": "919334 969361", "output": "178233305115" }, { "input": "35462 261309", "output": "1853307952" }, { "input": "118887 842857", "output": "20040948031" }, { "input": "202311 358998", "output": "14525848875" }, { "input": "285735 907842", "output": "51880446774" }, { "input": "401863 456686", "output": "36705041203" }, { "input": "452583 972827", "output": "88056992428" }, { "input": "235473 715013", "output": "33673251230" }, { "input": "318897 263858", "output": "16828704925" }, { "input": "402321 812702", "output": "65393416268" }, { "input": "518449 361546", "output": "37488632431" }, { "input": "634577 910391", "output": "115542637921" }, { "input": "685297 235043", "output": "32214852554" }, { "input": "801425 751183", "output": "120403367155" }, { "input": "884849 300028", "output": "53095895155" }, { "input": "977 848872", "output": "165869588" }, { "input": "51697 397716", "output": "4112144810" }, { "input": "834588 107199", "output": "17893399803" }, { "input": "918012 688747", "output": "126455602192" }, { "input": "1436 237592", "output": "68236422" }, { "input": "117564 753732", "output": "17722349770" }, { "input": "200988 302576", "output": "12162829017" }, { "input": "284412 818717", "output": "46570587880" }, { "input": "400540 176073", "output": "14104855884" }, { "input": "483964 724917", "output": "70166746198" }, { "input": "567388 241058", "output": "27354683301" }, { "input": "650812 789902", "output": "102815540084" }, { "input": "400999 756281", "output": "60653584944" }, { "input": "100 101", "output": "2020" }, { "input": "100 102", "output": "2040" }, { "input": "103 100", "output": "2060" }, { "input": "100 104", "output": "2080" }, { "input": "3 4", "output": "3" }, { "input": "11 23", "output": "50" }, { "input": "8 14", "output": "23" }, { "input": "23423 34234", "output": "160372597" }, { "input": "1 4", "output": "1" }, { "input": "999999 999999", "output": "199999600001" }, { "input": "82 99", "output": "1624" }, { "input": "21 18", "output": "75" }, { "input": "234 234", "output": "10952" }, { "input": "4 4", "output": "4" }, { "input": "6 13", "output": "15" }, { "input": "3 9", "output": "6" }, { "input": "99999 99999", "output": "1999960001" }, { "input": "34 33", "output": "225" }, { "input": "2 2", "output": "0" }, { "input": "333 1", "output": "66" }, { "input": "3 3", "output": "2" }, { "input": "8 2", "output": "3" }, { "input": "2179 2218", "output": "966605" }, { "input": "1000000 999999", "output": "199999800000" }, { "input": "873828 774207", "output": "135304750879" }, { "input": "13 19", "output": "50" }, { "input": "1648 576469", "output": "190004183" }, { "input": "11 13", "output": "28" }, { "input": "5 8", "output": "8" }, { "input": "650074 943659", "output": "122689636154" }, { "input": "1 3", "output": "0" }, { "input": "54 43", "output": "465" }, { "input": "14 9", "output": "26" }, { "input": "2 3", "output": "1" }, { "input": "543 534", "output": "57993" }, { "input": "321 123", "output": "7896" }, { "input": "21 3", "output": "12" }, { "input": "2 1", "output": "0" }, { "input": "4 3", "output": "3" }, { "input": "47474 74747", "output": "709707816" }, { "input": "4 9", "output": "8" }, { "input": "7 4", "output": "6" }, { "input": "9 4", "output": "8" }, { "input": "12414 4214", "output": "10462520" }, { "input": "2 9", "output": "4" }, { "input": "253 821", "output": "41542" }, { "input": "2 4", "output": "2" } ]
1,671,909,523
2,147,483,647
Python 3
OK
TESTS
128
499
0
n, m = map(int, input().split()) x = [0, 0, 0, 0, 0] y = [0, 0, 0, 0, 0] for i in range(1, n+1): x[i%5] += 1 for i in range(1, m+1): y[i%5] += 1 print(x[1]*y[4] + x[2]*y[3] + x[3]*y[2] + x[4]*y[1] + x[0]*y[0])
Title: Alyona and Numbers Time Limit: None seconds Memory Limit: None megabytes Problem Description: After finishing eating her bun, Alyona came up with two integers *n* and *m*. She decided to write down two columns of integers — the first column containing integers from 1 to *n* and the second containing integers from 1 to *m*. Now the girl wants to count how many pairs of integers she can choose, one from the first column and the other from the second column, such that their sum is divisible by 5. Formally, Alyona wants to count the number of pairs of integers (*x*,<=*y*) such that 1<=≤<=*x*<=≤<=*n*, 1<=≤<=*y*<=≤<=*m* and equals 0. As usual, Alyona has some troubles and asks you to help. Input Specification: The only line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1<=000<=000). Output Specification: Print the only integer — the number of pairs of integers (*x*,<=*y*) such that 1<=≤<=*x*<=≤<=*n*, 1<=≤<=*y*<=≤<=*m* and (*x*<=+<=*y*) is divisible by 5. Demo Input: ['6 12\n', '11 14\n', '1 5\n', '3 8\n', '5 7\n', '21 21\n'] Demo Output: ['14\n', '31\n', '1\n', '5\n', '7\n', '88\n'] Note: Following pairs are suitable in the first sample case: - for *x* = 1 fits *y* equal to 4 or 9; - for *x* = 2 fits *y* equal to 3 or 8; - for *x* = 3 fits *y* equal to 2, 7 or 12; - for *x* = 4 fits *y* equal to 1, 6 or 11; - for *x* = 5 fits *y* equal to 5 or 10; - for *x* = 6 fits *y* equal to 4 or 9. Only the pair (1, 4) is suitable in the third sample case.
```python n, m = map(int, input().split()) x = [0, 0, 0, 0, 0] y = [0, 0, 0, 0, 0] for i in range(1, n+1): x[i%5] += 1 for i in range(1, m+1): y[i%5] += 1 print(x[1]*y[4] + x[2]*y[3] + x[3]*y[2] + x[4]*y[1] + x[0]*y[0]) ```
3
408
B
Garland
PROGRAMMING
1,200
[ "implementation" ]
null
null
Once little Vasya read an article in a magazine on how to make beautiful handmade garland from colored paper. Vasya immediately went to the store and bought *n* colored sheets of paper, the area of each sheet is 1 square meter. The garland must consist of exactly *m* pieces of colored paper of arbitrary area, each piece should be of a certain color. To make the garland, Vasya can arbitrarily cut his existing colored sheets into pieces. Vasya is not obliged to use all the sheets to make the garland. Vasya wants the garland to be as attractive as possible, so he wants to maximize the total area of ​​*m* pieces of paper in the garland. Calculate what the maximum total area of ​​the pieces of paper in the garland Vasya can get.
The first line contains a non-empty sequence of *n* (1<=≤<=*n*<=≤<=1000) small English letters ("a"..."z"). Each letter means that Vasya has a sheet of paper of the corresponding color. The second line contains a non-empty sequence of *m* (1<=≤<=*m*<=≤<=1000) small English letters that correspond to the colors of the pieces of paper in the garland that Vasya wants to make.
Print an integer that is the maximum possible total area of the pieces of paper in the garland Vasya wants to get or -1, if it is impossible to make the garland from the sheets he's got. It is guaranteed that the answer is always an integer.
[ "aaabbac\naabbccac\n", "a\nz\n" ]
[ "6\n", "-1" ]
In the first test sample Vasya can make an garland of area 6: he can use both sheets of color *b*, three (but not four) sheets of color *a* and cut a single sheet of color *c* in three, for example, equal pieces. Vasya can use the resulting pieces to make a garland of area 6. In the second test sample Vasya cannot make a garland at all — he doesn't have a sheet of color *z*.
1,000
[ { "input": "aaabbac\naabbccac", "output": "6" }, { "input": "a\nz", "output": "-1" }, { "input": "r\nr", "output": "1" }, { "input": "stnsdn\nndnndsn", "output": "4" }, { "input": "yqfqfp\ntttwtqq", "output": "-1" }, { "input": "zzbbrrtrtzr\ntbbtrrrzr", "output": "9" }, { "input": "ivvfisvsvii\npaihjinno", "output": "-1" }, { "input": "zbvwnlgkshqerxptyod\nz", "output": "1" }, { "input": "xlktwjymocqrahnbesf\nfoo", "output": "2" }, { "input": "bbzmzqazmbambnmzaabznmbabzqnaabmabmnnabbmnzaanzzezebzabqaabzqaemeqqammmbazmmz\naznnbbmeebmanbeemzmemqbaeebnqenqzzbanebmnzqqebqmmnmqqzmmeqqqaaezemmazqqmqaqnnqqzbzeeazammmenbbamzbmnaenemenaaaebnmanebqmqnznqbenmqqnnnaeaebqmamennmqqeaaqqbammnzqmnmqnqbbezmemznqmanzmmqzzzzembqnzqbanamezqaqbazenenqqznqaebzaeezbqqbmeeaqnmmbnqbbnmaqqemaeaezaabmbnbzzaae", "output": "77" }, { "input": "lccfdfnfflncddlksndcwnfcllnnaswcdnldafcalssfcdnkkaklwnnacsncfwanwnwfadawcsdcfwflnnlfsfclkfknlaldna\nuaaldlllhedgugugueahddhedbuddaedhaaeugdubaealbgbagedldbl", "output": "-1" }, { "input": "hvewdvwdwudrwarwmddwnazmwauzatrmwptwwevavpmwrtruwnpwantewrnwmepdwvtmnveanunrvrtwpvhhnuhnmpptdttzmmndtvudmzhhannmmnahdpzamuvhzaavnhtnumwrwvttdetvuewaaennddwuvzvaptdzrzhtetwwzmzedrwuvrwznprhdvnavrruvvhzuwpdtmpwmzrwvermrhdamv\nuvzhwtpuputnahwwarduzddhpnwwvettprwavdmnztdnrddmarmvuevtdezndnezvarhmppwwnmvnrtddzhhnzrwuhvpwmezuurundarwdazwptrpeurrnwautddnhdmhtwhwvvtavdzezumetzezpazndhuentmrhamutrtttpevtuutemdnvwnwnmnvmznatneweuaahdavmaddhnrdenwwztrwh", "output": "199" }, { "input": "aaccddff\nabcdf", "output": "-1" } ]
1,698,009,763
2,147,483,647
PyPy 3-64
OK
TESTS
21
62
0
# https://codeforces.com/contest/408 import sys input = lambda: sys.stdin.readline().rstrip() # faster! has = [0] * 26 for c in input(): has[ord(c) - ord("a")] += 1 wants = [0] * 26 for c in input(): wants[ord(c) - ord("a")] += 1 ans = 0 for i in range(26): if wants[i] > 0 and has[i] == 0: print(-1) exit() ans += min(wants[i], has[i]) print(ans)
Title: Garland Time Limit: None seconds Memory Limit: None megabytes Problem Description: Once little Vasya read an article in a magazine on how to make beautiful handmade garland from colored paper. Vasya immediately went to the store and bought *n* colored sheets of paper, the area of each sheet is 1 square meter. The garland must consist of exactly *m* pieces of colored paper of arbitrary area, each piece should be of a certain color. To make the garland, Vasya can arbitrarily cut his existing colored sheets into pieces. Vasya is not obliged to use all the sheets to make the garland. Vasya wants the garland to be as attractive as possible, so he wants to maximize the total area of ​​*m* pieces of paper in the garland. Calculate what the maximum total area of ​​the pieces of paper in the garland Vasya can get. Input Specification: The first line contains a non-empty sequence of *n* (1<=≤<=*n*<=≤<=1000) small English letters ("a"..."z"). Each letter means that Vasya has a sheet of paper of the corresponding color. The second line contains a non-empty sequence of *m* (1<=≤<=*m*<=≤<=1000) small English letters that correspond to the colors of the pieces of paper in the garland that Vasya wants to make. Output Specification: Print an integer that is the maximum possible total area of the pieces of paper in the garland Vasya wants to get or -1, if it is impossible to make the garland from the sheets he's got. It is guaranteed that the answer is always an integer. Demo Input: ['aaabbac\naabbccac\n', 'a\nz\n'] Demo Output: ['6\n', '-1'] Note: In the first test sample Vasya can make an garland of area 6: he can use both sheets of color *b*, three (but not four) sheets of color *a* and cut a single sheet of color *c* in three, for example, equal pieces. Vasya can use the resulting pieces to make a garland of area 6. In the second test sample Vasya cannot make a garland at all — he doesn't have a sheet of color *z*.
```python # https://codeforces.com/contest/408 import sys input = lambda: sys.stdin.readline().rstrip() # faster! has = [0] * 26 for c in input(): has[ord(c) - ord("a")] += 1 wants = [0] * 26 for c in input(): wants[ord(c) - ord("a")] += 1 ans = 0 for i in range(26): if wants[i] > 0 and has[i] == 0: print(-1) exit() ans += min(wants[i], has[i]) print(ans) ```
3
387
A
George and Sleep
PROGRAMMING
900
[ "implementation" ]
null
null
George woke up and saw the current time *s* on the digital clock. Besides, George knows that he has slept for time *t*. Help George! Write a program that will, given time *s* and *t*, determine the time *p* when George went to bed. Note that George could have gone to bed yesterday relatively to the current time (see the second test sample).
The first line contains current time *s* as a string in the format "hh:mm". The second line contains time *t* in the format "hh:mm" — the duration of George's sleep. It is guaranteed that the input contains the correct time in the 24-hour format, that is, 00<=≤<=*hh*<=≤<=23, 00<=≤<=*mm*<=≤<=59.
In the single line print time *p* — the time George went to bed in the format similar to the format of the time in the input.
[ "05:50\n05:44\n", "00:00\n01:00\n", "00:01\n00:00\n" ]
[ "00:06\n", "23:00\n", "00:01\n" ]
In the first sample George went to bed at "00:06". Note that you should print the time only in the format "00:06". That's why answers "0:06", "00:6" and others will be considered incorrect. In the second sample, George went to bed yesterday. In the third sample, George didn't do to bed at all.
500
[ { "input": "05:50\n05:44", "output": "00:06" }, { "input": "00:00\n01:00", "output": "23:00" }, { "input": "00:01\n00:00", "output": "00:01" }, { "input": "23:59\n23:59", "output": "00:00" }, { "input": "23:44\n23:55", "output": "23:49" }, { "input": "00:00\n13:12", "output": "10:48" }, { "input": "12:00\n23:59", "output": "12:01" }, { "input": "12:44\n12:44", "output": "00:00" }, { "input": "05:55\n07:12", "output": "22:43" }, { "input": "07:12\n05:55", "output": "01:17" }, { "input": "22:22\n22:22", "output": "00:00" }, { "input": "22:22\n22:23", "output": "23:59" }, { "input": "23:24\n23:23", "output": "00:01" }, { "input": "00:00\n00:00", "output": "00:00" }, { "input": "23:30\n00:00", "output": "23:30" }, { "input": "01:00\n00:00", "output": "01:00" }, { "input": "05:44\n06:00", "output": "23:44" }, { "input": "00:00\n23:59", "output": "00:01" }, { "input": "21:00\n01:00", "output": "20:00" }, { "input": "21:21\n12:21", "output": "09:00" }, { "input": "12:21\n21:12", "output": "15:09" }, { "input": "12:33\n23:33", "output": "13:00" }, { "input": "07:55\n05:53", "output": "02:02" }, { "input": "19:30\n02:00", "output": "17:30" }, { "input": "21:30\n02:00", "output": "19:30" }, { "input": "19:30\n09:30", "output": "10:00" }, { "input": "13:08\n00:42", "output": "12:26" }, { "input": "13:04\n09:58", "output": "03:06" }, { "input": "21:21\n23:06", "output": "22:15" }, { "input": "20:53\n10:23", "output": "10:30" }, { "input": "12:59\n00:45", "output": "12:14" }, { "input": "12:39\n22:21", "output": "14:18" }, { "input": "21:10\n13:50", "output": "07:20" }, { "input": "03:38\n23:46", "output": "03:52" }, { "input": "03:48\n00:41", "output": "03:07" }, { "input": "07:43\n12:27", "output": "19:16" }, { "input": "03:23\n08:52", "output": "18:31" }, { "input": "16:04\n10:28", "output": "05:36" }, { "input": "12:53\n08:37", "output": "04:16" }, { "input": "13:43\n17:23", "output": "20:20" }, { "input": "00:00\n00:01", "output": "23:59" }, { "input": "10:10\n01:01", "output": "09:09" }, { "input": "10:05\n00:00", "output": "10:05" }, { "input": "09:09\n00:00", "output": "09:09" }, { "input": "09:10\n00:01", "output": "09:09" }, { "input": "23:24\n00:28", "output": "22:56" }, { "input": "10:00\n01:00", "output": "09:00" } ]
1,594,233,714
2,147,483,647
PyPy 3
OK
TESTS
47
140
20,172,800
s = input() t = input() mms = int(s[:2]) * 60 + int(s[3:]) mmt = int(t[:2]) * 60 + int(t[3:]) diff = (mms + 1440 - mmt) % 1440 h = diff // 60 m = diff % 60 print(str(h).zfill(2) + ':' + str(m).zfill(2))
Title: George and Sleep Time Limit: None seconds Memory Limit: None megabytes Problem Description: George woke up and saw the current time *s* on the digital clock. Besides, George knows that he has slept for time *t*. Help George! Write a program that will, given time *s* and *t*, determine the time *p* when George went to bed. Note that George could have gone to bed yesterday relatively to the current time (see the second test sample). Input Specification: The first line contains current time *s* as a string in the format "hh:mm". The second line contains time *t* in the format "hh:mm" — the duration of George's sleep. It is guaranteed that the input contains the correct time in the 24-hour format, that is, 00<=≤<=*hh*<=≤<=23, 00<=≤<=*mm*<=≤<=59. Output Specification: In the single line print time *p* — the time George went to bed in the format similar to the format of the time in the input. Demo Input: ['05:50\n05:44\n', '00:00\n01:00\n', '00:01\n00:00\n'] Demo Output: ['00:06\n', '23:00\n', '00:01\n'] Note: In the first sample George went to bed at "00:06". Note that you should print the time only in the format "00:06". That's why answers "0:06", "00:6" and others will be considered incorrect. In the second sample, George went to bed yesterday. In the third sample, George didn't do to bed at all.
```python s = input() t = input() mms = int(s[:2]) * 60 + int(s[3:]) mmt = int(t[:2]) * 60 + int(t[3:]) diff = (mms + 1440 - mmt) % 1440 h = diff // 60 m = diff % 60 print(str(h).zfill(2) + ':' + str(m).zfill(2)) ```
3
946
B
Weird Subtraction Process
PROGRAMMING
1,100
[ "math", "number theory" ]
null
null
You have two variables *a* and *b*. Consider the following sequence of actions performed with these variables: 1. If *a*<==<=0 or *b*<==<=0, end the process. Otherwise, go to step 2;1. If *a*<=≥<=2·*b*, then set the value of *a* to *a*<=-<=2·*b*, and repeat step 1. Otherwise, go to step 3;1. If *b*<=≥<=2·*a*, then set the value of *b* to *b*<=-<=2·*a*, and repeat step 1. Otherwise, end the process. Initially the values of *a* and *b* are positive integers, and so the process will be finite. You have to determine the values of *a* and *b* after the process ends.
The only line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1018). *n* is the initial value of variable *a*, and *m* is the initial value of variable *b*.
Print two integers — the values of *a* and *b* after the end of the process.
[ "12 5\n", "31 12\n" ]
[ "0 1\n", "7 12\n" ]
Explanations to the samples: 1. *a* = 12, *b* = 5 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 2, *b* = 5 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 2, *b* = 1 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 0, *b* = 1;1. *a* = 31, *b* = 12 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 7, *b* = 12.
0
[ { "input": "12 5", "output": "0 1" }, { "input": "31 12", "output": "7 12" }, { "input": "1000000000000000000 7", "output": "8 7" }, { "input": "31960284556200 8515664064180", "output": "14928956427840 8515664064180" }, { "input": "1000000000000000000 1000000000000000000", "output": "1000000000000000000 1000000000000000000" }, { "input": "1 1000", "output": "1 0" }, { "input": "1 1000000", "output": "1 0" }, { "input": "1 1000000000000000", "output": "1 0" }, { "input": "1 99999999999999999", "output": "1 1" }, { "input": "1 4", "output": "1 0" }, { "input": "1000000000000001 500000000000000", "output": "1 0" }, { "input": "1 1000000000000000000", "output": "1 0" }, { "input": "2 4", "output": "2 0" }, { "input": "2 1", "output": "0 1" }, { "input": "6 19", "output": "6 7" }, { "input": "22 5", "output": "0 1" }, { "input": "10000000000000000 100000000000000001", "output": "0 1" }, { "input": "1 1000000000000", "output": "1 0" }, { "input": "2 1000000000000000", "output": "2 0" }, { "input": "2 10", "output": "2 2" }, { "input": "51 100", "output": "51 100" }, { "input": "3 1000000000000000000", "output": "3 4" }, { "input": "1000000000000000000 3", "output": "4 3" }, { "input": "1 10000000000000000", "output": "1 0" }, { "input": "8796203 7556", "output": "1019 1442" }, { "input": "5 22", "output": "1 0" }, { "input": "1000000000000000000 1", "output": "0 1" }, { "input": "1 100000000000", "output": "1 0" }, { "input": "2 1000000000000", "output": "2 0" }, { "input": "5 4567865432345678", "output": "5 8" }, { "input": "576460752303423487 288230376151711743", "output": "1 1" }, { "input": "499999999999999999 1000000000000000000", "output": "3 2" }, { "input": "1 9999999999999", "output": "1 1" }, { "input": "103 1000000000000000000", "output": "103 196" }, { "input": "7 1", "output": "1 1" }, { "input": "100000000000000001 10000000000000000", "output": "1 0" }, { "input": "5 10", "output": "5 0" }, { "input": "7 11", "output": "7 11" }, { "input": "1 123456789123456", "output": "1 0" }, { "input": "5000000000000 100000000000001", "output": "0 1" }, { "input": "1000000000000000 1", "output": "0 1" }, { "input": "1000000000000000000 499999999999999999", "output": "2 3" }, { "input": "10 5", "output": "0 5" }, { "input": "9 18917827189272", "output": "9 0" }, { "input": "179 100000000000497000", "output": "179 270" }, { "input": "5 100000000000001", "output": "1 1" }, { "input": "5 20", "output": "5 0" }, { "input": "100000001 50000000", "output": "1 0" }, { "input": "345869461223138161 835002744095575440", "output": "1 0" }, { "input": "8589934592 4294967296", "output": "0 4294967296" }, { "input": "4 8", "output": "4 0" }, { "input": "1 100000000000000000", "output": "1 0" }, { "input": "1000000000000000000 333333333333333", "output": "1000 1333" }, { "input": "25 12", "output": "1 0" }, { "input": "24 54", "output": "0 6" }, { "input": "6 12", "output": "6 0" }, { "input": "129200000000305 547300000001292", "output": "1 0" }, { "input": "1000000000000000000 49999999999999999", "output": "20 39" }, { "input": "1 2", "output": "1 0" }, { "input": "1 123456789876", "output": "1 0" }, { "input": "2 3", "output": "2 3" }, { "input": "1 3", "output": "1 1" }, { "input": "1 1", "output": "1 1" }, { "input": "19 46", "output": "3 2" }, { "input": "3 6", "output": "3 0" }, { "input": "129 1000000000000000000", "output": "1 0" }, { "input": "12 29", "output": "0 1" }, { "input": "8589934592 2147483648", "output": "0 2147483648" }, { "input": "2147483648 8589934592", "output": "2147483648 0" }, { "input": "5 6", "output": "5 6" }, { "input": "1000000000000000000 2", "output": "0 2" }, { "input": "2 7", "output": "2 3" }, { "input": "17174219820754872 61797504734333370", "output": "17174219820754872 27449065092823626" }, { "input": "49 100", "output": "1 0" }, { "input": "7 17", "output": "1 1" }, { "input": "1000000000000000000 10000001", "output": "0 1" }, { "input": "49999999999999999 2", "output": "3 2" }, { "input": "49999999999999999 1", "output": "1 1" }, { "input": "576460752303423487 2", "output": "3 2" }, { "input": "19395 19395", "output": "19395 19395" }, { "input": "19394 19394", "output": "19394 19394" } ]
1,601,114,725
325
PyPy 3
OK
TESTS
81
155
0
import sys n, m = map(int, input().split()) while n and m: if n >= m*2: n %= m*2 elif n*2 <= m: m %= n*2 else: break print(n, m)
Title: Weird Subtraction Process Time Limit: None seconds Memory Limit: None megabytes Problem Description: You have two variables *a* and *b*. Consider the following sequence of actions performed with these variables: 1. If *a*<==<=0 or *b*<==<=0, end the process. Otherwise, go to step 2;1. If *a*<=≥<=2·*b*, then set the value of *a* to *a*<=-<=2·*b*, and repeat step 1. Otherwise, go to step 3;1. If *b*<=≥<=2·*a*, then set the value of *b* to *b*<=-<=2·*a*, and repeat step 1. Otherwise, end the process. Initially the values of *a* and *b* are positive integers, and so the process will be finite. You have to determine the values of *a* and *b* after the process ends. Input Specification: The only line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1018). *n* is the initial value of variable *a*, and *m* is the initial value of variable *b*. Output Specification: Print two integers — the values of *a* and *b* after the end of the process. Demo Input: ['12 5\n', '31 12\n'] Demo Output: ['0 1\n', '7 12\n'] Note: Explanations to the samples: 1. *a* = 12, *b* = 5 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 2, *b* = 5 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 2, *b* = 1 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 0, *b* = 1;1. *a* = 31, *b* = 12 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 7, *b* = 12.
```python import sys n, m = map(int, input().split()) while n and m: if n >= m*2: n %= m*2 elif n*2 <= m: m %= n*2 else: break print(n, m) ```
3
267
A
Subtractions
PROGRAMMING
900
[ "math", "number theory" ]
null
null
You've got two numbers. As long as they are both larger than zero, they go through the same operation: subtract the lesser number from the larger one. If they equal substract one number from the another. For example, one operation transforms pair (4,17) to pair (4,13), it transforms (5,5) to (0,5). You've got some number of pairs (*a**i*,<=*b**i*). How many operations will be performed for each of them?
The first line contains the number of pairs *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000). Then follow *n* lines, each line contains a pair of positive integers *a**i*,<=*b**i* (1<=<=≤<=<=*a**i*,<=<=*b**i*<=<=≤<=<=109).
Print the sought number of operations for each pair on a single line.
[ "2\n4 17\n7 987654321\n" ]
[ "8\n141093479\n" ]
none
500
[ { "input": "2\n4 17\n7 987654321", "output": "8\n141093479" }, { "input": "10\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321", "output": "141093479\n141093479\n141093479\n141093479\n141093479\n141093479\n141093479\n141093479\n141093479\n141093479" }, { "input": "1\n536870912 32", "output": "16777216" }, { "input": "20\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999", "output": "1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000" }, { "input": "3\n1000000000 1\n1000000000 1\n1 100000000", "output": "1000000000\n1000000000\n100000000" } ]
1,589,429,498
2,147,483,647
PyPy 3
OK
TESTS
35
202
24,985,600
for u in range(int(input())): x,y=map(int,input().split()) c=0 while(x>0 and y>0): if(x>=y): c=c+x//y x%=y else: c=c+y//x y=y%x print(c)
Title: Subtractions Time Limit: None seconds Memory Limit: None megabytes Problem Description: You've got two numbers. As long as they are both larger than zero, they go through the same operation: subtract the lesser number from the larger one. If they equal substract one number from the another. For example, one operation transforms pair (4,17) to pair (4,13), it transforms (5,5) to (0,5). You've got some number of pairs (*a**i*,<=*b**i*). How many operations will be performed for each of them? Input Specification: The first line contains the number of pairs *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000). Then follow *n* lines, each line contains a pair of positive integers *a**i*,<=*b**i* (1<=<=≤<=<=*a**i*,<=<=*b**i*<=<=≤<=<=109). Output Specification: Print the sought number of operations for each pair on a single line. Demo Input: ['2\n4 17\n7 987654321\n'] Demo Output: ['8\n141093479\n'] Note: none
```python for u in range(int(input())): x,y=map(int,input().split()) c=0 while(x>0 and y>0): if(x>=y): c=c+x//y x%=y else: c=c+y//x y=y%x print(c) ```
3
159
D
Palindrome pairs
PROGRAMMING
1,500
[ "*special", "brute force", "dp", "strings" ]
null
null
You are given a non-empty string *s* consisting of lowercase letters. Find the number of pairs of non-overlapping palindromic substrings of this string. In a more formal way, you have to find the quantity of tuples (*a*,<=*b*,<=*x*,<=*y*) such that 1<=≤<=*a*<=≤<=*b*<=&lt;<=*x*<=≤<=*y*<=≤<=|*s*| and substrings *s*[*a*... *b*], *s*[*x*... *y*] are palindromes. A palindrome is a string that can be read the same way from left to right and from right to left. For example, "abacaba", "z", "abba" are palindromes. A substring *s*[*i*... *j*] (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|) of string *s* = *s*1*s*2... *s*|*s*| is a string *s**i**s**i*<=+<=1... *s**j*. For example, substring *s*[2...4] of string *s* = "abacaba" equals "bac".
The first line of input contains a non-empty string *s* which consists of lowercase letters ('a'...'z'), *s* contains at most 2000 characters.
Output a single number — the quantity of pairs of non-overlapping palindromic substrings of *s*. Please do not use the %lld format specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d format specifier.
[ "aa\n", "aaa\n", "abacaba\n" ]
[ "1\n", "5\n", "36\n" ]
none
2,000
[ { "input": "aa", "output": "1" }, { "input": "aaa", "output": "5" }, { "input": "abacaba", "output": "36" }, { "input": "aaaaaaaaaa", "output": "495" }, { "input": "aabbb", "output": "24" }, { "input": "abbaa", "output": "18" }, { "input": "bbbbb", "output": "35" }, { "input": "bbaab", "output": "18" }, { "input": "aabba", "output": "18" }, { "input": "aaaaa", "output": "35" }, { "input": "abicabacka", "output": "57" }, { "input": "aiajadabaa", "output": "87" }, { "input": "abacabauabagabaeabacabadabacabbfabacamadabacabaeabacabadabacababcdggdefxeceadaffhecbgpdbeffecdcbfagcbbfgegaggcaffdfiafaeaab", "output": "20470" }, { "input": "abacabadabacabaeabacabadabacabafabacabadabqcabaeoqacabagabacabagefdfdedbbacefhhargbaebbbefabdabdcceddbgcebgdccdccccdbgdecfa", "output": "23427" }, { "input": "abacabafabacabaeabacabadabaqaeatabacabadabacabgeabacabadabacabaeadfgbefcbgbagebgobabaaececaccfeeaeeavbcccwbgecffgfadgagcgfb", "output": "21454" }, { "input": "abacabadabacabaeabacabadabacabafabacabadabacabaeabacabadabacabagabacabadabacabaeabacabadabacabafabacabadabacabaeabacabadabacabahabacabadabacabaeabacabadabacabafabacabadabacabaeabacabadabacabagabacabadabacabaeabacabadabacabafabacabadabacabaeabacabadabacabadadihfcihdeeegcgdfihcagaigeabegaheddgadbcagheieicdadafaadafeaeihbafccifeifafdhicebgeccbgbdhdcabeghhbebehbbfgfeddfgbdhcbhcfifcgccfihdedafefdhcchbcahgiicgdhahcihdgghchfahahffggedigifhdcbecbhddacdgiahbiffbadhiggagaefihchggfhffhfdcdbfeaabhfhgbbiacag", "output": "757870" }, { "input": "abacabadabacabaeabacabadabacabafabacabadabacabaeabacabadabacabagabacabadabacabaeabacabadabacabafabacabadabacabaeabacabadabacabahabacabadabacabaeabacabadabacabafabacabadabacabaeabacabadabacabagabacabadabacabaeabacabadabacabafabacabqdabacabaeabacabadabacabaaciifgeeabgfgfhiadhbfhddihcfeaebfbiiebbcebafegfiefgbagffgchdieicffebaadddcefiibibbhbagfgifieedgeiabhfhbgghiaiegccehgdhaeaafddadgeghidabaeicdhbfghfcciihdgiefaggachefchbddaddafbhhdfhcaebhffbfefabbbbafcdihbcgbfaffieghiiiebhegbcfceidggibdggabaifgedg", "output": "687296" }, { "input": "abacabadabacabaeabacabadabacabafabacabadabacabaeabacabadabacabagabacabadabacabaeabacabadabacabafabacabadabacabaeabacabadabacabahabacabadabpcabaeabacabadabacabafabacabadabacabaeabacabadabacabagabacabadabacabaeabacabadabacabafabacabadabacabaeabacabadabacabaeeegbahbcahagefafcedggigbhdaeebfbagfafhdfcdddeaihgdigiaehdabicigbccdacdcbbcfeccdgiibicaifgieigcfbiedebfeddadagibhbdbfeibgbiadgcacfhfbfegbdbheidegcghfhbhcaffbcfhihcbghecfidbdfadgacigfdabhiebibfhfcachcbdcabeedfcffehhidbbihcgahfhdfhbhaciegccagebifh", "output": "630475" }, { "input": "abacabndabacabaeabacabadabacabafabacabadabacabaeabacabadabacabagabacabadabacabaeabacabadabacabafabacabadabacabaeabacabadabacabahabacabadabacabaeabacabadabacabafabacabadabacabadabacabadabacabagabacabadabacabaeabacabadabacabafabacabadabacabaeabacabadabacabayhaghdcfefibhcbccbbfiedcdieghaihagcchhecgdfbdcchhbagebfbiecaibedhhaeidbcgageadeichbhghficaafdbafdbgadgcficdhdgcagiafbahaeffheabfbbgccbfdbfabahiaeabbfggefbafbheeehaebiehibbffehifghadcegdhdagbebeagbedcciibadfcifcedcghacheaihfdfgebcciidbcffgaebgabg", "output": "619985" }, { "input": "abacababcc", "output": "98" }, { "input": "abauabaabd", "output": "94" }, { "input": "abbabbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbabbbaaabaabaa", "output": "79323" }, { "input": "bababbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbabbabbbbbaabababbbbbbbaabaabaaabbabbbabbbbabbabaababbbabbb", "output": "385228" }, { "input": "abbabbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbabaabaabbabaaaabbabaaabbaababaababbabaaabbbbabbbaaaabababbbaaabaababb", "output": "1054380" }, { "input": "bababbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbabbbbbbbaaabbaabbbabaabab", "output": "2840036" }, { "input": "bababbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbabbababbababbabbababbababbabbababbabbababbababbabbababbababaabbbbbabbabbbaaabbaaababaaaabbbbbbbaaabbbaabaabbaababababbaabbabbabaabbbabbaabababaababbababaaaabababbbaaaaaabbbbbabbbba", "output": "3678765" } ]
1,460,547,279
2,147,483,647
Python 3
OK
TESTS
50
2,212
307,200
def main(): s = tuple(input()) n = len(s) a, b = [1] * n, [1] * n for i in range(n): for x, y in zip(range(i, -1, -1), range(i + 2, n)): if s[x] != s[y]: break a[y] += 1 b[x] += 1 for x, y in zip(range(i, -1, -1), range(i + 1, n)): if s[x] != s[y]: break a[y] += 1 b[x] += 1 x = 0 for i, y in enumerate(a): x += y a[i] = x print(sum(x * y for x, y in zip(a, b[1:]))) if __name__ == '__main__': main()
Title: Palindrome pairs Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a non-empty string *s* consisting of lowercase letters. Find the number of pairs of non-overlapping palindromic substrings of this string. In a more formal way, you have to find the quantity of tuples (*a*,<=*b*,<=*x*,<=*y*) such that 1<=≤<=*a*<=≤<=*b*<=&lt;<=*x*<=≤<=*y*<=≤<=|*s*| and substrings *s*[*a*... *b*], *s*[*x*... *y*] are palindromes. A palindrome is a string that can be read the same way from left to right and from right to left. For example, "abacaba", "z", "abba" are palindromes. A substring *s*[*i*... *j*] (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|) of string *s* = *s*1*s*2... *s*|*s*| is a string *s**i**s**i*<=+<=1... *s**j*. For example, substring *s*[2...4] of string *s* = "abacaba" equals "bac". Input Specification: The first line of input contains a non-empty string *s* which consists of lowercase letters ('a'...'z'), *s* contains at most 2000 characters. Output Specification: Output a single number — the quantity of pairs of non-overlapping palindromic substrings of *s*. Please do not use the %lld format specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d format specifier. Demo Input: ['aa\n', 'aaa\n', 'abacaba\n'] Demo Output: ['1\n', '5\n', '36\n'] Note: none
```python def main(): s = tuple(input()) n = len(s) a, b = [1] * n, [1] * n for i in range(n): for x, y in zip(range(i, -1, -1), range(i + 2, n)): if s[x] != s[y]: break a[y] += 1 b[x] += 1 for x, y in zip(range(i, -1, -1), range(i + 1, n)): if s[x] != s[y]: break a[y] += 1 b[x] += 1 x = 0 for i, y in enumerate(a): x += y a[i] = x print(sum(x * y for x, y in zip(a, b[1:]))) if __name__ == '__main__': main() ```
3
165
A
Supercentral Point
PROGRAMMING
1,000
[ "implementation" ]
null
null
One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*): - point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=&gt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=&lt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=&lt;<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=&gt;<=*y* We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points. Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set.
The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different.
Print the only number — the number of supercentral points of the given set.
[ "8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n", "5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n" ]
[ "2\n", "1\n" ]
In the first sample the supercentral points are only points (1, 1) and (1, 2). In the second sample there is one supercental point — point (0, 0).
500
[ { "input": "8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3", "output": "2" }, { "input": "5\n0 0\n0 1\n1 0\n0 -1\n-1 0", "output": "1" }, { "input": "9\n-565 -752\n-184 723\n-184 -752\n-184 1\n950 723\n-565 723\n950 -752\n950 1\n-565 1", "output": "1" }, { "input": "25\n-651 897\n916 897\n-651 -808\n-748 301\n-734 414\n-651 -973\n-734 897\n916 -550\n-758 414\n916 180\n-758 -808\n-758 -973\n125 -550\n125 -973\n125 301\n916 414\n-748 -808\n-651 301\n-734 301\n-307 897\n-651 -550\n-651 414\n125 -808\n-748 -550\n916 -808", "output": "7" }, { "input": "1\n487 550", "output": "0" }, { "input": "10\n990 -396\n990 736\n990 646\n990 -102\n990 -570\n990 155\n990 528\n990 489\n990 268\n990 676", "output": "0" }, { "input": "30\n507 836\n525 836\n-779 196\n507 -814\n525 -814\n525 42\n525 196\n525 -136\n-779 311\n507 -360\n525 300\n507 578\n507 311\n-779 836\n507 300\n525 -360\n525 311\n-779 -360\n-779 578\n-779 300\n507 42\n525 578\n-779 379\n507 196\n525 379\n507 379\n-779 -814\n-779 42\n-779 -136\n507 -136", "output": "8" }, { "input": "25\n890 -756\n890 -188\n-37 -756\n-37 853\n523 998\n-261 853\n-351 853\n-351 -188\n523 -756\n-261 -188\n-37 998\n523 -212\n-351 998\n-37 -188\n-351 -756\n-37 -212\n890 998\n890 -212\n523 853\n-351 -212\n-261 -212\n-261 998\n-261 -756\n890 853\n523 -188", "output": "9" }, { "input": "21\n-813 -11\n486 254\n685 254\n-708 254\n-55 -11\n-671 -191\n486 -11\n-671 -11\n685 -11\n685 -191\n486 -191\n-55 254\n-708 -11\n-813 254\n-708 -191\n41 -11\n-671 254\n-813 -191\n41 254\n-55 -191\n41 -191", "output": "5" }, { "input": "4\n1 0\n2 0\n1 1\n1 -1", "output": "0" } ]
1,622,147,771
2,147,483,647
Python 3
OK
TESTS
26
154
0
cases = int(input()) coors = [] for _ in range(cases): a, b = map(int, input().split()) coors.append([a, b]) ans = 0 for x, y in coors: right = left = upper = lower = False for xx, yy in coors: if x == xx and y > yy: lower = True elif x == xx and y < yy: upper = True elif x < xx and y == yy: right = True elif x > xx and y == yy: left = True if right == left == upper == lower == True: ans += 1 break print(ans)
Title: Supercentral Point Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*): - point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=&gt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=&lt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=&lt;<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=&gt;<=*y* We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points. Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set. Input Specification: The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different. Output Specification: Print the only number — the number of supercentral points of the given set. Demo Input: ['8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n', '5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n'] Demo Output: ['2\n', '1\n'] Note: In the first sample the supercentral points are only points (1, 1) and (1, 2). In the second sample there is one supercental point — point (0, 0).
```python cases = int(input()) coors = [] for _ in range(cases): a, b = map(int, input().split()) coors.append([a, b]) ans = 0 for x, y in coors: right = left = upper = lower = False for xx, yy in coors: if x == xx and y > yy: lower = True elif x == xx and y < yy: upper = True elif x < xx and y == yy: right = True elif x > xx and y == yy: left = True if right == left == upper == lower == True: ans += 1 break print(ans) ```
3
33
A
What is for dinner?
PROGRAMMING
1,200
[ "greedy", "implementation" ]
A. What is for dinner?
2
256
In one little known, but very beautiful country called Waterland, lives a lovely shark Valerie. Like all the sharks, she has several rows of teeth, and feeds on crucians. One of Valerie's distinguishing features is that while eating one crucian she uses only one row of her teeth, the rest of the teeth are "relaxing". For a long time our heroine had been searching the sea for crucians, but a great misfortune happened. Her teeth started to ache, and she had to see the local dentist, lobster Ashot. As a professional, Ashot quickly relieved Valerie from her toothache. Moreover, he managed to determine the cause of Valerie's developing caries (for what he was later nicknamed Cap). It turned that Valerie eats too many crucians. To help Valerie avoid further reoccurrence of toothache, Ashot found for each Valerie's tooth its residual viability. Residual viability of a tooth is a value equal to the amount of crucians that Valerie can eat with this tooth. Every time Valerie eats a crucian, viability of all the teeth used for it will decrease by one. When the viability of at least one tooth becomes negative, the shark will have to see the dentist again. Unhappy, Valerie came back home, where a portion of crucians was waiting for her. For sure, the shark couldn't say no to her favourite meal, but she had no desire to go back to the dentist. That's why she decided to eat the maximum amount of crucians from the portion but so that the viability of no tooth becomes negative. As Valerie is not good at mathematics, she asked you to help her to find out the total amount of crucians that she can consume for dinner. We should remind you that while eating one crucian Valerie uses exactly one row of teeth and the viability of each tooth from this row decreases by one.
The first line contains three integers *n*, *m*, *k* (1<=≤<=*m*<=≤<=*n*<=≤<=1000,<=0<=≤<=*k*<=≤<=106) — total amount of Valerie's teeth, amount of tooth rows and amount of crucians in Valerie's portion for dinner. Then follow *n* lines, each containing two integers: *r* (1<=≤<=*r*<=≤<=*m*) — index of the row, where belongs the corresponding tooth, and *c* (0<=≤<=*c*<=≤<=106) — its residual viability. It's guaranteed that each tooth row has positive amount of teeth.
In the first line output the maximum amount of crucians that Valerie can consume for dinner.
[ "4 3 18\n2 3\n1 2\n3 6\n2 3\n", "2 2 13\n1 13\n2 12\n" ]
[ "11\n", "13\n" ]
none
500
[ { "input": "4 3 18\n2 3\n1 2\n3 6\n2 3", "output": "11" }, { "input": "2 2 13\n1 13\n2 12", "output": "13" }, { "input": "5 4 8\n4 6\n4 5\n1 3\n2 0\n3 3", "output": "8" }, { "input": "1 1 0\n1 3", "output": "0" }, { "input": "7 1 30\n1 8\n1 15\n1 5\n1 17\n1 9\n1 16\n1 16", "output": "5" }, { "input": "4 2 8\n1 9\n1 10\n1 4\n2 6", "output": "8" }, { "input": "10 4 14\n2 6\n1 5\n2 8\n2 6\n2 5\n4 1\n4 0\n2 4\n3 4\n1 0", "output": "8" }, { "input": "54 22 1009\n15 7\n17 7\n11 9\n5 11\n12 9\n13 8\n13 12\n22 11\n20 9\n20 7\n16 11\n19 12\n3 12\n15 9\n1 12\n2 10\n16 10\n16 10\n14 10\n9 11\n9 9\n14 8\n10 10\n16 12\n1 8\n3 8\n21 11\n18 12\n2 6\n9 11\n11 7\n15 9\n20 11\n6 8\n8 8\n19 11\n15 7\n9 9\n22 7\n12 9\n17 9\n17 11\n12 7\n15 9\n5 11\n11 6\n18 8\n7 10\n4 10\n13 12\n4 8\n20 6\n15 12\n9 7", "output": "180" }, { "input": "1 1 1000000\n1 1000000", "output": "1000000" }, { "input": "4 3 181818\n3 1299\n1 1694\n3 1164\n2 1278", "output": "4136" }, { "input": "50 50 0\n33 0\n26 0\n30 0\n41 0\n38 0\n36 0\n16 0\n7 0\n23 0\n5 0\n39 0\n29 0\n40 0\n47 0\n24 0\n43 0\n14 0\n10 0\n20 0\n3 0\n6 0\n34 0\n13 0\n18 0\n21 0\n9 0\n8 0\n22 0\n25 0\n4 0\n11 0\n17 0\n32 0\n44 0\n49 0\n50 0\n27 0\n28 0\n45 0\n12 0\n35 0\n15 0\n42 0\n31 0\n2 0\n1 0\n48 0\n19 0\n37 0\n46 0", "output": "0" }, { "input": "19 12 199\n7 1\n8 6\n6 14\n1 7\n4 1\n6 6\n3 4\n1 5\n9 2\n5 3\n11 3\n9 4\n1 12\n4 7\n7 3\n12 14\n2 1\n10 8\n6 12", "output": "54" } ]
1,666,230,779
2,147,483,647
Python 3
OK
TESTS
31
92
0
n,m,k = map(int,input().split()) diction = {} for i in range(n): nums = list(map(int,input().split())) if nums[0] not in diction.keys(): diction[nums[0]] = nums[1] elif nums[0] in diction.keys(): if nums[1] > diction[nums[0]]: pass else: diction[nums[0]] = nums[1] s = sum(diction.values()) if s >= k: print(k) else: print(s)
Title: What is for dinner? Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: In one little known, but very beautiful country called Waterland, lives a lovely shark Valerie. Like all the sharks, she has several rows of teeth, and feeds on crucians. One of Valerie's distinguishing features is that while eating one crucian she uses only one row of her teeth, the rest of the teeth are "relaxing". For a long time our heroine had been searching the sea for crucians, but a great misfortune happened. Her teeth started to ache, and she had to see the local dentist, lobster Ashot. As a professional, Ashot quickly relieved Valerie from her toothache. Moreover, he managed to determine the cause of Valerie's developing caries (for what he was later nicknamed Cap). It turned that Valerie eats too many crucians. To help Valerie avoid further reoccurrence of toothache, Ashot found for each Valerie's tooth its residual viability. Residual viability of a tooth is a value equal to the amount of crucians that Valerie can eat with this tooth. Every time Valerie eats a crucian, viability of all the teeth used for it will decrease by one. When the viability of at least one tooth becomes negative, the shark will have to see the dentist again. Unhappy, Valerie came back home, where a portion of crucians was waiting for her. For sure, the shark couldn't say no to her favourite meal, but she had no desire to go back to the dentist. That's why she decided to eat the maximum amount of crucians from the portion but so that the viability of no tooth becomes negative. As Valerie is not good at mathematics, she asked you to help her to find out the total amount of crucians that she can consume for dinner. We should remind you that while eating one crucian Valerie uses exactly one row of teeth and the viability of each tooth from this row decreases by one. Input Specification: The first line contains three integers *n*, *m*, *k* (1<=≤<=*m*<=≤<=*n*<=≤<=1000,<=0<=≤<=*k*<=≤<=106) — total amount of Valerie's teeth, amount of tooth rows and amount of crucians in Valerie's portion for dinner. Then follow *n* lines, each containing two integers: *r* (1<=≤<=*r*<=≤<=*m*) — index of the row, where belongs the corresponding tooth, and *c* (0<=≤<=*c*<=≤<=106) — its residual viability. It's guaranteed that each tooth row has positive amount of teeth. Output Specification: In the first line output the maximum amount of crucians that Valerie can consume for dinner. Demo Input: ['4 3 18\n2 3\n1 2\n3 6\n2 3\n', '2 2 13\n1 13\n2 12\n'] Demo Output: ['11\n', '13\n'] Note: none
```python n,m,k = map(int,input().split()) diction = {} for i in range(n): nums = list(map(int,input().split())) if nums[0] not in diction.keys(): diction[nums[0]] = nums[1] elif nums[0] in diction.keys(): if nums[1] > diction[nums[0]]: pass else: diction[nums[0]] = nums[1] s = sum(diction.values()) if s >= k: print(k) else: print(s) ```
3.977
313
A
Ilya and Bank Account
PROGRAMMING
900
[ "implementation", "number theory" ]
null
null
Ilya is a very clever lion, he lives in an unusual city ZooVille. In this city all the animals have their rights and obligations. Moreover, they even have their own bank accounts. The state of a bank account is an integer. The state of a bank account can be a negative number. This means that the owner of the account owes the bank money. Ilya the Lion has recently had a birthday, so he got a lot of gifts. One of them (the gift of the main ZooVille bank) is the opportunity to delete the last digit or the digit before last from the state of his bank account no more than once. For example, if the state of Ilya's bank account is -123, then Ilya can delete the last digit and get his account balance equal to -12, also he can remove its digit before last and get the account balance equal to -13. Of course, Ilya is permitted not to use the opportunity to delete a digit from the balance. Ilya is not very good at math, and that's why he asks you to help him maximize his bank account. Find the maximum state of the bank account that can be obtained using the bank's gift.
The single line contains integer *n* (10<=≤<=|*n*|<=≤<=109) — the state of Ilya's bank account.
In a single line print an integer — the maximum state of the bank account that Ilya can get.
[ "2230\n", "-10\n", "-100003\n" ]
[ "2230\n", "0\n", "-10000\n" ]
In the first test sample Ilya doesn't profit from using the present. In the second test sample you can delete digit 1 and get the state of the account equal to 0.
500
[ { "input": "2230", "output": "2230" }, { "input": "-10", "output": "0" }, { "input": "-100003", "output": "-10000" }, { "input": "544883178", "output": "544883178" }, { "input": "-847251738", "output": "-84725173" }, { "input": "423654797", "output": "423654797" }, { "input": "-623563697", "output": "-62356367" }, { "input": "645894116", "output": "645894116" }, { "input": "-384381709", "output": "-38438170" }, { "input": "437587210", "output": "437587210" }, { "input": "-297534606", "output": "-29753460" }, { "input": "891773002", "output": "891773002" }, { "input": "-56712976", "output": "-5671296" }, { "input": "963662765", "output": "963662765" }, { "input": "-272656295", "output": "-27265625" }, { "input": "383441522", "output": "383441522" }, { "input": "-477665112", "output": "-47766511" }, { "input": "791725034", "output": "791725034" }, { "input": "-812168727", "output": "-81216872" }, { "input": "528894922", "output": "528894922" }, { "input": "-479977172", "output": "-47997712" }, { "input": "568044564", "output": "568044564" }, { "input": "-392784794", "output": "-39278474" }, { "input": "925596634", "output": "925596634" }, { "input": "-836078769", "output": "-83607876" }, { "input": "71036059", "output": "71036059" }, { "input": "-337396162", "output": "-33739612" }, { "input": "87129297", "output": "87129297" }, { "input": "-648171877", "output": "-64817187" }, { "input": "20218400", "output": "20218400" }, { "input": "10", "output": "10" }, { "input": "1000000000", "output": "1000000000" }, { "input": "-1000000000", "output": "-100000000" }, { "input": "-102", "output": "-10" }, { "input": "-120", "output": "-10" }, { "input": "-20", "output": "0" }, { "input": "-15", "output": "-1" }, { "input": "-5575533", "output": "-557553" }, { "input": "-50", "output": "0" }, { "input": "-31", "output": "-1" }, { "input": "-55", "output": "-5" }, { "input": "-81", "output": "-1" }, { "input": "-99", "output": "-9" }, { "input": "-23", "output": "-2" }, { "input": "-41", "output": "-1" }, { "input": "-24", "output": "-2" }, { "input": "46", "output": "46" } ]
1,687,862,525
2,147,483,647
Python 3
OK
TESTS
47
92
0
n = input() print(max(map(int, (n, n[:-1], n[:-2]+n[-1]))))
Title: Ilya and Bank Account Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ilya is a very clever lion, he lives in an unusual city ZooVille. In this city all the animals have their rights and obligations. Moreover, they even have their own bank accounts. The state of a bank account is an integer. The state of a bank account can be a negative number. This means that the owner of the account owes the bank money. Ilya the Lion has recently had a birthday, so he got a lot of gifts. One of them (the gift of the main ZooVille bank) is the opportunity to delete the last digit or the digit before last from the state of his bank account no more than once. For example, if the state of Ilya's bank account is -123, then Ilya can delete the last digit and get his account balance equal to -12, also he can remove its digit before last and get the account balance equal to -13. Of course, Ilya is permitted not to use the opportunity to delete a digit from the balance. Ilya is not very good at math, and that's why he asks you to help him maximize his bank account. Find the maximum state of the bank account that can be obtained using the bank's gift. Input Specification: The single line contains integer *n* (10<=≤<=|*n*|<=≤<=109) — the state of Ilya's bank account. Output Specification: In a single line print an integer — the maximum state of the bank account that Ilya can get. Demo Input: ['2230\n', '-10\n', '-100003\n'] Demo Output: ['2230\n', '0\n', '-10000\n'] Note: In the first test sample Ilya doesn't profit from using the present. In the second test sample you can delete digit 1 and get the state of the account equal to 0.
```python n = input() print(max(map(int, (n, n[:-1], n[:-2]+n[-1])))) ```
3
540
A
Combination Lock
PROGRAMMING
800
[ "implementation" ]
null
null
Scrooge McDuck keeps his most treasured savings in a home safe with a combination lock. Each time he wants to put there the treasures that he's earned fair and square, he has to open the lock. The combination lock is represented by *n* rotating disks with digits from 0 to 9 written on them. Scrooge McDuck has to turn some disks so that the combination of digits on the disks forms a secret combination. In one move, he can rotate one disk one digit forwards or backwards. In particular, in one move he can go from digit 0 to digit 9 and vice versa. What minimum number of actions does he need for that?
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of disks on the combination lock. The second line contains a string of *n* digits — the original state of the disks. The third line contains a string of *n* digits — Scrooge McDuck's combination that opens the lock.
Print a single integer — the minimum number of moves Scrooge McDuck needs to open the lock.
[ "5\n82195\n64723\n" ]
[ "13\n" ]
In the sample he needs 13 moves: - 1 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b8967f65a723782358b93eff9ce69f336817cf70.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 2 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/07fa58573ece0d32c4d555e498d2b24d2f70f36a.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 3 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cc2275d9252aae35a6867c6a5b4ba7596e9a7626.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 4 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b100aea470fcaaab4e9529b234ba0d7875943c10.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 5 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/eb2cbe4324cebca65b85816262a85e473cd65967.png" style="max-width: 100.0%;max-height: 100.0%;"/>
500
[ { "input": "5\n82195\n64723", "output": "13" }, { "input": "12\n102021090898\n010212908089", "output": "16" }, { "input": "1\n8\n1", "output": "3" }, { "input": "2\n83\n57", "output": "7" }, { "input": "10\n0728592530\n1362615763", "output": "27" }, { "input": "100\n4176196363694273682807653052945037727131821799902563705176501742060696655282954944720643131654235909\n3459912084922154505910287499879975659298239371519889866585472674423008837878123067103005344986554746", "output": "245" }, { "input": "1\n8\n1", "output": "3" }, { "input": "2\n83\n57", "output": "7" }, { "input": "3\n607\n684", "output": "5" }, { "input": "4\n0809\n0636", "output": "8" }, { "input": "5\n84284\n08941", "output": "16" }, { "input": "25\n8037856825987124762280548\n9519431339078678836940020", "output": "72" }, { "input": "125\n23269567683904664184142384849516523616863461607751021071772615078579713054027902974007001544768640273491193035874486891541257\n47635110303703399505805044019026243695451609639556649012447370081552870340011971572363458960190590266459684717415349529509024", "output": "305" }, { "input": "5\n84284\n08941", "output": "16" }, { "input": "25\n8037856825987124762285484\n9519431339078678836940202", "output": "74" }, { "input": "125\n23269567689466418414238845152168634610771021717726157879713054270294007001544768647391193035874486891412573389247025830678706\n47635110307339950580504010224954516093956649124473708152870340117152363458960190596659684717415349529090241694059599629136831", "output": "357" }, { "input": "5\n84284\n08941", "output": "16" }, { "input": "25\n8378525987476228048406972\n9194339078883694020217816", "output": "55" }, { "input": "125\n23269576839046618414238484916523616863461607750210717761078579713054027902974007015447686027349193035874486891541257338624472\n47635103037033950580504401926243695451609639556490124437081552870340011971572363489601905026645984717415349529509024169604599", "output": "274" }, { "input": "1\n0\n0", "output": "0" }, { "input": "1\n7\n7", "output": "0" }, { "input": "1\n0\n5", "output": "5" }, { "input": "1\n2\n7", "output": "5" }, { "input": "1\n7\n9", "output": "2" }, { "input": "1\n9\n7", "output": "2" }, { "input": "1\n2\n9", "output": "3" }, { "input": "1\n9\n2", "output": "3" }, { "input": "25\n3164978461316464614169874\n9413979197249127496597357", "output": "66" }, { "input": "4\n9999\n9999", "output": "0" }, { "input": "2\n11\n11", "output": "0" } ]
1,593,015,703
2,147,483,647
Python 3
OK
TESTS
43
124
6,963,200
n=int(input()) t=0 s1=input() s2=input() for i in range(n): if abs(int(s1[i])-int(s2[i]))<(10-abs(int(s1[i])-int(s2[i]))): t+=abs(int(s1[i])-int(s2[i])) else: t+=(10-abs(int(s1[i])-int(s2[i]))) print(t)
Title: Combination Lock Time Limit: None seconds Memory Limit: None megabytes Problem Description: Scrooge McDuck keeps his most treasured savings in a home safe with a combination lock. Each time he wants to put there the treasures that he's earned fair and square, he has to open the lock. The combination lock is represented by *n* rotating disks with digits from 0 to 9 written on them. Scrooge McDuck has to turn some disks so that the combination of digits on the disks forms a secret combination. In one move, he can rotate one disk one digit forwards or backwards. In particular, in one move he can go from digit 0 to digit 9 and vice versa. What minimum number of actions does he need for that? Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of disks on the combination lock. The second line contains a string of *n* digits — the original state of the disks. The third line contains a string of *n* digits — Scrooge McDuck's combination that opens the lock. Output Specification: Print a single integer — the minimum number of moves Scrooge McDuck needs to open the lock. Demo Input: ['5\n82195\n64723\n'] Demo Output: ['13\n'] Note: In the sample he needs 13 moves: - 1 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b8967f65a723782358b93eff9ce69f336817cf70.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 2 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/07fa58573ece0d32c4d555e498d2b24d2f70f36a.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 3 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cc2275d9252aae35a6867c6a5b4ba7596e9a7626.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 4 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b100aea470fcaaab4e9529b234ba0d7875943c10.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 5 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/eb2cbe4324cebca65b85816262a85e473cd65967.png" style="max-width: 100.0%;max-height: 100.0%;"/>
```python n=int(input()) t=0 s1=input() s2=input() for i in range(n): if abs(int(s1[i])-int(s2[i]))<(10-abs(int(s1[i])-int(s2[i]))): t+=abs(int(s1[i])-int(s2[i])) else: t+=(10-abs(int(s1[i])-int(s2[i]))) print(t) ```
3
168
A
Wizards and Demonstration
PROGRAMMING
900
[ "implementation", "math" ]
null
null
Some country is populated by wizards. They want to organize a demonstration. There are *n* people living in the city, *x* of them are the wizards who will surely go to the demonstration. Other city people (*n*<=-<=*x* people) do not support the wizards and aren't going to go to the demonstration. We know that the city administration will react only to the demonstration involving at least *y* percent of the city people. Having considered the matter, the wizards decided to create clone puppets which can substitute the city people on the demonstration. So all in all, the demonstration will involve only the wizards and their puppets. The city administration cannot tell the difference between a puppet and a person, so, as they calculate the percentage, the administration will consider the city to be consisting of only *n* people and not containing any clone puppets. Help the wizards and find the minimum number of clones to create to that the demonstration had no less than *y* percent of the city people.
The first line contains three space-separated integers, *n*, *x*, *y* (1<=≤<=*n*,<=*x*,<=*y*<=≤<=104,<=*x*<=≤<=*n*) — the number of citizens in the city, the number of wizards and the percentage the administration needs, correspondingly. Please note that *y* can exceed 100 percent, that is, the administration wants to see on a demonstration more people that actually live in the city (<=&gt;<=*n*).
Print a single integer — the answer to the problem, the minimum number of clones to create, so that the demonstration involved no less than *y* percent of *n* (the real total city population).
[ "10 1 14\n", "20 10 50\n", "1000 352 146\n" ]
[ "1\n", "0\n", "1108\n" ]
In the first sample it is necessary that at least 14% of 10 people came to the demonstration. As the number of people should be integer, then at least two people should come. There is only one wizard living in the city and he is going to come. That isn't enough, so he needs to create one clone. In the second sample 10 people should come to the demonstration. The city has 10 wizards. They will all come to the demonstration, so nobody has to create any clones.
500
[ { "input": "10 1 14", "output": "1" }, { "input": "20 10 50", "output": "0" }, { "input": "1000 352 146", "output": "1108" }, { "input": "68 65 20", "output": "0" }, { "input": "78 28 27", "output": "0" }, { "input": "78 73 58", "output": "0" }, { "input": "70 38 66", "output": "9" }, { "input": "54 4 38", "output": "17" }, { "input": "3 1 69", "output": "2" }, { "input": "11 9 60", "output": "0" }, { "input": "71 49 65", "output": "0" }, { "input": "78 55 96", "output": "20" }, { "input": "2765 768 9020", "output": "248635" }, { "input": "3478 1728 9727", "output": "336578" }, { "input": "9678 6173 5658", "output": "541409" }, { "input": "1138 570 6666", "output": "75290" }, { "input": "7754 204 9038", "output": "700603" }, { "input": "8403 7401 4769", "output": "393339" }, { "input": "4909 2111 8860", "output": "432827" }, { "input": "6571 6449 8965", "output": "582642" }, { "input": "9178 2255 7996", "output": "731618" }, { "input": "6151 6148 3746", "output": "224269" }, { "input": "8890 5449 8734", "output": "771004" }, { "input": "7879 2590 2818", "output": "219441" }, { "input": "8484 6400 547", "output": "40008" }, { "input": "7835 6710 1639", "output": "121706" }, { "input": "2379 1436 9663", "output": "228447" }, { "input": "6487 5670 8", "output": "0" }, { "input": "4470 2543 6", "output": "0" }, { "input": "7261 5328 10", "output": "0" }, { "input": "3871 3795 7", "output": "0" }, { "input": "9620 6557 6", "output": "0" }, { "input": "4890 1112 5", "output": "0" }, { "input": "1 1 1", "output": "0" }, { "input": "1 1 10000", "output": "99" }, { "input": "10000 1 1", "output": "99" }, { "input": "10000 1 10000", "output": "999999" }, { "input": "10000 10000 1", "output": "0" }, { "input": "10000 10000 10000", "output": "990000" }, { "input": "67 1 3", "output": "2" }, { "input": "7878 4534 9159", "output": "717013" }, { "input": "1 1 1", "output": "0" }, { "input": "3271 5 50", "output": "1631" } ]
1,644,946,610
2,147,483,647
Python 3
OK
TESTS
43
92
0
import math n, x, y = map(int, input().split()) print(max(math.ceil((n * y - (100 * x)) / 100), 0))
Title: Wizards and Demonstration Time Limit: None seconds Memory Limit: None megabytes Problem Description: Some country is populated by wizards. They want to organize a demonstration. There are *n* people living in the city, *x* of them are the wizards who will surely go to the demonstration. Other city people (*n*<=-<=*x* people) do not support the wizards and aren't going to go to the demonstration. We know that the city administration will react only to the demonstration involving at least *y* percent of the city people. Having considered the matter, the wizards decided to create clone puppets which can substitute the city people on the demonstration. So all in all, the demonstration will involve only the wizards and their puppets. The city administration cannot tell the difference between a puppet and a person, so, as they calculate the percentage, the administration will consider the city to be consisting of only *n* people and not containing any clone puppets. Help the wizards and find the minimum number of clones to create to that the demonstration had no less than *y* percent of the city people. Input Specification: The first line contains three space-separated integers, *n*, *x*, *y* (1<=≤<=*n*,<=*x*,<=*y*<=≤<=104,<=*x*<=≤<=*n*) — the number of citizens in the city, the number of wizards and the percentage the administration needs, correspondingly. Please note that *y* can exceed 100 percent, that is, the administration wants to see on a demonstration more people that actually live in the city (<=&gt;<=*n*). Output Specification: Print a single integer — the answer to the problem, the minimum number of clones to create, so that the demonstration involved no less than *y* percent of *n* (the real total city population). Demo Input: ['10 1 14\n', '20 10 50\n', '1000 352 146\n'] Demo Output: ['1\n', '0\n', '1108\n'] Note: In the first sample it is necessary that at least 14% of 10 people came to the demonstration. As the number of people should be integer, then at least two people should come. There is only one wizard living in the city and he is going to come. That isn't enough, so he needs to create one clone. In the second sample 10 people should come to the demonstration. The city has 10 wizards. They will all come to the demonstration, so nobody has to create any clones.
```python import math n, x, y = map(int, input().split()) print(max(math.ceil((n * y - (100 * x)) / 100), 0)) ```
3
908
A
New Year and Counting Cards
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
Your friend has *n* cards. You know that each card has a lowercase English letter on one side and a digit on the other. Currently, your friend has laid out the cards on a table so only one side of each card is visible. You would like to know if the following statement is true for cards that your friend owns: "If a card has a vowel on one side, then it has an even digit on the other side." More specifically, a vowel is one of 'a', 'e', 'i', 'o' or 'u', and even digit is one of '0', '2', '4', '6' or '8'. For example, if a card has 'a' on one side, and '6' on the other side, then this statement is true for it. Also, the statement is true, for example, for a card with 'b' and '4', and for a card with 'b' and '3' (since the letter is not a vowel). The statement is false, for example, for card with 'e' and '5'. You are interested if the statement is true for all cards. In particular, if no card has a vowel, the statement is true. To determine this, you can flip over some cards to reveal the other side. You would like to know what is the minimum number of cards you need to flip in the worst case in order to verify that the statement is true.
The first and only line of input will contain a string *s* (1<=≤<=|*s*|<=≤<=50), denoting the sides of the cards that you can see on the table currently. Each character of *s* is either a lowercase English letter or a digit.
Print a single integer, the minimum number of cards you must turn over to verify your claim.
[ "ee\n", "z\n", "0ay1\n" ]
[ "2\n", "0\n", "2\n" ]
In the first sample, we must turn over both cards. Note that even though both cards have the same letter, they could possibly have different numbers on the other side. In the second sample, we don't need to turn over any cards. The statement is vacuously true, since you know your friend has no cards with a vowel on them. In the third sample, we need to flip the second and fourth cards.
500
[ { "input": "ee", "output": "2" }, { "input": "z", "output": "0" }, { "input": "0ay1", "output": "2" }, { "input": "0abcdefghijklmnopqrstuvwxyz1234567896", "output": "10" }, { "input": "0a0a9e9e2i2i9o9o6u6u9z9z4x4x9b9b", "output": "18" }, { "input": "01234567890123456789012345678901234567890123456789", "output": "25" }, { "input": "qwertyuioplkjhgfdsazxcvbnmqwertyuioplkjhgfdsazxcvb", "output": "10" }, { "input": "cjw2dwmr10pku4yxohe0wglktd", "output": "4" }, { "input": "6z2tx805jie8cfybwtfqvmlveec3iak5z5u3lu62vbxyqht6", "output": "13" }, { "input": "kaq7jyialrfp4ilkni90eq8v3amcbygon7py0hb8z26fbl8ss1", "output": "13" }, { "input": "hpwn50zgbmct80k9rizjqg40nycgs0acwikjqt11nr6m61krfs", "output": "8" }, { "input": "l3rw91a4m25l8iytxyeuixsegzcbm4h41ornf3pixkrmwznrzc", "output": "14" }, { "input": "2222", "output": "0" }, { "input": "13579", "output": "5" }, { "input": "1", "output": "1" }, { "input": "0", "output": "0" }, { "input": "a", "output": "1" }, { "input": "y", "output": "0" }, { "input": "w", "output": "0" }, { "input": "oo", "output": "2" }, { "input": "oy", "output": "1" }, { "input": "yo", "output": "1" }, { "input": "yy", "output": "0" }, { "input": "a0", "output": "1" }, { "input": "a9", "output": "2" }, { "input": "y0", "output": "0" }, { "input": "y7", "output": "1" }, { "input": "0a", "output": "1" }, { "input": "3a", "output": "2" }, { "input": "06", "output": "0" }, { "input": "07", "output": "1" }, { "input": "70", "output": "1" }, { "input": "77", "output": "2" }, { "input": "13570", "output": "4" }, { "input": "0000000000011111", "output": "5" }, { "input": "1357", "output": "4" }, { "input": "uuuuuuuuuuuuuuuuuu", "output": "18" }, { "input": "gabieurat", "output": "5" } ]
1,671,502,154
2,147,483,647
Python 3
OK
TESTS
38
62
0
s = input() res = sum(c in {"a", "e", "i", "o", "u"} or (c.isdigit() and int(c) & 1 == 1) for c in s) print(res)
Title: New Year and Counting Cards Time Limit: None seconds Memory Limit: None megabytes Problem Description: Your friend has *n* cards. You know that each card has a lowercase English letter on one side and a digit on the other. Currently, your friend has laid out the cards on a table so only one side of each card is visible. You would like to know if the following statement is true for cards that your friend owns: "If a card has a vowel on one side, then it has an even digit on the other side." More specifically, a vowel is one of 'a', 'e', 'i', 'o' or 'u', and even digit is one of '0', '2', '4', '6' or '8'. For example, if a card has 'a' on one side, and '6' on the other side, then this statement is true for it. Also, the statement is true, for example, for a card with 'b' and '4', and for a card with 'b' and '3' (since the letter is not a vowel). The statement is false, for example, for card with 'e' and '5'. You are interested if the statement is true for all cards. In particular, if no card has a vowel, the statement is true. To determine this, you can flip over some cards to reveal the other side. You would like to know what is the minimum number of cards you need to flip in the worst case in order to verify that the statement is true. Input Specification: The first and only line of input will contain a string *s* (1<=≤<=|*s*|<=≤<=50), denoting the sides of the cards that you can see on the table currently. Each character of *s* is either a lowercase English letter or a digit. Output Specification: Print a single integer, the minimum number of cards you must turn over to verify your claim. Demo Input: ['ee\n', 'z\n', '0ay1\n'] Demo Output: ['2\n', '0\n', '2\n'] Note: In the first sample, we must turn over both cards. Note that even though both cards have the same letter, they could possibly have different numbers on the other side. In the second sample, we don't need to turn over any cards. The statement is vacuously true, since you know your friend has no cards with a vowel on them. In the third sample, we need to flip the second and fourth cards.
```python s = input() res = sum(c in {"a", "e", "i", "o", "u"} or (c.isdigit() and int(c) & 1 == 1) for c in s) print(res) ```
3
629
B
Far Relative’s Problem
PROGRAMMING
1,100
[ "brute force" ]
null
null
Famil Door wants to celebrate his birthday with his friends from Far Far Away. He has *n* friends and each of them can come to the party in a specific range of days of the year from *a**i* to *b**i*. Of course, Famil Door wants to have as many friends celebrating together with him as possible. Far cars are as weird as Far Far Away citizens, so they can only carry two people of opposite gender, that is exactly one male and one female. However, Far is so far from here that no other transportation may be used to get to the party. Famil Door should select some day of the year and invite some of his friends, such that they all are available at this moment and the number of male friends invited is equal to the number of female friends invited. Find the maximum number of friends that may present at the party.
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=5000) — then number of Famil Door's friends. Then follow *n* lines, that describe the friends. Each line starts with a capital letter 'F' for female friends and with a capital letter 'M' for male friends. Then follow two integers *a**i* and *b**i* (1<=≤<=*a**i*<=≤<=*b**i*<=≤<=366), providing that the *i*-th friend can come to the party from day *a**i* to day *b**i* inclusive.
Print the maximum number of people that may come to Famil Door's party.
[ "4\nM 151 307\nF 343 352\nF 117 145\nM 24 128\n", "6\nM 128 130\nF 128 131\nF 131 140\nF 131 141\nM 131 200\nM 140 200\n" ]
[ "2\n", "4\n" ]
In the first sample, friends 3 and 4 can come on any day in range [117, 128]. In the second sample, friends with indices 3, 4, 5 and 6 can come on day 140.
1,000
[ { "input": "4\nM 151 307\nF 343 352\nF 117 145\nM 24 128", "output": "2" }, { "input": "6\nM 128 130\nF 128 131\nF 131 140\nF 131 141\nM 131 200\nM 140 200", "output": "4" }, { "input": "1\nF 68 307", "output": "0" }, { "input": "40\nM 55 363\nF 117 252\nM 157 282\nF 322 345\nM 330 363\nF 154 231\nF 216 352\nF 357 365\nM 279 292\nF 353 359\nF 82 183\nM 78 297\nM 231 314\nM 107 264\nF 34 318\nM 44 244\nF 42 339\nM 253 307\nM 128 192\nF 119 328\nM 135 249\nF 303 358\nF 348 352\nF 8 364\nF 126 303\nM 226 346\nF 110 300\nF 47 303\nF 201 311\nF 287 288\nM 270 352\nM 227 351\nF 8 111\nF 39 229\nM 163 315\nF 269 335\nF 147 351\nF 96 143\nM 97 99\nM 177 295", "output": "22" }, { "input": "2\nF 1 1\nM 1 1", "output": "2" }, { "input": "4\nM 1 2\nM 2 3\nF 3 4\nF 4 5", "output": "2" }, { "input": "1\nF 1 2", "output": "0" }, { "input": "18\nF 3 4\nF 3 4\nF 3 4\nF 3 4\nF 5 6\nF 5 6\nM 3 4\nM 3 4\nM 5 6\nM 5 6\nM 5 6\nM 5 6\nF 7 8\nF 7 8\nF 7 8\nM 7 8\nM 7 8\nM 7 8", "output": "6" }, { "input": "2\nM 1 1\nF 1 1", "output": "2" }, { "input": "3\nM 1 1\nF 1 1\nM 1 1", "output": "2" } ]
1,456,211,876
2,147,483,647
Python 3
OK
TESTS
76
826
307,200
n=int(input()) rows=[] for _ in range(n): g,s,e=input().split() rows.append((g,int(s),int(e))) best=0 for i in range(1,367): m=f=0 for row in rows: g,s,e=row if g=='M': m+=(1 if (s<=i and i<=e) else 0) else: f+=(1 if (s<=i and i<=e) else 0) best=max(min(m,f),best) print(best*2)
Title: Far Relative’s Problem Time Limit: None seconds Memory Limit: None megabytes Problem Description: Famil Door wants to celebrate his birthday with his friends from Far Far Away. He has *n* friends and each of them can come to the party in a specific range of days of the year from *a**i* to *b**i*. Of course, Famil Door wants to have as many friends celebrating together with him as possible. Far cars are as weird as Far Far Away citizens, so they can only carry two people of opposite gender, that is exactly one male and one female. However, Far is so far from here that no other transportation may be used to get to the party. Famil Door should select some day of the year and invite some of his friends, such that they all are available at this moment and the number of male friends invited is equal to the number of female friends invited. Find the maximum number of friends that may present at the party. Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=5000) — then number of Famil Door's friends. Then follow *n* lines, that describe the friends. Each line starts with a capital letter 'F' for female friends and with a capital letter 'M' for male friends. Then follow two integers *a**i* and *b**i* (1<=≤<=*a**i*<=≤<=*b**i*<=≤<=366), providing that the *i*-th friend can come to the party from day *a**i* to day *b**i* inclusive. Output Specification: Print the maximum number of people that may come to Famil Door's party. Demo Input: ['4\nM 151 307\nF 343 352\nF 117 145\nM 24 128\n', '6\nM 128 130\nF 128 131\nF 131 140\nF 131 141\nM 131 200\nM 140 200\n'] Demo Output: ['2\n', '4\n'] Note: In the first sample, friends 3 and 4 can come on any day in range [117, 128]. In the second sample, friends with indices 3, 4, 5 and 6 can come on day 140.
```python n=int(input()) rows=[] for _ in range(n): g,s,e=input().split() rows.append((g,int(s),int(e))) best=0 for i in range(1,367): m=f=0 for row in rows: g,s,e=row if g=='M': m+=(1 if (s<=i and i<=e) else 0) else: f+=(1 if (s<=i and i<=e) else 0) best=max(min(m,f),best) print(best*2) ```
3
873
D
Merge Sort
PROGRAMMING
1,800
[ "constructive algorithms", "divide and conquer" ]
null
null
Merge sort is a well-known sorting algorithm. The main function that sorts the elements of array *a* with indices from [*l*,<=*r*) can be implemented as follows: 1. If the segment [*l*,<=*r*) is already sorted in non-descending order (that is, for any *i* such that *l*<=≤<=*i*<=&lt;<=*r*<=-<=1 *a*[*i*]<=≤<=*a*[*i*<=+<=1]), then end the function call; 1. Let ; 1. Call *mergesort*(*a*,<=*l*,<=*mid*); 1. Call *mergesort*(*a*,<=*mid*,<=*r*); 1. Merge segments [*l*,<=*mid*) and [*mid*,<=*r*), making the segment [*l*,<=*r*) sorted in non-descending order. The merge algorithm doesn't call any other functions. The array in this problem is 0-indexed, so to sort the whole array, you need to call *mergesort*(*a*,<=0,<=*n*). The number of calls of function *mergesort* is very important, so Ivan has decided to calculate it while sorting the array. For example, if *a*<==<={1,<=2,<=3,<=4}, then there will be 1 call of *mergesort* — *mergesort*(0,<=4), which will check that the array is sorted and then end. If *a*<==<={2,<=1,<=3}, then the number of calls is 3: first of all, you call *mergesort*(0,<=3), which then sets *mid*<==<=1 and calls *mergesort*(0,<=1) and *mergesort*(1,<=3), which do not perform any recursive calls because segments (0,<=1) and (1,<=3) are sorted. Ivan has implemented the program that counts the number of *mergesort* calls, but now he needs to test it. To do this, he needs to find an array *a* such that *a* is a permutation of size *n* (that is, the number of elements in *a* is *n*, and every integer number from [1,<=*n*] can be found in this array), and the number of *mergesort* calls when sorting the array is exactly *k*. Help Ivan to find an array he wants!
The first line contains two numbers *n* and *k* (1<=≤<=*n*<=≤<=100000, 1<=≤<=*k*<=≤<=200000) — the size of a desired permutation and the number of *mergesort* calls required to sort it.
If a permutation of size *n* such that there will be exactly *k* calls of *mergesort* while sorting it doesn't exist, output <=-<=1. Otherwise output *n* integer numbers *a*[0],<=*a*[1],<=...,<=*a*[*n*<=-<=1] — the elements of a permutation that would meet the required conditions. If there are multiple answers, print any of them.
[ "3 3\n", "4 1\n", "5 6\n" ]
[ "2 1 3 ", "1 2 3 4 ", "-1\n" ]
none
0
[ { "input": "3 3", "output": "2 1 3 " }, { "input": "4 1", "output": "1 2 3 4 " }, { "input": "5 6", "output": "-1" }, { "input": "100 100", "output": "-1" }, { "input": "10000 10001", "output": "3 1 5 2 7 4 8 10 6 12 9 13 15 11 17 14 18 20 16 22 19 23 25 21 27 24 28 30 26 32 29 33 35 31 37 34 38 40 36 42 39 44 41 46 43 47 49 45 51 48 52 54 50 56 53 57 59 55 61 58 62 64 60 66 63 67 69 65 71 68 72 74 70 76 73 77 79 75 81 78 83 80 85 82 86 88 84 90 87 91 93 89 95 92 96 98 94 100 97 101 103 99 105 102 106 108 104 110 107 111 113 109 115 112 116 118 114 120 117 122 119 124 121 125 127 123 129 126 130 132 128 134 131 135 137 133 139 136 140 142 138 144 141 145 147 143 149 146 150 152 148 154 151 155 157..." }, { "input": "10000 20001", "output": "-1" }, { "input": "10000 30001", "output": "-1" }, { "input": "20000 10001", "output": "3 1 5 2 7 4 8 10 6 12 9 13 15 11 17 14 18 20 16 22 19 23 25 21 27 24 28 30 26 32 29 33 35 31 37 34 38 40 36 42 39 44 41 46 43 47 49 45 51 48 52 54 50 56 53 57 59 55 61 58 62 64 60 66 63 67 69 65 71 68 72 74 70 76 73 77 79 75 81 78 83 80 85 82 86 88 84 90 87 91 93 89 95 92 96 98 94 100 97 101 103 99 105 102 106 108 104 110 107 111 113 109 115 112 116 118 114 120 117 122 119 124 121 125 127 123 129 126 130 132 128 134 131 135 137 133 139 136 140 142 138 144 141 145 147 143 149 146 150 152 148 154 151 155 157..." }, { "input": "20000 20001", "output": "3 1 5 2 7 4 8 10 6 12 9 13 15 11 17 14 18 20 16 22 19 23 25 21 27 24 28 30 26 32 29 33 35 31 37 34 38 40 36 42 39 44 41 46 43 47 49 45 51 48 52 54 50 56 53 57 59 55 61 58 62 64 60 66 63 67 69 65 71 68 72 74 70 76 73 77 79 75 81 78 83 80 85 82 86 88 84 90 87 91 93 89 95 92 96 98 94 100 97 101 103 99 105 102 106 108 104 110 107 111 113 109 115 112 116 118 114 120 117 122 119 124 121 125 127 123 129 126 130 132 128 134 131 135 137 133 139 136 140 142 138 144 141 145 147 143 149 146 150 152 148 154 151 155 157..." }, { "input": "20000 30001", "output": "3 1 5 2 7 4 8 10 6 12 9 13 15 11 17 14 18 20 16 22 19 23 25 21 27 24 28 30 26 32 29 33 35 31 37 34 38 40 36 42 39 44 41 46 43 47 49 45 51 48 52 54 50 56 53 57 59 55 61 58 62 64 60 66 63 67 69 65 71 68 72 74 70 76 73 77 79 75 81 78 83 80 85 82 86 88 84 90 87 91 93 89 95 92 96 98 94 100 97 101 103 99 105 102 106 108 104 110 107 111 113 109 115 112 116 118 114 120 117 122 119 124 121 125 127 123 129 126 130 132 128 134 131 135 137 133 139 136 140 142 138 144 141 145 147 143 149 146 150 152 148 154 151 155 157..." }, { "input": "30000 10001", "output": "2 4 1 6 3 8 5 9 11 7 13 10 15 12 16 18 14 20 17 22 19 24 21 26 23 28 25 30 27 31 33 29 35 32 37 34 38 40 36 42 39 44 41 45 47 43 49 46 51 48 53 50 55 52 57 54 59 56 60 62 58 64 61 66 63 67 69 65 71 68 73 70 74 76 72 78 75 80 77 82 79 84 81 86 83 88 85 89 91 87 93 90 95 92 97 94 99 96 101 98 103 100 104 106 102 108 105 110 107 112 109 114 111 116 113 118 115 119 121 117 123 120 125 122 126 128 124 130 127 132 129 133 135 131 137 134 139 136 141 138 143 140 145 142 147 144 148 150 146 152 149 154 151 155 157..." }, { "input": "30000 20001", "output": "2 4 1 6 3 8 5 9 11 7 13 10 15 12 16 18 14 20 17 22 19 24 21 26 23 28 25 30 27 31 33 29 35 32 37 34 38 40 36 42 39 44 41 45 47 43 49 46 51 48 53 50 55 52 57 54 59 56 60 62 58 64 61 66 63 67 69 65 71 68 73 70 74 76 72 78 75 80 77 82 79 84 81 86 83 88 85 89 91 87 93 90 95 92 97 94 99 96 101 98 103 100 104 106 102 108 105 110 107 112 109 114 111 116 113 118 115 119 121 117 123 120 125 122 126 128 124 130 127 132 129 133 135 131 137 134 139 136 141 138 143 140 145 142 147 144 148 150 146 152 149 154 151 155 157..." }, { "input": "30000 30001", "output": "2 4 1 6 3 8 5 9 11 7 13 10 15 12 16 18 14 20 17 22 19 24 21 26 23 28 25 30 27 31 33 29 35 32 37 34 38 40 36 42 39 44 41 45 47 43 49 46 51 48 53 50 55 52 57 54 59 56 60 62 58 64 61 66 63 67 69 65 71 68 73 70 74 76 72 78 75 80 77 82 79 84 81 86 83 88 85 89 91 87 93 90 95 92 97 94 99 96 101 98 103 100 104 106 102 108 105 110 107 112 109 114 111 116 113 118 115 119 121 117 123 120 125 122 126 128 124 130 127 132 129 133 135 131 137 134 139 136 141 138 143 140 145 142 147 144 148 150 146 152 149 154 151 155 157..." }, { "input": "40000 10001", "output": "3 1 5 2 7 4 8 10 6 12 9 13 15 11 17 14 18 20 16 22 19 23 25 21 27 24 28 30 26 32 29 33 35 31 37 34 38 40 36 42 39 44 41 46 43 47 49 45 51 48 52 54 50 56 53 57 59 55 61 58 62 64 60 66 63 67 69 65 71 68 72 74 70 76 73 77 79 75 81 78 83 80 85 82 86 88 84 90 87 91 93 89 95 92 96 98 94 100 97 101 103 99 105 102 106 108 104 110 107 111 113 109 115 112 116 118 114 120 117 122 119 124 121 125 127 123 129 126 130 132 128 134 131 135 137 133 139 136 140 142 138 144 141 145 147 143 149 146 150 152 148 154 151 155 157..." }, { "input": "40000 20001", "output": "3 1 5 2 7 4 8 10 6 12 9 13 15 11 17 14 18 20 16 22 19 23 25 21 27 24 28 30 26 32 29 33 35 31 37 34 38 40 36 42 39 44 41 46 43 47 49 45 51 48 52 54 50 56 53 57 59 55 61 58 62 64 60 66 63 67 69 65 71 68 72 74 70 76 73 77 79 75 81 78 83 80 85 82 86 88 84 90 87 91 93 89 95 92 96 98 94 100 97 101 103 99 105 102 106 108 104 110 107 111 113 109 115 112 116 118 114 120 117 122 119 124 121 125 127 123 129 126 130 132 128 134 131 135 137 133 139 136 140 142 138 144 141 145 147 143 149 146 150 152 148 154 151 155 157..." }, { "input": "40000 30001", "output": "3 1 5 2 7 4 8 10 6 12 9 13 15 11 17 14 18 20 16 22 19 23 25 21 27 24 28 30 26 32 29 33 35 31 37 34 38 40 36 42 39 44 41 46 43 47 49 45 51 48 52 54 50 56 53 57 59 55 61 58 62 64 60 66 63 67 69 65 71 68 72 74 70 76 73 77 79 75 81 78 83 80 85 82 86 88 84 90 87 91 93 89 95 92 96 98 94 100 97 101 103 99 105 102 106 108 104 110 107 111 113 109 115 112 116 118 114 120 117 122 119 124 121 125 127 123 129 126 130 132 128 134 131 135 137 133 139 136 140 142 138 144 141 145 147 143 149 146 150 152 148 154 151 155 157..." }, { "input": "50000 10001", "output": "2 4 1 5 7 3 8 10 6 11 13 9 14 16 12 17 19 15 20 22 18 23 25 21 26 28 24 29 31 27 32 34 30 35 37 33 38 40 36 41 43 39 44 46 42 47 49 45 50 52 48 53 55 51 56 58 54 59 61 57 62 64 60 65 67 63 68 70 66 71 73 69 74 76 72 77 79 75 80 82 78 83 85 81 86 88 84 89 91 87 92 94 90 96 93 98 95 99 101 97 102 104 100 105 107 103 108 110 106 111 113 109 114 116 112 117 119 115 120 122 118 123 125 121 126 128 124 129 131 127 132 134 130 135 137 133 138 140 136 141 143 139 145 142 147 144 148 150 146 151 153 149 154 156 152..." }, { "input": "50000 20001", "output": "2 4 1 5 7 3 8 10 6 11 13 9 14 16 12 17 19 15 20 22 18 23 25 21 26 28 24 29 31 27 32 34 30 35 37 33 38 40 36 41 43 39 44 46 42 47 49 45 50 52 48 53 55 51 56 58 54 59 61 57 62 64 60 65 67 63 68 70 66 71 73 69 74 76 72 77 79 75 80 82 78 83 85 81 86 88 84 89 91 87 92 94 90 96 93 98 95 99 101 97 102 104 100 105 107 103 108 110 106 111 113 109 114 116 112 117 119 115 120 122 118 123 125 121 126 128 124 129 131 127 132 134 130 135 137 133 138 140 136 141 143 139 145 142 147 144 148 150 146 151 153 149 154 156 152..." }, { "input": "50000 30001", "output": "2 4 1 5 7 3 8 10 6 11 13 9 14 16 12 17 19 15 20 22 18 23 25 21 26 28 24 29 31 27 32 34 30 35 37 33 38 40 36 41 43 39 44 46 42 47 49 45 50 52 48 53 55 51 56 58 54 59 61 57 62 64 60 65 67 63 68 70 66 71 73 69 74 76 72 77 79 75 80 82 78 83 85 81 86 88 84 89 91 87 92 94 90 96 93 98 95 99 101 97 102 104 100 105 107 103 108 110 106 111 113 109 114 116 112 117 119 115 120 122 118 123 125 121 126 128 124 129 131 127 132 134 130 135 137 133 138 140 136 141 143 139 145 142 147 144 148 150 146 151 153 149 154 156 152..." }, { "input": "60000 10001", "output": "2 4 1 6 3 8 5 9 11 7 13 10 15 12 16 18 14 20 17 22 19 24 21 26 23 28 25 30 27 31 33 29 35 32 37 34 38 40 36 42 39 44 41 45 47 43 49 46 51 48 53 50 55 52 57 54 59 56 60 62 58 64 61 66 63 67 69 65 71 68 73 70 74 76 72 78 75 80 77 82 79 84 81 86 83 88 85 89 91 87 93 90 95 92 97 94 99 96 101 98 103 100 104 106 102 108 105 110 107 112 109 114 111 116 113 118 115 119 121 117 123 120 125 122 126 128 124 130 127 132 129 133 135 131 137 134 139 136 141 138 143 140 145 142 147 144 148 150 146 152 149 154 151 155 157..." }, { "input": "60000 20001", "output": "2 4 1 6 3 8 5 9 11 7 13 10 15 12 16 18 14 20 17 22 19 24 21 26 23 28 25 30 27 31 33 29 35 32 37 34 38 40 36 42 39 44 41 45 47 43 49 46 51 48 53 50 55 52 57 54 59 56 60 62 58 64 61 66 63 67 69 65 71 68 73 70 74 76 72 78 75 80 77 82 79 84 81 86 83 88 85 89 91 87 93 90 95 92 97 94 99 96 101 98 103 100 104 106 102 108 105 110 107 112 109 114 111 116 113 118 115 119 121 117 123 120 125 122 126 128 124 130 127 132 129 133 135 131 137 134 139 136 141 138 143 140 145 142 147 144 148 150 146 152 149 154 151 155 157..." }, { "input": "60000 30001", "output": "2 4 1 6 3 8 5 9 11 7 13 10 15 12 16 18 14 20 17 22 19 24 21 26 23 28 25 30 27 31 33 29 35 32 37 34 38 40 36 42 39 44 41 45 47 43 49 46 51 48 53 50 55 52 57 54 59 56 60 62 58 64 61 66 63 67 69 65 71 68 73 70 74 76 72 78 75 80 77 82 79 84 81 86 83 88 85 89 91 87 93 90 95 92 97 94 99 96 101 98 103 100 104 106 102 108 105 110 107 112 109 114 111 116 113 118 115 119 121 117 123 120 125 122 126 128 124 130 127 132 129 133 135 131 137 134 139 136 141 138 143 140 145 142 147 144 148 150 146 152 149 154 151 155 157..." }, { "input": "70000 10001", "output": "3 1 5 2 7 4 9 6 11 8 13 10 15 12 16 18 14 20 17 22 19 24 21 26 23 28 25 30 27 32 29 33 35 31 37 34 39 36 41 38 43 40 45 42 47 44 49 46 50 52 48 54 51 56 53 58 55 60 57 62 59 64 61 66 63 67 69 65 71 68 73 70 75 72 77 74 79 76 81 78 83 80 84 86 82 88 85 90 87 92 89 94 91 96 93 98 95 100 97 101 103 99 105 102 107 104 109 106 111 108 113 110 115 112 117 114 118 120 116 122 119 124 121 126 123 128 125 130 127 132 129 134 131 135 137 133 139 136 141 138 143 140 145 142 147 144 149 146 151 148 152 154 150 156 153..." }, { "input": "70000 20001", "output": "3 1 5 2 7 4 9 6 11 8 13 10 15 12 16 18 14 20 17 22 19 24 21 26 23 28 25 30 27 32 29 33 35 31 37 34 39 36 41 38 43 40 45 42 47 44 49 46 50 52 48 54 51 56 53 58 55 60 57 62 59 64 61 66 63 67 69 65 71 68 73 70 75 72 77 74 79 76 81 78 83 80 84 86 82 88 85 90 87 92 89 94 91 96 93 98 95 100 97 101 103 99 105 102 107 104 109 106 111 108 113 110 115 112 117 114 118 120 116 122 119 124 121 126 123 128 125 130 127 132 129 134 131 135 137 133 139 136 141 138 143 140 145 142 147 144 149 146 151 148 152 154 150 156 153..." }, { "input": "70000 30001", "output": "3 1 5 2 7 4 9 6 11 8 13 10 15 12 16 18 14 20 17 22 19 24 21 26 23 28 25 30 27 32 29 33 35 31 37 34 39 36 41 38 43 40 45 42 47 44 49 46 50 52 48 54 51 56 53 58 55 60 57 62 59 64 61 66 63 67 69 65 71 68 73 70 75 72 77 74 79 76 81 78 83 80 84 86 82 88 85 90 87 92 89 94 91 96 93 98 95 100 97 101 103 99 105 102 107 104 109 106 111 108 113 110 115 112 117 114 118 120 116 122 119 124 121 126 123 128 125 130 127 132 129 134 131 135 137 133 139 136 141 138 143 140 145 142 147 144 149 146 151 148 152 154 150 156 153..." }, { "input": "80000 10001", "output": "3 1 5 2 7 4 8 10 6 12 9 13 15 11 17 14 18 20 16 22 19 23 25 21 27 24 28 30 26 32 29 33 35 31 37 34 38 40 36 42 39 44 41 46 43 47 49 45 51 48 52 54 50 56 53 57 59 55 61 58 62 64 60 66 63 67 69 65 71 68 72 74 70 76 73 77 79 75 81 78 83 80 85 82 86 88 84 90 87 91 93 89 95 92 96 98 94 100 97 101 103 99 105 102 106 108 104 110 107 111 113 109 115 112 116 118 114 120 117 122 119 124 121 125 127 123 129 126 130 132 128 134 131 135 137 133 139 136 140 142 138 144 141 145 147 143 149 146 150 152 148 154 151 155 157..." }, { "input": "80000 20001", "output": "3 1 5 2 7 4 8 10 6 12 9 13 15 11 17 14 18 20 16 22 19 23 25 21 27 24 28 30 26 32 29 33 35 31 37 34 38 40 36 42 39 44 41 46 43 47 49 45 51 48 52 54 50 56 53 57 59 55 61 58 62 64 60 66 63 67 69 65 71 68 72 74 70 76 73 77 79 75 81 78 83 80 85 82 86 88 84 90 87 91 93 89 95 92 96 98 94 100 97 101 103 99 105 102 106 108 104 110 107 111 113 109 115 112 116 118 114 120 117 122 119 124 121 125 127 123 129 126 130 132 128 134 131 135 137 133 139 136 140 142 138 144 141 145 147 143 149 146 150 152 148 154 151 155 157..." }, { "input": "80000 30001", "output": "3 1 5 2 7 4 8 10 6 12 9 13 15 11 17 14 18 20 16 22 19 23 25 21 27 24 28 30 26 32 29 33 35 31 37 34 38 40 36 42 39 44 41 46 43 47 49 45 51 48 52 54 50 56 53 57 59 55 61 58 62 64 60 66 63 67 69 65 71 68 72 74 70 76 73 77 79 75 81 78 83 80 85 82 86 88 84 90 87 91 93 89 95 92 96 98 94 100 97 101 103 99 105 102 106 108 104 110 107 111 113 109 115 112 116 118 114 120 117 122 119 124 121 125 127 123 129 126 130 132 128 134 131 135 137 133 139 136 140 142 138 144 141 145 147 143 149 146 150 152 148 154 151 155 157..." }, { "input": "90000 10001", "output": "3 1 4 6 2 8 5 9 11 7 13 10 14 16 12 17 19 15 20 22 18 24 21 25 27 23 28 30 26 31 33 29 35 32 36 38 34 39 41 37 42 44 40 46 43 47 49 45 50 52 48 53 55 51 57 54 58 60 56 61 63 59 64 66 62 68 65 69 71 67 72 74 70 75 77 73 79 76 80 82 78 83 85 81 86 88 84 90 87 91 93 89 94 96 92 97 99 95 101 98 102 104 100 105 107 103 108 110 106 112 109 113 115 111 116 118 114 119 121 117 123 120 124 126 122 127 129 125 130 132 128 134 131 135 137 133 138 140 136 141 143 139 145 142 146 148 144 149 151 147 152 154 150 156 153..." }, { "input": "90000 20001", "output": "3 1 4 6 2 8 5 9 11 7 13 10 14 16 12 17 19 15 20 22 18 24 21 25 27 23 28 30 26 31 33 29 35 32 36 38 34 39 41 37 42 44 40 46 43 47 49 45 50 52 48 53 55 51 57 54 58 60 56 61 63 59 64 66 62 68 65 69 71 67 72 74 70 75 77 73 79 76 80 82 78 83 85 81 86 88 84 90 87 91 93 89 94 96 92 97 99 95 101 98 102 104 100 105 107 103 108 110 106 112 109 113 115 111 116 118 114 119 121 117 123 120 124 126 122 127 129 125 130 132 128 134 131 135 137 133 138 140 136 141 143 139 145 142 146 148 144 149 151 147 152 154 150 156 153..." }, { "input": "90000 30001", "output": "3 1 4 6 2 8 5 9 11 7 13 10 14 16 12 17 19 15 20 22 18 24 21 25 27 23 28 30 26 31 33 29 35 32 36 38 34 39 41 37 42 44 40 46 43 47 49 45 50 52 48 53 55 51 57 54 58 60 56 61 63 59 64 66 62 68 65 69 71 67 72 74 70 75 77 73 79 76 80 82 78 83 85 81 86 88 84 90 87 91 93 89 94 96 92 97 99 95 101 98 102 104 100 105 107 103 108 110 106 112 109 113 115 111 116 118 114 119 121 117 123 120 124 126 122 127 129 125 130 132 128 134 131 135 137 133 138 140 136 141 143 139 145 142 146 148 144 149 151 147 152 154 150 156 153..." }, { "input": "100000 10001", "output": "2 4 1 5 7 3 8 10 6 11 13 9 14 16 12 17 19 15 20 22 18 23 25 21 26 28 24 29 31 27 32 34 30 35 37 33 38 40 36 41 43 39 44 46 42 47 49 45 50 52 48 53 55 51 56 58 54 59 61 57 62 64 60 65 67 63 68 70 66 71 73 69 74 76 72 77 79 75 80 82 78 83 85 81 86 88 84 89 91 87 92 94 90 96 93 98 95 99 101 97 102 104 100 105 107 103 108 110 106 111 113 109 114 116 112 117 119 115 120 122 118 123 125 121 126 128 124 129 131 127 132 134 130 135 137 133 138 140 136 141 143 139 145 142 147 144 148 150 146 151 153 149 154 156 152..." }, { "input": "100000 20001", "output": "2 4 1 5 7 3 8 10 6 11 13 9 14 16 12 17 19 15 20 22 18 23 25 21 26 28 24 29 31 27 32 34 30 35 37 33 38 40 36 41 43 39 44 46 42 47 49 45 50 52 48 53 55 51 56 58 54 59 61 57 62 64 60 65 67 63 68 70 66 71 73 69 74 76 72 77 79 75 80 82 78 83 85 81 86 88 84 89 91 87 92 94 90 96 93 98 95 99 101 97 102 104 100 105 107 103 108 110 106 111 113 109 114 116 112 117 119 115 120 122 118 123 125 121 126 128 124 129 131 127 132 134 130 135 137 133 138 140 136 141 143 139 145 142 147 144 148 150 146 151 153 149 154 156 152..." }, { "input": "100000 30001", "output": "2 4 1 5 7 3 8 10 6 11 13 9 14 16 12 17 19 15 20 22 18 23 25 21 26 28 24 29 31 27 32 34 30 35 37 33 38 40 36 41 43 39 44 46 42 47 49 45 50 52 48 53 55 51 56 58 54 59 61 57 62 64 60 65 67 63 68 70 66 71 73 69 74 76 72 77 79 75 80 82 78 83 85 81 86 88 84 89 91 87 92 94 90 96 93 98 95 99 101 97 102 104 100 105 107 103 108 110 106 111 113 109 114 116 112 117 119 115 120 122 118 123 125 121 126 128 124 129 131 127 132 134 130 135 137 133 138 140 136 141 143 139 145 142 147 144 148 150 146 151 153 149 154 156 152..." }, { "input": "100000 199999", "output": "2 4 1 5 7 3 8 10 6 11 13 9 14 16 12 17 19 15 20 22 18 23 25 21 26 28 24 29 31 27 32 34 30 35 37 33 38 40 36 41 43 39 44 46 42 47 49 45 50 52 48 53 55 51 56 58 54 59 61 57 62 64 60 65 67 63 68 70 66 71 73 69 74 76 72 77 79 75 80 82 78 83 85 81 86 88 84 89 91 87 92 94 90 96 93 98 95 99 101 97 102 104 100 105 107 103 108 110 106 111 113 109 114 116 112 117 119 115 120 122 118 123 125 121 126 128 124 129 131 127 132 134 130 135 137 133 138 140 136 141 143 139 145 142 147 144 148 150 146 151 153 149 154 156 152..." }, { "input": "10 17", "output": "3 1 4 6 2 8 5 9 7 10 " } ]
1,646,602,532
2,147,483,647
Python 3
OK
TESTS
36
623
3,481,600
import os import sys import copy num = 0 a = None # sys.stdin = open(os.path.join(os.path.dirname(__file__),'35.in')) k = None def solve(): global k,a n, k = map(lambda x:int(x), input().split()) savek = copy.deepcopy(k) # print(a) a = [_+1 for _ in range(n)] def mgsort(l, r): global num,a,k mid = (l+r) >> 1 if r - l == 1 or k == 1: return k -= 2 a[l:mid] , a[mid:r] = a[mid:r] , a[l:mid] mgsort(l, mid) mgsort(mid, r) if k % 2 != 0: mgsort(0, n) if k == 1: for i in a: print(i,sep=' ',end=' ') else: print(-1) solve()
Title: Merge Sort Time Limit: None seconds Memory Limit: None megabytes Problem Description: Merge sort is a well-known sorting algorithm. The main function that sorts the elements of array *a* with indices from [*l*,<=*r*) can be implemented as follows: 1. If the segment [*l*,<=*r*) is already sorted in non-descending order (that is, for any *i* such that *l*<=≤<=*i*<=&lt;<=*r*<=-<=1 *a*[*i*]<=≤<=*a*[*i*<=+<=1]), then end the function call; 1. Let ; 1. Call *mergesort*(*a*,<=*l*,<=*mid*); 1. Call *mergesort*(*a*,<=*mid*,<=*r*); 1. Merge segments [*l*,<=*mid*) and [*mid*,<=*r*), making the segment [*l*,<=*r*) sorted in non-descending order. The merge algorithm doesn't call any other functions. The array in this problem is 0-indexed, so to sort the whole array, you need to call *mergesort*(*a*,<=0,<=*n*). The number of calls of function *mergesort* is very important, so Ivan has decided to calculate it while sorting the array. For example, if *a*<==<={1,<=2,<=3,<=4}, then there will be 1 call of *mergesort* — *mergesort*(0,<=4), which will check that the array is sorted and then end. If *a*<==<={2,<=1,<=3}, then the number of calls is 3: first of all, you call *mergesort*(0,<=3), which then sets *mid*<==<=1 and calls *mergesort*(0,<=1) and *mergesort*(1,<=3), which do not perform any recursive calls because segments (0,<=1) and (1,<=3) are sorted. Ivan has implemented the program that counts the number of *mergesort* calls, but now he needs to test it. To do this, he needs to find an array *a* such that *a* is a permutation of size *n* (that is, the number of elements in *a* is *n*, and every integer number from [1,<=*n*] can be found in this array), and the number of *mergesort* calls when sorting the array is exactly *k*. Help Ivan to find an array he wants! Input Specification: The first line contains two numbers *n* and *k* (1<=≤<=*n*<=≤<=100000, 1<=≤<=*k*<=≤<=200000) — the size of a desired permutation and the number of *mergesort* calls required to sort it. Output Specification: If a permutation of size *n* such that there will be exactly *k* calls of *mergesort* while sorting it doesn't exist, output <=-<=1. Otherwise output *n* integer numbers *a*[0],<=*a*[1],<=...,<=*a*[*n*<=-<=1] — the elements of a permutation that would meet the required conditions. If there are multiple answers, print any of them. Demo Input: ['3 3\n', '4 1\n', '5 6\n'] Demo Output: ['2 1 3 ', '1 2 3 4 ', '-1\n'] Note: none
```python import os import sys import copy num = 0 a = None # sys.stdin = open(os.path.join(os.path.dirname(__file__),'35.in')) k = None def solve(): global k,a n, k = map(lambda x:int(x), input().split()) savek = copy.deepcopy(k) # print(a) a = [_+1 for _ in range(n)] def mgsort(l, r): global num,a,k mid = (l+r) >> 1 if r - l == 1 or k == 1: return k -= 2 a[l:mid] , a[mid:r] = a[mid:r] , a[l:mid] mgsort(l, mid) mgsort(mid, r) if k % 2 != 0: mgsort(0, n) if k == 1: for i in a: print(i,sep=' ',end=' ') else: print(-1) solve() ```
3
816
B
Karen and Coffee
PROGRAMMING
1,400
[ "binary search", "data structures", "implementation" ]
null
null
To stay woke and attentive during classes, Karen needs some coffee! Karen, a coffee aficionado, wants to know the optimal temperature for brewing the perfect cup of coffee. Indeed, she has spent some time reading several recipe books, including the universally acclaimed "The Art of the Covfefe". She knows *n* coffee recipes. The *i*-th recipe suggests that coffee should be brewed between *l**i* and *r**i* degrees, inclusive, to achieve the optimal taste. Karen thinks that a temperature is admissible if at least *k* recipes recommend it. Karen has a rather fickle mind, and so she asks *q* questions. In each question, given that she only wants to prepare coffee with a temperature between *a* and *b*, inclusive, can you tell her how many admissible integer temperatures fall within the range?
The first line of input contains three integers, *n*, *k* (1<=≤<=*k*<=≤<=*n*<=≤<=200000), and *q* (1<=≤<=*q*<=≤<=200000), the number of recipes, the minimum number of recipes a certain temperature must be recommended by to be admissible, and the number of questions Karen has, respectively. The next *n* lines describe the recipes. Specifically, the *i*-th line among these contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=200000), describing that the *i*-th recipe suggests that the coffee be brewed between *l**i* and *r**i* degrees, inclusive. The next *q* lines describe the questions. Each of these lines contains *a* and *b*, (1<=≤<=*a*<=≤<=*b*<=≤<=200000), describing that she wants to know the number of admissible integer temperatures between *a* and *b* degrees, inclusive.
For each question, output a single integer on a line by itself, the number of admissible integer temperatures between *a* and *b* degrees, inclusive.
[ "3 2 4\n91 94\n92 97\n97 99\n92 94\n93 97\n95 96\n90 100\n", "2 1 1\n1 1\n200000 200000\n90 100\n" ]
[ "3\n3\n0\n4\n", "0\n" ]
In the first test case, Karen knows 3 recipes. 1. The first one recommends brewing the coffee between 91 and 94 degrees, inclusive. 1. The second one recommends brewing the coffee between 92 and 97 degrees, inclusive. 1. The third one recommends brewing the coffee between 97 and 99 degrees, inclusive. A temperature is admissible if at least 2 recipes recommend it. She asks 4 questions. In her first question, she wants to know the number of admissible integer temperatures between 92 and 94 degrees, inclusive. There are 3: 92, 93 and 94 degrees are all admissible. In her second question, she wants to know the number of admissible integer temperatures between 93 and 97 degrees, inclusive. There are 3: 93, 94 and 97 degrees are all admissible. In her third question, she wants to know the number of admissible integer temperatures between 95 and 96 degrees, inclusive. There are none. In her final question, she wants to know the number of admissible integer temperatures between 90 and 100 degrees, inclusive. There are 4: 92, 93, 94 and 97 degrees are all admissible. In the second test case, Karen knows 2 recipes. 1. The first one, "wikiHow to make Cold Brew Coffee", recommends brewing the coffee at exactly 1 degree. 1. The second one, "What good is coffee that isn't brewed at at least 36.3306 times the temperature of the surface of the sun?", recommends brewing the coffee at exactly 200000 degrees. A temperature is admissible if at least 1 recipe recommends it. In her first and only question, she wants to know the number of admissible integer temperatures that are actually reasonable. There are none.
1,000
[ { "input": "3 2 4\n91 94\n92 97\n97 99\n92 94\n93 97\n95 96\n90 100", "output": "3\n3\n0\n4" }, { "input": "2 1 1\n1 1\n200000 200000\n90 100", "output": "0" }, { "input": "1 1 1\n1 1\n1 1", "output": "1" }, { "input": "1 1 1\n200000 200000\n200000 200000", "output": "1" } ]
1,589,818,973
2,147,483,647
PyPy 3
OK
TESTS
45
920
10,342,400
from sys import stdin, stdout MN = 200005 inp = stdin.readline().split() n = int(inp[0]) k = int(inp[1]) q = int(inp[2]) dod = [0] * MN pref = [0] * MN cnt = 0 for i in range(0, n) : inp = stdin.readline().split() dod[int(inp[0])] += 1 dod[int(inp[1]) + 1] -= 1 for i in range(1, MN) : cnt += dod[i] pref[i] = pref[i - 1] if(cnt >= k) : pref[i] += 1 for i in range(0, q) : inp = stdin.readline().split() stdout.write(str(pref[int(inp[1])] - pref[int(inp[0]) - 1]) + "\n")
Title: Karen and Coffee Time Limit: None seconds Memory Limit: None megabytes Problem Description: To stay woke and attentive during classes, Karen needs some coffee! Karen, a coffee aficionado, wants to know the optimal temperature for brewing the perfect cup of coffee. Indeed, she has spent some time reading several recipe books, including the universally acclaimed "The Art of the Covfefe". She knows *n* coffee recipes. The *i*-th recipe suggests that coffee should be brewed between *l**i* and *r**i* degrees, inclusive, to achieve the optimal taste. Karen thinks that a temperature is admissible if at least *k* recipes recommend it. Karen has a rather fickle mind, and so she asks *q* questions. In each question, given that she only wants to prepare coffee with a temperature between *a* and *b*, inclusive, can you tell her how many admissible integer temperatures fall within the range? Input Specification: The first line of input contains three integers, *n*, *k* (1<=≤<=*k*<=≤<=*n*<=≤<=200000), and *q* (1<=≤<=*q*<=≤<=200000), the number of recipes, the minimum number of recipes a certain temperature must be recommended by to be admissible, and the number of questions Karen has, respectively. The next *n* lines describe the recipes. Specifically, the *i*-th line among these contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=200000), describing that the *i*-th recipe suggests that the coffee be brewed between *l**i* and *r**i* degrees, inclusive. The next *q* lines describe the questions. Each of these lines contains *a* and *b*, (1<=≤<=*a*<=≤<=*b*<=≤<=200000), describing that she wants to know the number of admissible integer temperatures between *a* and *b* degrees, inclusive. Output Specification: For each question, output a single integer on a line by itself, the number of admissible integer temperatures between *a* and *b* degrees, inclusive. Demo Input: ['3 2 4\n91 94\n92 97\n97 99\n92 94\n93 97\n95 96\n90 100\n', '2 1 1\n1 1\n200000 200000\n90 100\n'] Demo Output: ['3\n3\n0\n4\n', '0\n'] Note: In the first test case, Karen knows 3 recipes. 1. The first one recommends brewing the coffee between 91 and 94 degrees, inclusive. 1. The second one recommends brewing the coffee between 92 and 97 degrees, inclusive. 1. The third one recommends brewing the coffee between 97 and 99 degrees, inclusive. A temperature is admissible if at least 2 recipes recommend it. She asks 4 questions. In her first question, she wants to know the number of admissible integer temperatures between 92 and 94 degrees, inclusive. There are 3: 92, 93 and 94 degrees are all admissible. In her second question, she wants to know the number of admissible integer temperatures between 93 and 97 degrees, inclusive. There are 3: 93, 94 and 97 degrees are all admissible. In her third question, she wants to know the number of admissible integer temperatures between 95 and 96 degrees, inclusive. There are none. In her final question, she wants to know the number of admissible integer temperatures between 90 and 100 degrees, inclusive. There are 4: 92, 93, 94 and 97 degrees are all admissible. In the second test case, Karen knows 2 recipes. 1. The first one, "wikiHow to make Cold Brew Coffee", recommends brewing the coffee at exactly 1 degree. 1. The second one, "What good is coffee that isn't brewed at at least 36.3306 times the temperature of the surface of the sun?", recommends brewing the coffee at exactly 200000 degrees. A temperature is admissible if at least 1 recipe recommends it. In her first and only question, she wants to know the number of admissible integer temperatures that are actually reasonable. There are none.
```python from sys import stdin, stdout MN = 200005 inp = stdin.readline().split() n = int(inp[0]) k = int(inp[1]) q = int(inp[2]) dod = [0] * MN pref = [0] * MN cnt = 0 for i in range(0, n) : inp = stdin.readline().split() dod[int(inp[0])] += 1 dod[int(inp[1]) + 1] -= 1 for i in range(1, MN) : cnt += dod[i] pref[i] = pref[i - 1] if(cnt >= k) : pref[i] += 1 for i in range(0, q) : inp = stdin.readline().split() stdout.write(str(pref[int(inp[1])] - pref[int(inp[0]) - 1]) + "\n") ```
3
625
C
K-special Tables
PROGRAMMING
1,300
[ "constructive algorithms", "implementation" ]
null
null
People do many crazy things to stand out in a crowd. Some of them dance, some learn by heart rules of Russian language, some try to become an outstanding competitive programmers, while others collect funny math objects. Alis is among these collectors. Right now she wants to get one of *k*-special tables. In case you forget, the table *n*<=×<=*n* is called *k*-special if the following three conditions are satisfied: - every integer from 1 to *n*2 appears in the table exactly once; - in each row numbers are situated in increasing order; - the sum of numbers in the *k*-th column is maximum possible. Your goal is to help Alice and find at least one *k*-special table of size *n*<=×<=*n*. Both rows and columns are numbered from 1 to *n*, with rows numbered from top to bottom and columns numbered from left to right.
The first line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=500,<=1<=≤<=*k*<=≤<=*n*) — the size of the table Alice is looking for and the column that should have maximum possible sum.
First print the sum of the integers in the *k*-th column of the required table. Next *n* lines should contain the description of the table itself: first line should contains *n* elements of the first row, second line should contain *n* elements of the second row and so on. If there are multiple suitable table, you are allowed to print any.
[ "4 1\n", "5 3\n" ]
[ "28\n1 2 3 4\n5 6 7 8\n9 10 11 12\n13 14 15 16\n", "85\n5 6 17 18 19\n9 10 23 24 25\n7 8 20 21 22\n3 4 14 15 16\n1 2 11 12 13\n\n" ]
none
1,000
[ { "input": "4 1", "output": "28\n1 2 3 4\n5 6 7 8\n9 10 11 12\n13 14 15 16" }, { "input": "5 3", "output": "85\n1 2 11 12 13\n3 4 14 15 16\n5 6 17 18 19\n7 8 20 21 22\n9 10 23 24 25" }, { "input": "1 1", "output": "1\n1" }, { "input": "2 1", "output": "4\n1 2\n3 4" }, { "input": "2 2", "output": "7\n1 3\n2 4" }, { "input": "500 1", "output": "62375500\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..." }, { "input": "3 1", "output": "12\n1 2 3\n4 5 6\n7 8 9" }, { "input": "3 2", "output": "18\n1 4 5\n2 6 7\n3 8 9" }, { "input": "3 3", "output": "24\n1 2 7\n3 4 8\n5 6 9" }, { "input": "4 2", "output": "38\n1 5 6 7\n2 8 9 10\n3 11 12 13\n4 14 15 16" }, { "input": "4 3", "output": "48\n1 2 9 10\n3 4 11 12\n5 6 13 14\n7 8 15 16" }, { "input": "4 4", "output": "58\n1 2 3 13\n4 5 6 14\n7 8 9 15\n10 11 12 16" }, { "input": "5 1", "output": "55\n1 2 3 4 5\n6 7 8 9 10\n11 12 13 14 15\n16 17 18 19 20\n21 22 23 24 25" }, { "input": "5 2", "output": "70\n1 6 7 8 9\n2 10 11 12 13\n3 14 15 16 17\n4 18 19 20 21\n5 22 23 24 25" }, { "input": "5 4", "output": "100\n1 2 3 16 17\n4 5 6 18 19\n7 8 9 20 21\n10 11 12 22 23\n13 14 15 24 25" }, { "input": "5 5", "output": "115\n1 2 3 4 21\n5 6 7 8 22\n9 10 11 12 23\n13 14 15 16 24\n17 18 19 20 25" }, { "input": "6 1", "output": "96\n1 2 3 4 5 6\n7 8 9 10 11 12\n13 14 15 16 17 18\n19 20 21 22 23 24\n25 26 27 28 29 30\n31 32 33 34 35 36" }, { "input": "6 2", "output": "117\n1 7 8 9 10 11\n2 12 13 14 15 16\n3 17 18 19 20 21\n4 22 23 24 25 26\n5 27 28 29 30 31\n6 32 33 34 35 36" }, { "input": "6 3", "output": "138\n1 2 13 14 15 16\n3 4 17 18 19 20\n5 6 21 22 23 24\n7 8 25 26 27 28\n9 10 29 30 31 32\n11 12 33 34 35 36" }, { "input": "6 4", "output": "159\n1 2 3 19 20 21\n4 5 6 22 23 24\n7 8 9 25 26 27\n10 11 12 28 29 30\n13 14 15 31 32 33\n16 17 18 34 35 36" }, { "input": "6 5", "output": "180\n1 2 3 4 25 26\n5 6 7 8 27 28\n9 10 11 12 29 30\n13 14 15 16 31 32\n17 18 19 20 33 34\n21 22 23 24 35 36" }, { "input": "6 6", "output": "201\n1 2 3 4 5 31\n6 7 8 9 10 32\n11 12 13 14 15 33\n16 17 18 19 20 34\n21 22 23 24 25 35\n26 27 28 29 30 36" }, { "input": "500 500", "output": "124875250\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 ..." }, { "input": "500 250", "output": "93562750\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..." }, { "input": "94 3", "output": "419898\n1 2 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280\n3 4 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 31..." }, { "input": "22 4", "output": "5863\n1 2 3 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85\n4 5 6 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104\n7 8 9 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123\n10 11 12 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142\n13 14 15 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161\n16 17 18 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180\n19 20 21 181 182 183 184 185 18..." }, { "input": "15 12", "output": "2910\n1 2 3 4 5 6 7 8 9 10 11 166 167 168 169\n12 13 14 15 16 17 18 19 20 21 22 170 171 172 173\n23 24 25 26 27 28 29 30 31 32 33 174 175 176 177\n34 35 36 37 38 39 40 41 42 43 44 178 179 180 181\n45 46 47 48 49 50 51 52 53 54 55 182 183 184 185\n56 57 58 59 60 61 62 63 64 65 66 186 187 188 189\n67 68 69 70 71 72 73 74 75 76 77 190 191 192 193\n78 79 80 81 82 83 84 85 86 87 88 194 195 196 197\n89 90 91 92 93 94 95 96 97 98 99 198 199 200 201\n100 101 102 103 104 105 106 107 108 109 110 202 203 204 205\n111..." }, { "input": "37 35", "output": "48581\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 1259 1260 1261\n35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 1262 1263 1264\n69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 1265 1266 1267\n103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 1268 1269 1270\n137 ..." }, { "input": "87 51", "output": "516954\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 4351 4352 4353 4354 4355 4356 4357 4358 4359 4360 4361 4362 4363 4364 4365 4366 4367 4368 4369 4370 4371 4372 4373 4374 4375 4376 4377 4378 4379 4380 4381 4382 4383 4384 4385 4386 4387\n51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 4388 4389 4390 4391 4392 ..." }, { "input": "15 4", "output": "1950\n1 2 3 46 47 48 49 50 51 52 53 54 55 56 57\n4 5 6 58 59 60 61 62 63 64 65 66 67 68 69\n7 8 9 70 71 72 73 74 75 76 77 78 79 80 81\n10 11 12 82 83 84 85 86 87 88 89 90 91 92 93\n13 14 15 94 95 96 97 98 99 100 101 102 103 104 105\n16 17 18 106 107 108 109 110 111 112 113 114 115 116 117\n19 20 21 118 119 120 121 122 123 124 125 126 127 128 129\n22 23 24 130 131 132 133 134 135 136 137 138 139 140 141\n25 26 27 142 143 144 145 146 147 148 149 150 151 152 153\n28 29 30 154 155 156 157 158 159 160 161 162 1..." }, { "input": "183 2", "output": "3064518\n1 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 ..." }, { "input": "103 6", "output": "567942\n1 2 3 4 5 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613\n6 7 8 9 10 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 6..." }, { "input": "131 11", "output": "1202056\n1 2 3 4 5 6 7 8 9 10 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 1323 1324 1325 1326 1327 1328 1329 1330 1331 1332 1333 1334 1335 1336 1337 1338 1339 1340 1341 1342 1343 1344 1345 1346 1347 1348 1349 1350 1351 1352 1353 1354 1355 1356 1357 1358 1359 1360 1361 1362 1363 1364 1365 1366 1367 1368 1369 1370 1371 1372 1373 1374 1375 1376 1377 1378 1379 1380 1381 1382 1383 1384 1385 1386 1387 1388 1389 1390 1391 1392 1393 1394 1395 1396 1397 1398 1399 1400 1401 1402 1403 1404 1405 1406 1..." }, { "input": "193 186", "output": "7039482\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..." }, { "input": "117 109", "output": "1539603\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 12637 12638 12639 12640 12641 12642 12643 12644 12645\n109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139..." }, { "input": "116 91", "output": "1384576\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 10441 10442 10443 10444 10445 10446 10447 10448 10449 10450 10451 10452 10453 10454 10455 10456 10457 10458 10459 10460 10461 10462 10463 10464 10465 10466\n91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 1..." }, { "input": "140 79", "output": "2132200\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 10921 10922 10923 10924 10925 10926 10927 10928 10929 10930 10931 10932 10933 10934 10935 10936 10937 10938 10939 10940 10941 10942 10943 10944 10945 10946 10947 10948 10949 10950 10951 10952 10953 10954 10955 10956 10957 10958 10959 10960 10961 10962 10963 10964 10965 10966 1..." }, { "input": "350 14", "output": "22175125\n1 2 3 4 5 6 7 8 9 10 11 12 13 4551 4552 4553 4554 4555 4556 4557 4558 4559 4560 4561 4562 4563 4564 4565 4566 4567 4568 4569 4570 4571 4572 4573 4574 4575 4576 4577 4578 4579 4580 4581 4582 4583 4584 4585 4586 4587 4588 4589 4590 4591 4592 4593 4594 4595 4596 4597 4598 4599 4600 4601 4602 4603 4604 4605 4606 4607 4608 4609 4610 4611 4612 4613 4614 4615 4616 4617 4618 4619 4620 4621 4622 4623 4624 4625 4626 4627 4628 4629 4630 4631 4632 4633 4634 4635 4636 4637 4638 4639 4640 4641 4642 4643 4644 4..." }, { "input": "374 9", "output": "26648248\n1 2 3 4 5 6 7 8 2993 2994 2995 2996 2997 2998 2999 3000 3001 3002 3003 3004 3005 3006 3007 3008 3009 3010 3011 3012 3013 3014 3015 3016 3017 3018 3019 3020 3021 3022 3023 3024 3025 3026 3027 3028 3029 3030 3031 3032 3033 3034 3035 3036 3037 3038 3039 3040 3041 3042 3043 3044 3045 3046 3047 3048 3049 3050 3051 3052 3053 3054 3055 3056 3057 3058 3059 3060 3061 3062 3063 3064 3065 3066 3067 3068 3069 3070 3071 3072 3073 3074 3075 3076 3077 3078 3079 3080 3081 3082 3083 3084 3085 3086 3087 3088 3089 ..." }, { "input": "265 255", "output": "18222195\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..." }, { "input": "289 287", "output": "24012143\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..." }, { "input": "276 11", "output": "10856736\n1 2 3 4 5 6 7 8 9 10 2761 2762 2763 2764 2765 2766 2767 2768 2769 2770 2771 2772 2773 2774 2775 2776 2777 2778 2779 2780 2781 2782 2783 2784 2785 2786 2787 2788 2789 2790 2791 2792 2793 2794 2795 2796 2797 2798 2799 2800 2801 2802 2803 2804 2805 2806 2807 2808 2809 2810 2811 2812 2813 2814 2815 2816 2817 2818 2819 2820 2821 2822 2823 2824 2825 2826 2827 2828 2829 2830 2831 2832 2833 2834 2835 2836 2837 2838 2839 2840 2841 2842 2843 2844 2845 2846 2847 2848 2849 2850 2851 2852 2853 2854 2855 2856 ..." }, { "input": "204 7", "output": "4349688\n1 2 3 4 5 6 1225 1226 1227 1228 1229 1230 1231 1232 1233 1234 1235 1236 1237 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283 1284 1285 1286 1287 1288 1289 1290 1291 1292 1293 1294 1295 1296 1297 1298 1299 1300 1301 1302 1303 1304 1305 1306 1307 1308 1309 1310 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 ..." }, { "input": "425 15", "output": "39560275\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 5951 5952 5953 5954 5955 5956 5957 5958 5959 5960 5961 5962 5963 5964 5965 5966 5967 5968 5969 5970 5971 5972 5973 5974 5975 5976 5977 5978 5979 5980 5981 5982 5983 5984 5985 5986 5987 5988 5989 5990 5991 5992 5993 5994 5995 5996 5997 5998 5999 6000 6001 6002 6003 6004 6005 6006 6007 6008 6009 6010 6011 6012 6013 6014 6015 6016 6017 6018 6019 6020 6021 6022 6023 6024 6025 6026 6027 6028 6029 6030 6031 6032 6033 6034 6035 6036 6037 6038 6039 6040 6041 6042 6043 604..." }, { "input": "449 6", "output": "45664198\n1 2 3 4 5 2246 2247 2248 2249 2250 2251 2252 2253 2254 2255 2256 2257 2258 2259 2260 2261 2262 2263 2264 2265 2266 2267 2268 2269 2270 2271 2272 2273 2274 2275 2276 2277 2278 2279 2280 2281 2282 2283 2284 2285 2286 2287 2288 2289 2290 2291 2292 2293 2294 2295 2296 2297 2298 2299 2300 2301 2302 2303 2304 2305 2306 2307 2308 2309 2310 2311 2312 2313 2314 2315 2316 2317 2318 2319 2320 2321 2322 2323 2324 2325 2326 2327 2328 2329 2330 2331 2332 2333 2334 2335 2336 2337 2338 2339 2340 2341 2342 2343 2..." }, { "input": "477 19", "output": "56204433\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 8587 8588 8589 8590 8591 8592 8593 8594 8595 8596 8597 8598 8599 8600 8601 8602 8603 8604 8605 8606 8607 8608 8609 8610 8611 8612 8613 8614 8615 8616 8617 8618 8619 8620 8621 8622 8623 8624 8625 8626 8627 8628 8629 8630 8631 8632 8633 8634 8635 8636 8637 8638 8639 8640 8641 8642 8643 8644 8645 8646 8647 8648 8649 8650 8651 8652 8653 8654 8655 8656 8657 8658 8659 8660 8661 8662 8663 8664 8665 8666 8667 8668 8669 8670 8671 8672 8673 8674 8675 8676 8677 8..." }, { "input": "448 437", "output": "88708928\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..." }, { "input": "472 459", "output": "103591728\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 ..." }, { "input": "500 494", "output": "124123750\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 ..." }, { "input": "462 318", "output": "83103405\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..." }, { "input": "486 481", "output": "114081696\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 ..." }, { "input": "410 361", "output": "64708660\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..." } ]
1,521,226,481
2,381
Python 3
OK
TESTS
52
686
14,233,600
R = lambda : map(int, input().split()) n,k = R() l = 0 r = [[0 for _ in range(n)] for _ in range(n)] for i in range(n): for j in range(k-1): l += 1 r[i][j] = l for i in range(n): for j in range(k-1,n): l += 1 r[i][j] = l s = 0 for i in range(n): s += r[i][k-1] print(s) for i in range(n): print(*r[i])
Title: K-special Tables Time Limit: None seconds Memory Limit: None megabytes Problem Description: People do many crazy things to stand out in a crowd. Some of them dance, some learn by heart rules of Russian language, some try to become an outstanding competitive programmers, while others collect funny math objects. Alis is among these collectors. Right now she wants to get one of *k*-special tables. In case you forget, the table *n*<=×<=*n* is called *k*-special if the following three conditions are satisfied: - every integer from 1 to *n*2 appears in the table exactly once; - in each row numbers are situated in increasing order; - the sum of numbers in the *k*-th column is maximum possible. Your goal is to help Alice and find at least one *k*-special table of size *n*<=×<=*n*. Both rows and columns are numbered from 1 to *n*, with rows numbered from top to bottom and columns numbered from left to right. Input Specification: The first line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=500,<=1<=≤<=*k*<=≤<=*n*) — the size of the table Alice is looking for and the column that should have maximum possible sum. Output Specification: First print the sum of the integers in the *k*-th column of the required table. Next *n* lines should contain the description of the table itself: first line should contains *n* elements of the first row, second line should contain *n* elements of the second row and so on. If there are multiple suitable table, you are allowed to print any. Demo Input: ['4 1\n', '5 3\n'] Demo Output: ['28\n1 2 3 4\n5 6 7 8\n9 10 11 12\n13 14 15 16\n', '85\n5 6 17 18 19\n9 10 23 24 25\n7 8 20 21 22\n3 4 14 15 16\n1 2 11 12 13\n\n'] Note: none
```python R = lambda : map(int, input().split()) n,k = R() l = 0 r = [[0 for _ in range(n)] for _ in range(n)] for i in range(n): for j in range(k-1): l += 1 r[i][j] = l for i in range(n): for j in range(k-1,n): l += 1 r[i][j] = l s = 0 for i in range(n): s += r[i][k-1] print(s) for i in range(n): print(*r[i]) ```
3
817
C
Really Big Numbers
PROGRAMMING
1,600
[ "binary search", "brute force", "dp", "math" ]
null
null
Ivan likes to learn different things about numbers, but he is especially interested in really big numbers. Ivan thinks that a positive integer number *x* is really big if the difference between *x* and the sum of its digits (in decimal representation) is not less than *s*. To prove that these numbers may have different special properties, he wants to know how rare (or not rare) they are — in fact, he needs to calculate the quantity of really big numbers that are not greater than *n*. Ivan tried to do the calculations himself, but soon realized that it's too difficult for him. So he asked you to help him in calculations.
The first (and the only) line contains two integers *n* and *s* (1<=≤<=*n*,<=*s*<=≤<=1018).
Print one integer — the quantity of really big numbers that are not greater than *n*.
[ "12 1\n", "25 20\n", "10 9\n" ]
[ "3\n", "0\n", "1\n" ]
In the first example numbers 10, 11 and 12 are really big. In the second example there are no really big numbers that are not greater than 25 (in fact, the first really big number is 30: 30 - 3 ≥ 20). In the third example 10 is the only really big number (10 - 1 ≥ 9).
0
[ { "input": "12 1", "output": "3" }, { "input": "25 20", "output": "0" }, { "input": "10 9", "output": "1" }, { "input": "300 1000", "output": "0" }, { "input": "500 1000", "output": "0" }, { "input": "1000 2000", "output": "0" }, { "input": "10000 1000", "output": "8991" }, { "input": "1000000000000000000 1000000000000000000", "output": "0" }, { "input": "1000000000000000000 100000000000000000", "output": "899999999999999991" }, { "input": "1000000000000000000 10000000000000000", "output": "989999999999999991" }, { "input": "1000000000000000000 1000000000000000", "output": "998999999999999991" }, { "input": "1000000000000000000 100000000000000", "output": "999899999999999991" }, { "input": "1000000000000000000 200000000000000000", "output": "799999999999999991" }, { "input": "10 5", "output": "1" }, { "input": "20 5", "output": "11" }, { "input": "20 9", "output": "11" }, { "input": "100 9", "output": "91" }, { "input": "1 1", "output": "0" }, { "input": "130 118", "output": "1" }, { "input": "190 181", "output": "0" }, { "input": "1999 1971", "output": "10" }, { "input": "100 99", "output": "1" }, { "input": "6909094398 719694282", "output": "6189400069" }, { "input": "260 258", "output": "0" }, { "input": "35 19", "output": "6" }, { "input": "100 87", "output": "1" }, { "input": "91 89", "output": "0" }, { "input": "109 89", "output": "10" }, { "input": "109 91", "output": "10" }, { "input": "20331 11580", "output": "8732" }, { "input": "405487470 255750281", "output": "149737161" }, { "input": "17382 12863", "output": "4493" }, { "input": "19725 14457", "output": "5246" }, { "input": "24848 15384", "output": "9449" }, { "input": "25727 15982", "output": "9728" }, { "input": "109 90", "output": "10" }, { "input": "1000000000000000000 999999999999999999", "output": "1" }, { "input": "1000000000000000000 999999999999999998", "output": "1" }, { "input": "1009 980", "output": "10" }, { "input": "999999999999999999 999999999999999838", "output": "0" }, { "input": "1000000000000000000 99999999999999800", "output": "900000000000000061" }, { "input": "8785369357 3377262261", "output": "5408107058" }, { "input": "110 109", "output": "0" }, { "input": "999 777", "output": "200" }, { "input": "327170000015578 77230000029054", "output": "249939999986479" }, { "input": "12515000022229 1791000022317", "output": "10723999999880" }, { "input": "9999999999999 9999999999882", "output": "10" }, { "input": "213 196", "output": "14" }, { "input": "92 82", "output": "0" }, { "input": "148 136", "output": "0" }, { "input": "8 9", "output": "0" }, { "input": "309 299", "output": "0" }, { "input": "9999 9963", "output": "10" }, { "input": "82 81", "output": "0" }, { "input": "9999999 9999936", "output": "10" }, { "input": "171 155", "output": "2" }, { "input": "999 972", "output": "10" }, { "input": "999999999999 999999999891", "output": "10" }, { "input": "9 9", "output": "0" }, { "input": "6900 6885", "output": "1" }, { "input": "96 57", "output": "27" }, { "input": "5 4", "output": "0" }, { "input": "17386 5814", "output": "11557" }, { "input": "493679757404593 316259583979965", "output": "177420173424564" }, { "input": "18474 9478", "output": "8975" }, { "input": "270091571496186 250931112649966", "output": "19160458846177" }, { "input": "565751690089037 381448507916936", "output": "184303182172038" }, { "input": "19 10", "output": "0" } ]
1,527,182,187
2,787
Python 3
OK
TESTS
68
78
0
#!/usr/bin/env python3 [n, s] = map(int, input().strip().split()) def sumdigit(x): return sum(map(int, str(x))) def fsum(x): return x - sumdigit(x) # first x in (xmin, xmax] that fsum(x) >= s def binsearch(s, xmin, xmax): while xmax - xmin > 1: xmid = (xmax + xmin) // 2 if fsum(xmid) >= s: xmax = xmid else: xmin = xmid return xmax xmin = 0 xmax = 1 while fsum(xmax) < s: xmin = xmax xmax *= 2 x = binsearch(s, xmin, xmax) print (max(n - x + 1, 0))
Title: Really Big Numbers Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ivan likes to learn different things about numbers, but he is especially interested in really big numbers. Ivan thinks that a positive integer number *x* is really big if the difference between *x* and the sum of its digits (in decimal representation) is not less than *s*. To prove that these numbers may have different special properties, he wants to know how rare (or not rare) they are — in fact, he needs to calculate the quantity of really big numbers that are not greater than *n*. Ivan tried to do the calculations himself, but soon realized that it's too difficult for him. So he asked you to help him in calculations. Input Specification: The first (and the only) line contains two integers *n* and *s* (1<=≤<=*n*,<=*s*<=≤<=1018). Output Specification: Print one integer — the quantity of really big numbers that are not greater than *n*. Demo Input: ['12 1\n', '25 20\n', '10 9\n'] Demo Output: ['3\n', '0\n', '1\n'] Note: In the first example numbers 10, 11 and 12 are really big. In the second example there are no really big numbers that are not greater than 25 (in fact, the first really big number is 30: 30 - 3 ≥ 20). In the third example 10 is the only really big number (10 - 1 ≥ 9).
```python #!/usr/bin/env python3 [n, s] = map(int, input().strip().split()) def sumdigit(x): return sum(map(int, str(x))) def fsum(x): return x - sumdigit(x) # first x in (xmin, xmax] that fsum(x) >= s def binsearch(s, xmin, xmax): while xmax - xmin > 1: xmid = (xmax + xmin) // 2 if fsum(xmid) >= s: xmax = xmid else: xmin = xmid return xmax xmin = 0 xmax = 1 while fsum(xmax) < s: xmin = xmax xmax *= 2 x = binsearch(s, xmin, xmax) print (max(n - x + 1, 0)) ```
3
758
A
Holiday Of Equality
PROGRAMMING
800
[ "implementation", "math" ]
null
null
In Berland it is the holiday of equality. In honor of the holiday the king decided to equalize the welfare of all citizens in Berland by the expense of the state treasury. Totally in Berland there are *n* citizens, the welfare of each of them is estimated as the integer in *a**i* burles (burle is the currency in Berland). You are the royal treasurer, which needs to count the minimum charges of the kingdom on the king's present. The king can only give money, he hasn't a power to take away them.
The first line contains the integer *n* (1<=≤<=*n*<=≤<=100) — the number of citizens in the kingdom. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (0<=≤<=*a**i*<=≤<=106) — the welfare of the *i*-th citizen.
In the only line print the integer *S* — the minimum number of burles which are had to spend.
[ "5\n0 1 2 3 4\n", "5\n1 1 0 1 1\n", "3\n1 3 1\n", "1\n12\n" ]
[ "10", "1", "4", "0" ]
In the first example if we add to the first citizen 4 burles, to the second 3, to the third 2 and to the fourth 1, then the welfare of all citizens will equal 4. In the second example it is enough to give one burle to the third citizen. In the third example it is necessary to give two burles to the first and the third citizens to make the welfare of citizens equal 3. In the fourth example it is possible to give nothing to everyone because all citizens have 12 burles.
500
[ { "input": "5\n0 1 2 3 4", "output": "10" }, { "input": "5\n1 1 0 1 1", "output": "1" }, { "input": "3\n1 3 1", "output": "4" }, { "input": "1\n12", "output": "0" }, { "input": "3\n1 2 3", "output": "3" }, { "input": "14\n52518 718438 358883 462189 853171 592966 225788 46977 814826 295697 676256 561479 56545 764281", "output": "5464380" }, { "input": "21\n842556 216391 427181 626688 775504 168309 851038 448402 880826 73697 593338 519033 135115 20128 424606 939484 846242 756907 377058 241543 29353", "output": "9535765" }, { "input": "3\n1 3 2", "output": "3" }, { "input": "3\n2 1 3", "output": "3" }, { "input": "3\n2 3 1", "output": "3" }, { "input": "3\n3 1 2", "output": "3" }, { "input": "3\n3 2 1", "output": "3" }, { "input": "1\n228503", "output": "0" }, { "input": "2\n32576 550340", "output": "517764" }, { "input": "3\n910648 542843 537125", "output": "741328" }, { "input": "4\n751720 572344 569387 893618", "output": "787403" }, { "input": "6\n433864 631347 597596 794426 713555 231193", "output": "1364575" }, { "input": "9\n31078 645168 695751 126111 375934 150495 838412 434477 993107", "output": "4647430" }, { "input": "30\n315421 772664 560686 654312 151528 356749 351486 707462 820089 226682 546700 136028 824236 842130 578079 337807 665903 764100 617900 822937 992759 591749 651310 742085 767695 695442 17967 515106 81059 186025", "output": "13488674" }, { "input": "45\n908719 394261 815134 419990 926993 383792 772842 277695 527137 655356 684956 695716 273062 550324 106247 399133 442382 33076 462920 294674 846052 817752 421365 474141 290471 358990 109812 74492 543281 169434 919692 786809 24028 197184 310029 801476 699355 429672 51343 374128 776726 850380 293868 981569 550763", "output": "21993384" }, { "input": "56\n100728 972537 13846 385421 756708 184642 259487 319707 376662 221694 675284 972837 499419 13846 38267 289898 901299 831197 954715 197515 514102 910423 127555 883934 362472 870788 538802 741008 973434 448124 391526 363321 947321 544618 68006 782313 955075 741981 815027 723297 585059 718114 700739 413489 454091 736144 308999 98065 3716 347323 9635 289003 986510 607065 60236 273351", "output": "26984185" }, { "input": "70\n644488 5444 150441 714420 602059 335330 510670 196555 546346 740011 509449 850947 692874 524857 750434 952985 223744 374727 896124 753037 367352 679050 560202 172728 569291 778616 332116 286927 843598 372698 244906 498046 900681 709791 420904 724593 864493 813094 791377 39998 296710 625656 403891 579231 706693 984045 16901 574259 562265 761104 930361 256045 124461 538980 573508 372148 988722 108592 784354 55302 232524 277205 782251 299943 436488 743389 324618 742543 266915 99642", "output": "32816391" }, { "input": "1\n0", "output": "0" }, { "input": "1\n1000000", "output": "0" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "100\n1000000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "99000000" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1000000", "output": "99000000" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1000000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "99000000" }, { "input": "3\n0 0 0", "output": "0" }, { "input": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "3\n5 0 0", "output": "10" }, { "input": "5\n2 10 0 0 0", "output": "38" } ]
1,698,665,270
2,147,483,647
PyPy 3-64
OK
TESTS
41
62
0
input() ls = list(map(int,input().split())) mx = max(ls) x = 0 for i in ls: x+=mx-i print(x)
Title: Holiday Of Equality Time Limit: None seconds Memory Limit: None megabytes Problem Description: In Berland it is the holiday of equality. In honor of the holiday the king decided to equalize the welfare of all citizens in Berland by the expense of the state treasury. Totally in Berland there are *n* citizens, the welfare of each of them is estimated as the integer in *a**i* burles (burle is the currency in Berland). You are the royal treasurer, which needs to count the minimum charges of the kingdom on the king's present. The king can only give money, he hasn't a power to take away them. Input Specification: The first line contains the integer *n* (1<=≤<=*n*<=≤<=100) — the number of citizens in the kingdom. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (0<=≤<=*a**i*<=≤<=106) — the welfare of the *i*-th citizen. Output Specification: In the only line print the integer *S* — the minimum number of burles which are had to spend. Demo Input: ['5\n0 1 2 3 4\n', '5\n1 1 0 1 1\n', '3\n1 3 1\n', '1\n12\n'] Demo Output: ['10', '1', '4', '0'] Note: In the first example if we add to the first citizen 4 burles, to the second 3, to the third 2 and to the fourth 1, then the welfare of all citizens will equal 4. In the second example it is enough to give one burle to the third citizen. In the third example it is necessary to give two burles to the first and the third citizens to make the welfare of citizens equal 3. In the fourth example it is possible to give nothing to everyone because all citizens have 12 burles.
```python input() ls = list(map(int,input().split())) mx = max(ls) x = 0 for i in ls: x+=mx-i print(x) ```
3
58
A
Chat room
PROGRAMMING
1,000
[ "greedy", "strings" ]
A. Chat room
1
256
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
If Vasya managed to say hello, print "YES", otherwise print "NO".
[ "ahhellllloou\n", "hlelo\n" ]
[ "YES\n", "NO\n" ]
none
500
[ { "input": "ahhellllloou", "output": "YES" }, { "input": "hlelo", "output": "NO" }, { "input": "helhcludoo", "output": "YES" }, { "input": "hehwelloho", "output": "YES" }, { "input": "pnnepelqomhhheollvlo", "output": "YES" }, { "input": "tymbzjyqhymedasloqbq", "output": "NO" }, { "input": "yehluhlkwo", "output": "NO" }, { "input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello", "output": "YES" }, { "input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq", "output": "YES" }, { "input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi", "output": "YES" }, { "input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo", "output": "YES" }, { "input": "lqllcolohwflhfhlnaow", "output": "NO" }, { "input": "heheeellollvoo", "output": "YES" }, { "input": "hellooo", "output": "YES" }, { "input": "o", "output": "NO" }, { "input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv", "output": "YES" }, { "input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk", "output": "YES" }, { "input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry", "output": "NO" }, { "input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq", "output": "NO" }, { "input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi", "output": "YES" }, { "input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm", "output": "YES" }, { "input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac", "output": "NO" }, { "input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok", "output": "YES" }, { "input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz", "output": "YES" }, { "input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb", "output": "YES" }, { "input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla", "output": "YES" }, { "input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz", "output": "YES" }, { "input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti", "output": "YES" }, { "input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli", "output": "YES" }, { "input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo", "output": "YES" }, { "input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk", "output": "NO" }, { "input": "loee", "output": "NO" }, { "input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo", "output": "NO" }, { "input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi", "output": "YES" }, { "input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv", "output": "NO" }, { "input": "hello", "output": "YES" }, { "input": "oohell", "output": "NO" }, { "input": "hell", "output": "NO" }, { "input": "eloellohoelo", "output": "NO" }, { "input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo", "output": "YES" } ]
1,693,500,407
2,147,483,647
PyPy 3-64
OK
TESTS
40
62
0
t=input() s='hello' j=0 for i in range(len(t)): if t[i]==s[j]: j+=1 if j==5: print('YES') break else: print('NO')
Title: Chat room Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*. Input Specification: The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters. Output Specification: If Vasya managed to say hello, print "YES", otherwise print "NO". Demo Input: ['ahhellllloou\n', 'hlelo\n'] Demo Output: ['YES\n', 'NO\n'] Note: none
```python t=input() s='hello' j=0 for i in range(len(t)): if t[i]==s[j]: j+=1 if j==5: print('YES') break else: print('NO') ```
3.969
41
A
Translation
PROGRAMMING
800
[ "implementation", "strings" ]
A. Translation
2
256
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
[ "code\nedoc\n", "abb\naba\n", "code\ncode\n" ]
[ "YES\n", "NO\n", "NO\n" ]
none
500
[ { "input": "code\nedoc", "output": "YES" }, { "input": "abb\naba", "output": "NO" }, { "input": "code\ncode", "output": "NO" }, { "input": "abacaba\nabacaba", "output": "YES" }, { "input": "q\nq", "output": "YES" }, { "input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk", "output": "NO" }, { "input": "z\na", "output": "NO" }, { "input": "asd\ndsa", "output": "YES" }, { "input": "abcdef\nfecdba", "output": "NO" }, { "input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu", "output": "NO" }, { "input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf", "output": "NO" }, { "input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp", "output": "NO" }, { "input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb", "output": "NO" }, { "input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom", "output": "NO" }, { "input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh", "output": "NO" }, { "input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy", "output": "NO" }, { "input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko", "output": "NO" }, { "input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv", "output": "NO" }, { "input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd", "output": "NO" }, { "input": "w\nw", "output": "YES" }, { "input": "vz\nzv", "output": "YES" }, { "input": "ry\nyr", "output": "YES" }, { "input": "xou\nuox", "output": "YES" }, { "input": "axg\ngax", "output": "NO" }, { "input": "zdsl\nlsdz", "output": "YES" }, { "input": "kudl\nldku", "output": "NO" }, { "input": "zzlzwnqlcl\nlclqnwzlzz", "output": "YES" }, { "input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv", "output": "YES" }, { "input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar", "output": "NO" }, { "input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn", "output": "YES" }, { "input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum", "output": "YES" }, { "input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv", "output": "YES" }, { "input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm", "output": "NO" }, { "input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd", "output": "NO" }, { "input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg", "output": "YES" }, { "input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis", "output": "YES" }, { "input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy", "output": "NO" }, { "input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw", "output": "YES" }, { "input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi", "output": "YES" }, { "input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib", "output": "YES" } ]
1,646,112,280
2,147,483,647
Python 3
OK
TESTS
40
92
0
s = input() t = input() out = '' lis = list(s) for id in reversed(lis): out = out +id if t == out: print("YES") else: print("NO")
Title: Translation Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. Input Specification: The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. Output Specification: If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. Demo Input: ['code\nedoc\n', 'abb\naba\n', 'code\ncode\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none
```python s = input() t = input() out = '' lis = list(s) for id in reversed(lis): out = out +id if t == out: print("YES") else: print("NO") ```
3.977
0
none
none
none
0
[ "none" ]
null
null
As usual, Sereja has array *a*, its elements are integers: *a*[1],<=*a*[2],<=...,<=*a*[*n*]. Let's introduce notation: A swap operation is the following sequence of actions: - choose two indexes *i*,<=*j* (*i*<=≠<=*j*); - perform assignments *tmp*<==<=*a*[*i*],<=*a*[*i*]<==<=*a*[*j*],<=*a*[*j*]<==<=*tmp*. What maximum value of function *m*(*a*) can Sereja get if he is allowed to perform at most *k* swap operations?
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=200; 1<=≤<=*k*<=≤<=10). The next line contains *n* integers *a*[1], *a*[2], ..., *a*[*n*] (<=-<=1000<=≤<=*a*[*i*]<=≤<=1000).
In a single line print the maximum value of *m*(*a*) that Sereja can get if he is allowed to perform at most *k* swap operations.
[ "10 2\n10 -1 2 2 2 2 2 2 -1 10\n", "5 10\n-1 -1 -1 -1 -1\n" ]
[ "32\n", "-1\n" ]
none
0
[ { "input": "10 2\n10 -1 2 2 2 2 2 2 -1 10", "output": "32" }, { "input": "5 10\n-1 -1 -1 -1 -1", "output": "-1" }, { "input": "18 1\n166 788 276 -103 -491 195 -960 389 376 369 630 285 3 575 315 -987 820 466", "output": "5016" }, { "input": "29 6\n-21 486 -630 -433 -123 -387 618 110 -203 55 -123 524 -168 662 432 378 -155 -136 -162 811 457 -157 -215 861 -565 -506 557 348 -7", "output": "6299" }, { "input": "9 9\n-767 148 -323 -818 41 -228 615 885 -260", "output": "1689" }, { "input": "35 5\n151 -160 -292 -31 -131 174 359 42 438 413 164 91 118 393 76 435 371 -76 145 605 292 578 623 405 664 330 455 329 66 168 179 -76 996 163 531", "output": "9754" }, { "input": "47 10\n-175 246 -903 681 748 -338 333 0 666 245 370 402 -38 682 144 658 -10 313 295 351 -95 149 111 -210 645 -173 -276 690 593 697 259 698 421 584 -229 445 -215 -203 49 642 386 649 469 4 340 484 279", "output": "14728" }, { "input": "11 7\n877 -188 10 -175 217 -254 841 380 552 -607 228", "output": "3105" }, { "input": "38 1\n173 587 -788 163 83 -768 461 -527 350 3 -898 634 -217 -528 317 -238 545 93 -964 283 -798 -596 77 222 -370 -209 61 846 -831 -419 -366 -509 -356 -649 916 -391 981 -596", "output": "2743" }, { "input": "6 9\n-669 45 -220 544 106 680", "output": "1375" }, { "input": "32 9\n-650 -208 506 812 -540 -275 -272 -236 -96 197 425 475 81 570 281 633 449 396 401 -362 -379 667 717 875 658 114 294 100 286 112 -928 -373", "output": "9049" }, { "input": "36 5\n-286 762 -5 -230 -483 -140 -143 -82 -127 449 435 85 -262 567 454 -163 942 -679 -609 854 -533 717 -101 92 -767 795 -804 -953 -754 -251 -100 884 809 -358 469 -112", "output": "8222" }, { "input": "24 5\n-751 889 721 -900 903 -900 -693 895 828 314 836 -493 549 -74 264 662 229 517 -223 367 141 -99 -390 283", "output": "8398" }, { "input": "82 8\n-483 465 435 -789 80 -412 672 512 -755 981 784 -281 -634 -270 806 887 -495 -46 -244 609 42 -821 100 -40 -299 -6 560 941 523 758 -730 -930 91 -138 -299 0 533 -208 -416 869 967 -871 573 165 -279 298 934 -236 70 800 550 433 139 147 139 -212 137 -933 -863 876 -622 193 -121 -944 983 -592 -40 -712 891 985 16 580 -845 -903 -986 952 -95 -613 -2 -45 -86 -206", "output": "18704" }, { "input": "116 10\n477 -765 -756 376 -48 -75 768 -658 263 -207 362 -535 96 -960 630 -686 609 -830 889 57 -239 346 -298 -18 -107 853 -607 -443 -517 371 657 105 479 498 -47 432 503 -917 -656 610 -466 216 -747 -587 -163 -174 493 -882 853 -582 -774 -477 -386 610 -58 557 968 196 69 610 -38 366 -79 574 170 317 332 189 158 -194 136 -151 500 309 624 316 543 472 132 -15 -78 166 360 -71 12 247 678 263 573 -198 1 101 155 -65 597 -93 60 3 -496 985 -586 -761 -532 506 578 -13 569 845 -341 870 -900 891 724 408 229 -210", "output": "24624" }, { "input": "110 4\n-813 -73 334 667 602 -155 432 -133 689 397 461 499 630 40 69 299 697 449 -130 210 -146 415 292 123 12 -105 444 338 509 497 142 688 603 107 -108 160 211 -215 219 -144 637 -173 615 -210 521 545 377 -6 -187 354 647 309 139 309 155 -242 546 -231 -267 405 411 -271 -149 264 -169 -447 -749 -218 273 -798 -135 839 54 -764 279 -578 -641 -152 -881 241 174 31 525 621 -855 656 482 -197 -402 995 785 338 -733 293 606 294 -645 262 909 325 -246 -952 408 646 2 -567 -484 661 -390 -488", "output": "20286" }, { "input": "94 2\n432 255 304 757 -438 52 461 55 837 -564 304 713 -968 -539 -593 835 -824 -532 38 -880 -772 480 -755 -387 -830 286 -38 -202 -273 423 272 471 -224 306 490 532 -210 -245 -20 680 -236 404 -5 -188 387 582 -30 -800 276 -811 240 -4 214 -708 200 -785 -466 61 16 -742 647 -371 -851 -295 -552 480 38 924 403 704 -705 -972 677 569 450 446 816 396 -179 281 -564 -27 -272 -640 809 29 28 -209 -925 997 -268 133 265 161", "output": "7839" }, { "input": "78 8\n-230 -757 673 -284 381 -324 -96 975 249 971 -355 186 -526 804 147 -553 655 263 -247 775 108 -246 -107 25 -786 -372 -24 -619 265 -192 269 392 210 449 335 -207 371 562 307 141 668 78 13 251 623 -238 60 543 618 201 73 -35 -663 620 485 444 330 362 -33 484 685 257 542 375 -952 48 -604 -288 -19 -718 -798 946 -533 -666 -686 -278 368 -294", "output": "17941" }, { "input": "1 10\n-1", "output": "-1" }, { "input": "1 1\n-1", "output": "-1" }, { "input": "1 1\n1", "output": "1" }, { "input": "1 10\n1", "output": "1" }, { "input": "10 1\n-1 1 1 1 1 1 1 1 1 1", "output": "9" } ]
1,399,059,947
2,147,483,647
Python 3
OK
TESTS
43
904
204,800
R = lambda:map(int, input().split()) n, k = R() a = list(R()) def f(l, r): x = sorted(a[:l] + a[r + 1:], reverse=True) y = sorted(a[l:r + 1]) return sum(y + [max(0, x[i] - y[i]) for i in range(min(k, len(x), len(y)))]) print(max(f(l, r) for l in range(n) for r in range(l, n)))
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: As usual, Sereja has array *a*, its elements are integers: *a*[1],<=*a*[2],<=...,<=*a*[*n*]. Let's introduce notation: A swap operation is the following sequence of actions: - choose two indexes *i*,<=*j* (*i*<=≠<=*j*); - perform assignments *tmp*<==<=*a*[*i*],<=*a*[*i*]<==<=*a*[*j*],<=*a*[*j*]<==<=*tmp*. What maximum value of function *m*(*a*) can Sereja get if he is allowed to perform at most *k* swap operations? Input Specification: The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=200; 1<=≤<=*k*<=≤<=10). The next line contains *n* integers *a*[1], *a*[2], ..., *a*[*n*] (<=-<=1000<=≤<=*a*[*i*]<=≤<=1000). Output Specification: In a single line print the maximum value of *m*(*a*) that Sereja can get if he is allowed to perform at most *k* swap operations. Demo Input: ['10 2\n10 -1 2 2 2 2 2 2 -1 10\n', '5 10\n-1 -1 -1 -1 -1\n'] Demo Output: ['32\n', '-1\n'] Note: none
```python R = lambda:map(int, input().split()) n, k = R() a = list(R()) def f(l, r): x = sorted(a[:l] + a[r + 1:], reverse=True) y = sorted(a[l:r + 1]) return sum(y + [max(0, x[i] - y[i]) for i in range(min(k, len(x), len(y)))]) print(max(f(l, r) for l in range(n) for r in range(l, n))) ```
3
476
B
Dreamoon and WiFi
PROGRAMMING
1,300
[ "bitmasks", "brute force", "combinatorics", "dp", "math", "probabilities" ]
null
null
Dreamoon is standing at the position 0 on a number line. Drazil is sending a list of commands through Wi-Fi to Dreamoon's smartphone and Dreamoon follows them. Each command is one of the following two types: 1. Go 1 unit towards the positive direction, denoted as '+' 1. Go 1 unit towards the negative direction, denoted as '-' But the Wi-Fi condition is so poor that Dreamoon's smartphone reports some of the commands can't be recognized and Dreamoon knows that some of them might even be wrong though successfully recognized. Dreamoon decides to follow every recognized command and toss a fair coin to decide those unrecognized ones (that means, he moves to the 1 unit to the negative or positive direction with the same probability 0.5). You are given an original list of commands sent by Drazil and list received by Dreamoon. What is the probability that Dreamoon ends in the position originally supposed to be final by Drazil's commands?
The first line contains a string *s*1 — the commands Drazil sends to Dreamoon, this string consists of only the characters in the set {'+', '-'}. The second line contains a string *s*2 — the commands Dreamoon's smartphone recognizes, this string consists of only the characters in the set {'+', '-', '?'}. '?' denotes an unrecognized command. Lengths of two strings are equal and do not exceed 10.
Output a single real number corresponding to the probability. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=9.
[ "++-+-\n+-+-+\n", "+-+-\n+-??\n", "+++\n??-\n" ]
[ "1.000000000000\n", "0.500000000000\n", "0.000000000000\n" ]
For the first sample, both *s*<sub class="lower-index">1</sub> and *s*<sub class="lower-index">2</sub> will lead Dreamoon to finish at the same position  + 1. For the second sample, *s*<sub class="lower-index">1</sub> will lead Dreamoon to finish at position 0, while there are four possibilites for *s*<sub class="lower-index">2</sub>: {"+-++", "+-+-", "+--+", "+---"} with ending position {+2, 0, 0, -2} respectively. So there are 2 correct cases out of 4, so the probability of finishing at the correct position is 0.5. For the third sample, *s*<sub class="lower-index">2</sub> could only lead us to finish at positions {+1, -1, -3}, so the probability to finish at the correct position  + 3 is 0.
1,500
[ { "input": "++-+-\n+-+-+", "output": "1.000000000000" }, { "input": "+-+-\n+-??", "output": "0.500000000000" }, { "input": "+++\n??-", "output": "0.000000000000" }, { "input": "++++++++++\n+++??++?++", "output": "0.125000000000" }, { "input": "--+++---+-\n??????????", "output": "0.205078125000" }, { "input": "+--+++--+-\n??????????", "output": "0.246093750000" }, { "input": "+\n+", "output": "1.000000000000" }, { "input": "-\n?", "output": "0.500000000000" }, { "input": "+\n-", "output": "0.000000000000" }, { "input": "-\n-", "output": "1.000000000000" }, { "input": "-\n+", "output": "0.000000000000" }, { "input": "+\n?", "output": "0.500000000000" }, { "input": "++++++++++\n++++++++++", "output": "1.000000000000" }, { "input": "++++++++++\n++++-+++++", "output": "0.000000000000" }, { "input": "----------\n++++++++++", "output": "0.000000000000" }, { "input": "++++++++++\n++++??++++", "output": "0.250000000000" }, { "input": "----------\n+++?++++-+", "output": "0.000000000000" }, { "input": "++++++++++\n++++++++?+", "output": "0.500000000000" }, { "input": "--++++--+\n?-+?-??+-", "output": "0.250000000000" }, { "input": "----------\n??????????", "output": "0.000976562500" }, { "input": "+--++\n+--+-", "output": "0.000000000000" }, { "input": "-----++---\n????????+?", "output": "0.017578125000" }, { "input": "------+--+\n??????????", "output": "0.043945312500" }, { "input": "---++--\n???????", "output": "0.164062500000" }, { "input": "-----++\n???????", "output": "0.164062500000" }, { "input": "+---+--\n???????", "output": "0.164062500000" }, { "input": "---+-+\n??????", "output": "0.234375000000" }, { "input": "+++-+\n---++", "output": "0.000000000000" }, { "input": "++-+--+\n?-?+??+", "output": "0.375000000000" }, { "input": "----+++--\n-+?+++?--", "output": "0.000000000000" }, { "input": "+-----\n+?----", "output": "0.500000000000" } ]
1,652,473,481
2,147,483,647
Python 3
OK
TESTS
31
31
0
#!/usr/bin/env python3 #-*- coding: utf-8 -*- # author: Neto, Jocelino # Dreamoon is standing at the position 0 on a number line. # Drazil is sending a list of commands through Wi-Fi to Dreamoon's smartphone # and Dreamoon follows them. # # Each command is one of the following two types: # # 1. Go 1 unit towards the positive direction, denoted as '+' # 1. Go 1 unit towards the negative direction, denoted as '-' # # But the Wi-Fi condition is so poor that Dreamoon's smartphone reports some of # the commands can't be recognized and Dreamoon knows that some of them might # even be wrong though successfully recognized. Dreamoon decides to follow every # recognized command and toss a fair coin to decide those unrecognized ones # (that means, he moves to the 1 unit to the negative or positive direction # with the same probability 0.5). # # You are given an original list of commands sent by Drazil and list received # by Dreamoon. What is the probability that Dreamoon ends in the position # originally supposed to be final by Drazil's commands? # def calculate(analysed, unknow, diff): power = 2 ** unknow if len(analysed) == unknow: counter_analysed = analysed.count("+") - analysed.count("-") A = 1 if counter_analysed == diff else 0 return A/power return calculate(analysed+"-", unknow, diff) + calculate(analysed+"+", unknow, diff) if __name__ == '__main__': str1_input = input()[:10] str2_input = input()[:10] counter_input = str1_input.count("+") - str1_input.count("-") counter_output = str2_input.count("+") - str2_input.count("-") est = str2_input.count("?") solution = calculate("", est, (counter_input - counter_output)) print(solution)
Title: Dreamoon and WiFi Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dreamoon is standing at the position 0 on a number line. Drazil is sending a list of commands through Wi-Fi to Dreamoon's smartphone and Dreamoon follows them. Each command is one of the following two types: 1. Go 1 unit towards the positive direction, denoted as '+' 1. Go 1 unit towards the negative direction, denoted as '-' But the Wi-Fi condition is so poor that Dreamoon's smartphone reports some of the commands can't be recognized and Dreamoon knows that some of them might even be wrong though successfully recognized. Dreamoon decides to follow every recognized command and toss a fair coin to decide those unrecognized ones (that means, he moves to the 1 unit to the negative or positive direction with the same probability 0.5). You are given an original list of commands sent by Drazil and list received by Dreamoon. What is the probability that Dreamoon ends in the position originally supposed to be final by Drazil's commands? Input Specification: The first line contains a string *s*1 — the commands Drazil sends to Dreamoon, this string consists of only the characters in the set {'+', '-'}. The second line contains a string *s*2 — the commands Dreamoon's smartphone recognizes, this string consists of only the characters in the set {'+', '-', '?'}. '?' denotes an unrecognized command. Lengths of two strings are equal and do not exceed 10. Output Specification: Output a single real number corresponding to the probability. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=9. Demo Input: ['++-+-\n+-+-+\n', '+-+-\n+-??\n', '+++\n??-\n'] Demo Output: ['1.000000000000\n', '0.500000000000\n', '0.000000000000\n'] Note: For the first sample, both *s*<sub class="lower-index">1</sub> and *s*<sub class="lower-index">2</sub> will lead Dreamoon to finish at the same position  + 1. For the second sample, *s*<sub class="lower-index">1</sub> will lead Dreamoon to finish at position 0, while there are four possibilites for *s*<sub class="lower-index">2</sub>: {"+-++", "+-+-", "+--+", "+---"} with ending position {+2, 0, 0, -2} respectively. So there are 2 correct cases out of 4, so the probability of finishing at the correct position is 0.5. For the third sample, *s*<sub class="lower-index">2</sub> could only lead us to finish at positions {+1, -1, -3}, so the probability to finish at the correct position  + 3 is 0.
```python #!/usr/bin/env python3 #-*- coding: utf-8 -*- # author: Neto, Jocelino # Dreamoon is standing at the position 0 on a number line. # Drazil is sending a list of commands through Wi-Fi to Dreamoon's smartphone # and Dreamoon follows them. # # Each command is one of the following two types: # # 1. Go 1 unit towards the positive direction, denoted as '+' # 1. Go 1 unit towards the negative direction, denoted as '-' # # But the Wi-Fi condition is so poor that Dreamoon's smartphone reports some of # the commands can't be recognized and Dreamoon knows that some of them might # even be wrong though successfully recognized. Dreamoon decides to follow every # recognized command and toss a fair coin to decide those unrecognized ones # (that means, he moves to the 1 unit to the negative or positive direction # with the same probability 0.5). # # You are given an original list of commands sent by Drazil and list received # by Dreamoon. What is the probability that Dreamoon ends in the position # originally supposed to be final by Drazil's commands? # def calculate(analysed, unknow, diff): power = 2 ** unknow if len(analysed) == unknow: counter_analysed = analysed.count("+") - analysed.count("-") A = 1 if counter_analysed == diff else 0 return A/power return calculate(analysed+"-", unknow, diff) + calculate(analysed+"+", unknow, diff) if __name__ == '__main__': str1_input = input()[:10] str2_input = input()[:10] counter_input = str1_input.count("+") - str1_input.count("-") counter_output = str2_input.count("+") - str2_input.count("-") est = str2_input.count("?") solution = calculate("", est, (counter_input - counter_output)) print(solution) ```
3
702
A
Maximum Increase
PROGRAMMING
800
[ "dp", "greedy", "implementation" ]
null
null
You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array. A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous.
The first line contains single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers. The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).
Print the maximum length of an increasing subarray of the given array.
[ "5\n1 7 2 11 15\n", "6\n100 100 100 100 100 100\n", "3\n1 2 3\n" ]
[ "3\n", "1\n", "3\n" ]
none
0
[ { "input": "5\n1 7 2 11 15", "output": "3" }, { "input": "6\n100 100 100 100 100 100", "output": "1" }, { "input": "3\n1 2 3", "output": "3" }, { "input": "1\n1000000000", "output": "1" }, { "input": "10\n802030518 598196518 640274071 983359971 71550121 96204862 799843967 446173607 796619138 402690754", "output": "3" }, { "input": "2\n2 1", "output": "1" }, { "input": "5\n1 2 3 3 4", "output": "3" }, { "input": "4\n1 2 2 3", "output": "2" }, { "input": "3\n2 1 1", "output": "1" }, { "input": "3\n1 2 1", "output": "2" }, { "input": "1\n1", "output": "1" }, { "input": "2\n1 2", "output": "2" }, { "input": "3\n1 1 2", "output": "2" }, { "input": "11\n1 2 3 1 2 3 2 1 2 3 4", "output": "4" }, { "input": "9\n1 2 3 4 5 6 7 8 9", "output": "9" }, { "input": "9\n1 1 1 1 1 1 1 1 1", "output": "1" }, { "input": "3\n3 2 1", "output": "1" }, { "input": "7\n1 2 3 4 5 6 7", "output": "7" }, { "input": "1\n1234394", "output": "1" } ]
1,694,650,185
2,147,483,647
Python 3
OK
TESTS
32
77
12,800,000
n = int(input()) a = list(map(int, input().split())) conteo = 1 maximo = 1 for i in range(1, n): if a[i] > a[i - 1]: conteo += 1 else: if conteo > maximo: maximo = conteo conteo = 1 if conteo > maximo: maximo = conteo print(maximo)
Title: Maximum Increase Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array. A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous. Input Specification: The first line contains single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers. The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109). Output Specification: Print the maximum length of an increasing subarray of the given array. Demo Input: ['5\n1 7 2 11 15\n', '6\n100 100 100 100 100 100\n', '3\n1 2 3\n'] Demo Output: ['3\n', '1\n', '3\n'] Note: none
```python n = int(input()) a = list(map(int, input().split())) conteo = 1 maximo = 1 for i in range(1, n): if a[i] > a[i - 1]: conteo += 1 else: if conteo > maximo: maximo = conteo conteo = 1 if conteo > maximo: maximo = conteo print(maximo) ```
3
34
A
Reconnaissance 2
PROGRAMMING
800
[ "implementation" ]
A. Reconnaissance 2
2
256
*n* soldiers stand in a circle. For each soldier his height *a**i* is known. A reconnaissance unit can be made of such two neighbouring soldiers, whose heights difference is minimal, i.e. |*a**i*<=-<=*a**j*| is minimal. So each of them will be less noticeable with the other. Output any pair of soldiers that can form a reconnaissance unit.
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of soldiers. Then follow the heights of the soldiers in their order in the circle — *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). The soldier heights are given in clockwise or counterclockwise direction.
Output two integers — indexes of neighbouring soldiers, who should form a reconnaissance unit. If there are many optimum solutions, output any of them. Remember, that the soldiers stand in a circle.
[ "5\n10 12 13 15 10\n", "4\n10 20 30 40\n" ]
[ "5 1\n", "1 2\n" ]
none
500
[ { "input": "5\n10 12 13 15 10", "output": "5 1" }, { "input": "4\n10 20 30 40", "output": "1 2" }, { "input": "6\n744 359 230 586 944 442", "output": "2 3" }, { "input": "5\n826 747 849 687 437", "output": "1 2" }, { "input": "5\n999 999 993 969 999", "output": "1 2" }, { "input": "5\n4 24 6 1 15", "output": "3 4" }, { "input": "2\n511 32", "output": "1 2" }, { "input": "3\n907 452 355", "output": "2 3" }, { "input": "4\n303 872 764 401", "output": "4 1" }, { "input": "10\n684 698 429 694 956 812 594 170 937 764", "output": "1 2" }, { "input": "20\n646 840 437 946 640 564 936 917 487 752 844 734 468 969 674 646 728 642 514 695", "output": "7 8" }, { "input": "30\n996 999 998 984 989 1000 996 993 1000 983 992 999 999 1000 979 992 987 1000 996 1000 1000 989 981 996 995 999 999 989 999 1000", "output": "12 13" }, { "input": "50\n93 27 28 4 5 78 59 24 19 134 31 128 118 36 90 32 32 1 44 32 33 13 31 10 12 25 38 50 25 12 4 22 28 53 48 83 4 25 57 31 71 24 8 7 28 86 23 80 101 58", "output": "16 17" }, { "input": "88\n1000 1000 1000 1000 1000 998 998 1000 1000 1000 1000 999 999 1000 1000 1000 999 1000 997 999 997 1000 999 998 1000 999 1000 1000 1000 999 1000 999 999 1000 1000 999 1000 999 1000 1000 998 1000 1000 1000 998 998 1000 1000 999 1000 1000 1000 1000 1000 1000 1000 998 1000 1000 1000 999 1000 1000 999 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 998 1000 1000 1000 998 1000 1000 998 1000 999 1000 1000 1000 1000", "output": "1 2" }, { "input": "99\n4 4 21 6 5 3 13 2 6 1 3 4 1 3 1 9 11 1 6 17 4 5 20 4 1 9 5 11 3 4 14 1 3 3 1 4 3 5 27 1 1 2 10 7 11 4 19 7 11 6 11 13 3 1 10 7 2 1 16 1 9 4 29 13 2 12 14 2 21 1 9 8 26 12 12 5 2 14 7 8 8 8 9 4 12 2 6 6 7 16 8 14 2 10 20 15 3 7 4", "output": "1 2" }, { "input": "100\n713 572 318 890 577 657 646 146 373 783 392 229 455 871 20 593 573 336 26 381 280 916 907 732 820 713 111 840 570 446 184 711 481 399 788 647 492 15 40 530 549 506 719 782 126 20 778 996 712 761 9 74 812 418 488 175 103 585 900 3 604 521 109 513 145 708 990 361 682 827 791 22 596 780 596 385 450 643 158 496 876 975 319 783 654 895 891 361 397 81 682 899 347 623 809 557 435 279 513 438", "output": "86 87" }, { "input": "100\n31 75 86 68 111 27 22 22 26 30 54 163 107 75 160 122 14 23 17 26 27 20 43 58 59 71 21 148 9 32 43 91 133 286 132 70 90 156 84 14 77 93 23 18 13 72 18 131 33 28 72 175 30 86 249 20 14 208 28 57 63 199 6 10 24 30 62 267 43 479 60 28 138 1 45 3 19 47 7 166 116 117 50 140 28 14 95 85 93 43 61 15 2 70 10 51 7 95 9 25", "output": "7 8" }, { "input": "100\n896 898 967 979 973 709 961 968 806 967 896 967 826 975 936 903 986 856 851 931 852 971 786 837 949 978 686 936 952 909 965 749 908 916 943 973 983 975 939 886 964 928 960 976 907 788 994 773 949 871 947 980 945 985 726 981 887 943 907 990 931 874 840 867 948 951 961 904 888 901 976 967 994 921 828 970 972 722 755 970 860 855 914 869 714 899 969 978 898 862 642 939 904 936 819 934 884 983 955 964", "output": "1 2" }, { "input": "100\n994 927 872 970 815 986 952 996 965 1000 877 986 978 999 950 990 936 997 993 960 921 860 895 869 943 998 983 968 973 953 999 990 995 871 853 979 973 963 953 938 997 989 993 964 960 973 946 975 1000 962 920 746 989 957 904 965 920 979 966 961 1000 993 975 952 846 971 991 979 985 969 984 973 956 1000 952 778 983 974 956 927 995 997 980 997 1000 970 960 970 988 983 947 904 935 972 1000 863 992 996 932 967", "output": "81 82" }, { "input": "100\n48 108 63 21 27 8 49 21 75 8 24 42 149 18 8 28 21 18 25 35 59 70 59 33 40 1 67 34 120 82 4 115 72 87 3 15 15 63 37 12 40 27 83 14 38 20 14 58 93 10 31 3 39 6 197 77 54 16 31 146 9 49 14 8 77 82 5 11 80 116 8 61 50 24 7 103 29 11 3 3 1 12 46 24 21 131 39 29 36 2 107 40 16 99 31 41 29 48 17 17", "output": "36 37" } ]
1,658,263,826
2,147,483,647
Python 3
OK
TESTS
20
92
0
n = int(input()) nums = list(map(int,input().split(' '))) nums.append(nums[0]) difs = [] for numA, numB in zip(nums,nums[1:]): difs.append(abs(numB-numA)) vmin = difs.index(min(difs)) #print(difs) if vmin == len(nums)-2: print(1, len(nums)-1) else: print(vmin+1, vmin+2)
Title: Reconnaissance 2 Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: *n* soldiers stand in a circle. For each soldier his height *a**i* is known. A reconnaissance unit can be made of such two neighbouring soldiers, whose heights difference is minimal, i.e. |*a**i*<=-<=*a**j*| is minimal. So each of them will be less noticeable with the other. Output any pair of soldiers that can form a reconnaissance unit. Input Specification: The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of soldiers. Then follow the heights of the soldiers in their order in the circle — *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). The soldier heights are given in clockwise or counterclockwise direction. Output Specification: Output two integers — indexes of neighbouring soldiers, who should form a reconnaissance unit. If there are many optimum solutions, output any of them. Remember, that the soldiers stand in a circle. Demo Input: ['5\n10 12 13 15 10\n', '4\n10 20 30 40\n'] Demo Output: ['5 1\n', '1 2\n'] Note: none
```python n = int(input()) nums = list(map(int,input().split(' '))) nums.append(nums[0]) difs = [] for numA, numB in zip(nums,nums[1:]): difs.append(abs(numB-numA)) vmin = difs.index(min(difs)) #print(difs) if vmin == len(nums)-2: print(1, len(nums)-1) else: print(vmin+1, vmin+2) ```
3.977
32
B
Borze
PROGRAMMING
800
[ "expression parsing", "implementation" ]
B. Borze
2
256
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
Output the decoded ternary number. It can have leading zeroes.
[ ".-.--\n", "--.\n", "-..-.--\n" ]
[ "012", "20", "1012" ]
none
1,000
[ { "input": ".-.--", "output": "012" }, { "input": "--.", "output": "20" }, { "input": "-..-.--", "output": "1012" }, { "input": "---..", "output": "210" }, { "input": "..--.---..", "output": "0020210" }, { "input": "-.....----.", "output": "10000220" }, { "input": ".", "output": "0" }, { "input": "-.", "output": "1" }, { "input": "--", "output": "2" }, { "input": "..", "output": "00" }, { "input": "--.", "output": "20" }, { "input": ".--.", "output": "020" }, { "input": ".-.-..", "output": "0110" }, { "input": "----.-.", "output": "2201" }, { "input": "-..--.-.", "output": "10201" }, { "input": "..--..--.", "output": "0020020" }, { "input": "-.-.---.--..-..-.-.-..-..-.--.", "output": "112120010111010120" }, { "input": "---.-.-.------..-..-..-..-.-..-.--.-.-..-.-.-----..-.-.", "output": "21112220010101011012011011221011" }, { "input": "-.-..--.-.-.-.-.-..-.-.-.---------.--.---..--...--.-----.-.-.-...--.-.-.---.------.--..-.--.-----.-...-..------", "output": "11020111110111222212021020002022111100201121222020012022110010222" }, { "input": "-.-..-.--.---..---.-..---.-...-.-.----..-.---.-.---..-.--.---.-.-------.---.--....----.-.---.---.---.----.-----..---.-.-.-.-----.--.-------.-..", "output": "110120210211021100112200121121012021122212120000220121212122022102111122120222110" }, { "input": ".-..-.-.---.-----.--.---...-.--.-.-....-..", "output": "01011212212021001201100010" }, { "input": ".------.-.---..--...-..-..-.-.-.--.--.-..-.--...-.-.---.-.-.------..--..-.---..----.-..-.--.---.-.----.-.---...-.-.-.-----.-.-.---.---.-.....-.-...-----.-...-.---.-..-.-----.--...---.-.-..-.--.-.---..", "output": "022201210200010101112020101200011211122200200121022010120211220121001112211121211000011002211001211012212000211101201210" }, { "input": ".-.--.---.-----.-.-----.-.-..-----..-..----..--.-.--.----..---.---..-.-.-----..-------.----..----.-..---...-----..-..-----...-..-.-.-----....---..---..-.-----...-.--...--.-.---.-.-.-.-.-...---..----.", "output": "01202122112211102210102200201202200212101122102221220022010210022101022100101122100021021012210012000201211111100210220" }, { "input": "..-.-.-.---.-.-.-..-.-..-.-.---.-------.---..-----.---....-.---.--.--.-.---.---------.-..---.-.-.--..---.---.-.---.-.-..-.-..-.-.-.----.--.-....--------.-.---..----.------.-.-.--.--.-----.-----.----", "output": "0011121111011011212221210221210001212020121222211021112002121121110110111220201000222201210220222011202022122122" }, { "input": "-..-------.------.-..--.-.-..--.-.-..-----..-.-.-..-..-..--.---..-----..---..-..--.-..-.-.---...-.....-------.---.-----.-...-.-...-.-.---.---.-----.--.--...-.--..-.-..-...-.-.-.-.---..---.-..-.-.-.-..", "output": "102221222010201102011022101110101020210221021010201011210010000222121221100110011212122120200012001101001111210211011110" }, { "input": ".-.----.-.--..-.-.-.-..----..-.-...--.-.---.---.-------..-.--..-......--.------.--.----.--...-.--.--..-----..-.....--.--.-.-.------..--------.----------..-.---.----.---.-..--..-.....-..------.--.", "output": "012201200111102200110020121212221012001000002022202022020001202002210100002020112220022220222220012122021102001000010222020" }, { "input": "------.-----.-....--.-.----.-.---.-.-..---.-.---.-----..-...-.-.---..-.-.-..-.-.-...-.-.-.----..--.------.----.-..-.--...-.-------...-.-..-.-.--.--.---..--..--------.--.-.-.---.-.-.-...----.--..-.--..", "output": "222022110002012201211102112122101001121011101110011122002022202201012000122210011011202021020022220201121111002202001200" }, { "input": "-.---...----...--.--...-.--.----", "output": "121002200020200012022" }, { "input": "--.--.--.---.--.-.---.-.-..-..--.-..---.-.....-..---.-----.--...-.-.-------.-.--.-.----.-..-.------.", "output": "202020212012111010201021100001021221200011222112012201012220" } ]
1,588,826,915
2,147,483,647
Python 3
OK
TESTS
30
216
6,656,000
n=input() ans='' i=0 # for i in range(len(n)): while i<len(n): # print(i) if n[i] == '.': ans+='0' i+=1 else: # if i+1<n: if n[i] =='-': if n[i+1] == '.': ans+='1' else: ans+='2' i+=2 print(ans)
Title: Borze Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet. Input Specification: The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes). Output Specification: Output the decoded ternary number. It can have leading zeroes. Demo Input: ['.-.--\n', '--.\n', '-..-.--\n'] Demo Output: ['012', '20', '1012'] Note: none
```python n=input() ans='' i=0 # for i in range(len(n)): while i<len(n): # print(i) if n[i] == '.': ans+='0' i+=1 else: # if i+1<n: if n[i] =='-': if n[i+1] == '.': ans+='1' else: ans+='2' i+=2 print(ans) ```
3.933602
353
A
Domino
PROGRAMMING
1,200
[ "implementation", "math" ]
null
null
Valera has got *n* domino pieces in a row. Each piece consists of two halves — the upper one and the lower one. Each of the halves contains a number from 1 to 6. Valera loves even integers very much, so he wants the sum of the numbers on the upper halves and the sum of the numbers on the lower halves to be even. To do that, Valera can rotate the dominoes by 180 degrees. After the rotation the upper and the lower halves swap places. This action takes one second. Help Valera find out the minimum time he must spend rotating dominoes to make his wish come true.
The first line contains integer *n* (1<=≤<=*n*<=≤<=100), denoting the number of dominoes Valera has. Next *n* lines contain two space-separated integers *x**i*,<=*y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=6). Number *x**i* is initially written on the upper half of the *i*-th domino, *y**i* is initially written on the lower half.
Print a single number — the minimum required number of seconds. If Valera can't do the task in any time, print <=-<=1.
[ "2\n4 2\n6 4\n", "1\n2 3\n", "3\n1 4\n2 3\n4 4\n" ]
[ "0\n", "-1\n", "1\n" ]
In the first test case the sum of the numbers on the upper halves equals 10 and the sum of the numbers on the lower halves equals 6. Both numbers are even, so Valera doesn't required to do anything. In the second sample Valera has only one piece of domino. It is written 3 on the one of its halves, therefore one of the sums will always be odd. In the third case Valera can rotate the first piece, and after that the sum on the upper halves will be equal to 10, and the sum on the lower halves will be equal to 8.
500
[ { "input": "2\n4 2\n6 4", "output": "0" }, { "input": "1\n2 3", "output": "-1" }, { "input": "3\n1 4\n2 3\n4 4", "output": "1" }, { "input": "5\n5 4\n5 4\n1 5\n5 5\n3 3", "output": "1" }, { "input": "20\n1 3\n5 2\n5 2\n2 6\n2 4\n1 1\n1 3\n1 4\n2 6\n4 2\n5 6\n2 2\n6 2\n4 3\n2 1\n6 2\n6 5\n4 5\n2 4\n1 4", "output": "-1" }, { "input": "100\n2 3\n2 4\n3 3\n1 4\n5 2\n5 4\n6 6\n3 4\n1 1\n4 2\n5 1\n5 5\n5 3\n3 6\n4 1\n1 6\n1 1\n3 2\n4 5\n6 1\n6 4\n1 1\n3 4\n3 3\n2 2\n1 1\n4 4\n6 4\n3 2\n5 2\n6 4\n3 2\n3 5\n4 4\n1 4\n5 2\n3 4\n1 4\n2 2\n5 6\n3 5\n6 1\n5 5\n1 6\n6 3\n1 4\n1 5\n5 5\n4 1\n3 2\n4 1\n5 5\n5 5\n1 5\n1 2\n6 4\n1 3\n3 6\n4 3\n3 5\n6 4\n2 6\n5 5\n1 4\n2 2\n2 3\n5 1\n2 5\n1 2\n2 6\n5 5\n4 6\n1 4\n3 6\n2 3\n6 1\n6 5\n3 2\n6 4\n4 5\n4 5\n2 6\n1 3\n6 2\n1 2\n2 3\n4 3\n5 4\n3 4\n1 6\n6 6\n2 4\n4 1\n3 1\n2 6\n5 4\n1 2\n6 5\n3 6\n2 4", "output": "-1" }, { "input": "1\n2 4", "output": "0" }, { "input": "1\n1 1", "output": "-1" }, { "input": "1\n1 2", "output": "-1" }, { "input": "2\n1 1\n3 3", "output": "0" }, { "input": "2\n1 1\n2 2", "output": "-1" }, { "input": "2\n1 1\n1 2", "output": "-1" }, { "input": "5\n1 2\n6 6\n1 1\n3 3\n6 1", "output": "1" }, { "input": "5\n5 4\n2 6\n6 2\n1 4\n6 2", "output": "0" }, { "input": "10\n4 1\n3 2\n1 2\n2 6\n3 5\n2 1\n5 2\n4 6\n5 6\n3 1", "output": "0" }, { "input": "10\n6 1\n4 4\n2 6\n6 5\n3 6\n6 3\n2 4\n5 1\n1 6\n1 5", "output": "-1" }, { "input": "15\n1 2\n5 1\n6 4\n5 1\n1 6\n2 6\n3 1\n6 4\n3 1\n2 1\n6 4\n3 5\n6 2\n1 6\n1 1", "output": "1" }, { "input": "15\n3 3\n2 1\n5 4\n3 3\n5 3\n5 4\n2 5\n1 3\n3 2\n3 3\n3 5\n2 5\n4 1\n2 3\n5 4", "output": "-1" }, { "input": "20\n1 5\n6 4\n4 3\n6 2\n1 1\n1 5\n6 3\n2 3\n3 6\n3 6\n3 6\n2 5\n4 3\n4 6\n5 5\n4 6\n3 4\n4 2\n3 3\n5 2", "output": "0" }, { "input": "20\n2 1\n6 5\n3 1\n2 5\n3 5\n4 1\n1 1\n5 4\n5 1\n2 4\n1 5\n3 2\n1 2\n3 5\n5 2\n1 2\n1 3\n4 2\n2 3\n4 5", "output": "-1" }, { "input": "25\n4 1\n6 3\n1 3\n2 3\n2 4\n6 6\n4 2\n4 2\n1 5\n5 4\n1 2\n2 5\n3 6\n4 1\n3 4\n2 6\n6 1\n5 6\n6 6\n4 2\n1 5\n3 3\n3 3\n6 5\n1 4", "output": "-1" }, { "input": "25\n5 5\n4 3\n2 5\n4 3\n4 6\n4 2\n5 6\n2 1\n5 4\n6 6\n1 3\n1 4\n2 3\n5 6\n5 4\n5 6\n5 4\n6 3\n3 5\n1 3\n2 5\n2 2\n4 4\n2 1\n4 4", "output": "-1" }, { "input": "30\n3 5\n2 5\n1 6\n1 6\n2 4\n5 5\n5 4\n5 6\n5 4\n2 1\n2 4\n1 6\n3 5\n1 1\n3 6\n5 5\n1 6\n3 4\n1 4\n4 6\n2 1\n3 3\n1 3\n4 5\n1 4\n1 6\n2 1\n4 6\n3 5\n5 6", "output": "1" }, { "input": "30\n2 3\n3 1\n6 6\n1 3\n5 5\n3 6\n4 5\n2 1\n1 3\n2 3\n4 4\n2 4\n6 4\n2 4\n5 4\n2 1\n2 5\n2 5\n4 2\n1 4\n2 6\n3 2\n3 2\n6 6\n4 2\n3 4\n6 3\n6 6\n6 6\n5 5", "output": "1" }, { "input": "35\n6 1\n4 3\n1 2\n4 3\n6 4\n4 6\n3 1\n5 5\n3 4\n5 4\n4 6\n1 6\n2 4\n6 6\n5 4\n5 2\n1 3\n1 4\n3 5\n1 4\n2 3\n4 5\n4 3\n6 1\n5 3\n3 2\n5 6\n3 5\n6 5\n4 1\n1 3\n5 5\n4 6\n6 1\n1 3", "output": "1" }, { "input": "35\n4 3\n5 6\n4 5\n2 5\n6 6\n4 1\n2 2\n4 2\n3 4\n4 1\n6 6\n6 3\n1 5\n1 5\n5 6\n4 2\n4 6\n5 5\n2 2\n5 2\n1 2\n4 6\n6 6\n6 5\n2 1\n3 5\n2 5\n3 1\n5 3\n6 4\n4 6\n5 6\n5 1\n3 4\n3 5", "output": "1" }, { "input": "40\n5 6\n1 1\n3 3\n2 6\n6 6\n5 4\n6 4\n3 5\n1 3\n4 4\n4 4\n2 5\n1 3\n3 6\n5 2\n4 3\n4 4\n5 6\n2 3\n1 1\n3 1\n1 1\n1 5\n4 3\n5 5\n3 4\n6 6\n5 6\n2 2\n6 6\n2 1\n2 4\n5 2\n2 2\n1 1\n1 4\n4 2\n3 5\n5 5\n4 5", "output": "-1" }, { "input": "40\n3 2\n5 3\n4 6\n3 5\n6 1\n5 2\n1 2\n6 2\n5 3\n3 2\n4 4\n3 3\n5 2\n4 5\n1 4\n5 1\n3 3\n1 3\n1 3\n2 1\n3 6\n4 2\n4 6\n6 2\n2 5\n2 2\n2 5\n3 3\n5 3\n2 1\n3 2\n2 3\n6 3\n6 3\n3 4\n3 2\n4 3\n5 4\n2 4\n4 6", "output": "-1" }, { "input": "45\n2 4\n3 4\n6 1\n5 5\n1 1\n3 5\n4 3\n5 2\n3 6\n6 1\n4 4\n6 1\n2 1\n6 1\n3 6\n3 3\n6 1\n1 2\n1 5\n6 5\n1 3\n5 6\n6 1\n4 5\n3 6\n2 2\n1 2\n4 5\n5 6\n1 5\n6 2\n2 4\n3 3\n3 1\n6 5\n6 5\n2 1\n5 2\n2 1\n3 3\n2 2\n1 4\n2 2\n3 3\n2 1", "output": "-1" }, { "input": "45\n6 6\n1 6\n1 2\n3 5\n4 4\n2 1\n5 3\n2 1\n5 2\n5 3\n1 4\n5 2\n4 2\n3 6\n5 2\n1 5\n4 4\n5 5\n6 5\n2 1\n2 6\n5 5\n2 1\n6 1\n1 6\n6 5\n2 4\n4 3\n2 6\n2 4\n6 5\n6 4\n6 3\n6 6\n2 1\n6 4\n5 6\n5 4\n1 5\n5 1\n3 3\n5 6\n2 5\n4 5\n3 6", "output": "-1" }, { "input": "50\n4 4\n5 1\n6 4\n6 2\n6 2\n1 4\n5 5\n4 2\n5 5\n5 4\n1 3\n3 5\n6 1\n6 1\n1 4\n4 3\n5 1\n3 6\n2 2\n6 2\n4 4\n2 3\n4 2\n6 5\n5 6\n2 2\n2 4\n3 5\n1 5\n3 2\n3 4\n5 6\n4 6\n1 6\n4 5\n2 6\n2 2\n3 5\n6 4\n5 1\n4 3\n3 4\n3 5\n3 3\n2 3\n3 2\n2 2\n1 4\n3 1\n4 4", "output": "1" }, { "input": "50\n1 2\n1 4\n1 1\n4 5\n4 4\n3 2\n4 5\n3 5\n1 1\n3 4\n3 2\n2 4\n2 6\n2 6\n3 2\n4 6\n1 6\n3 1\n1 6\n2 1\n4 1\n1 6\n4 3\n6 6\n5 2\n6 4\n2 1\n4 3\n6 4\n5 1\n5 5\n3 1\n1 1\n5 5\n2 2\n2 3\n2 3\n3 5\n5 5\n1 6\n1 5\n3 6\n3 6\n1 1\n3 3\n2 6\n5 5\n1 3\n6 3\n6 6", "output": "-1" }, { "input": "55\n3 2\n5 6\n5 1\n3 5\n5 5\n1 5\n5 4\n6 3\n5 6\n4 2\n3 1\n1 2\n5 5\n1 1\n5 2\n6 3\n5 4\n3 6\n4 6\n2 6\n6 4\n1 4\n1 6\n4 1\n2 5\n4 3\n2 1\n2 1\n6 2\n3 1\n2 5\n4 4\n6 3\n2 2\n3 5\n5 1\n3 6\n5 4\n4 6\n6 5\n5 6\n2 2\n3 2\n5 2\n6 5\n2 2\n5 3\n3 1\n4 5\n6 4\n2 4\n1 2\n5 6\n2 6\n5 2", "output": "0" }, { "input": "55\n4 6\n3 3\n6 5\n5 3\n5 6\n2 3\n2 2\n3 4\n3 1\n5 4\n5 4\n2 4\n3 4\n4 5\n1 5\n6 3\n1 1\n5 1\n3 4\n1 5\n3 1\n2 5\n3 3\n4 3\n3 3\n3 1\n6 6\n3 3\n3 3\n5 6\n5 3\n3 5\n1 4\n5 5\n1 3\n1 4\n3 5\n3 6\n2 4\n2 4\n5 1\n6 4\n5 1\n5 5\n1 1\n3 2\n4 3\n5 4\n5 1\n2 4\n4 3\n6 1\n3 4\n1 5\n6 3", "output": "-1" }, { "input": "60\n2 6\n1 4\n3 2\n1 2\n3 2\n2 4\n6 4\n4 6\n1 3\n3 1\n6 5\n2 4\n5 4\n4 2\n1 6\n3 4\n4 5\n5 2\n1 5\n5 4\n3 4\n3 4\n4 4\n4 1\n6 6\n3 6\n2 4\n2 1\n4 4\n6 5\n3 1\n4 3\n1 3\n6 3\n5 5\n1 4\n3 1\n3 6\n1 5\n3 1\n1 5\n4 4\n1 3\n2 4\n6 2\n4 1\n5 3\n3 4\n5 6\n1 2\n1 6\n6 3\n1 6\n3 6\n3 4\n6 2\n4 6\n2 3\n3 3\n3 3", "output": "-1" }, { "input": "60\n2 3\n4 6\n2 4\n1 3\n5 6\n1 5\n1 2\n1 3\n5 6\n4 3\n4 2\n3 1\n1 3\n3 5\n1 5\n3 4\n2 4\n3 5\n4 5\n1 2\n3 1\n1 5\n2 5\n6 2\n1 6\n3 3\n6 2\n5 3\n1 3\n1 4\n6 4\n6 3\n4 2\n4 2\n1 4\n1 3\n3 2\n3 1\n2 1\n1 2\n3 1\n2 6\n1 4\n3 6\n3 3\n1 5\n2 4\n5 5\n6 2\n5 2\n3 3\n5 3\n3 4\n4 5\n5 6\n2 4\n5 3\n3 1\n2 4\n5 4", "output": "-1" }, { "input": "65\n5 4\n3 3\n1 2\n4 3\n3 5\n1 5\n4 5\n2 6\n1 2\n1 5\n6 3\n2 6\n4 3\n3 6\n1 5\n3 5\n4 6\n2 5\n6 5\n1 4\n3 4\n4 3\n1 4\n2 5\n6 5\n3 1\n4 3\n1 2\n1 1\n6 1\n5 2\n3 2\n1 6\n2 6\n3 3\n6 6\n4 6\n1 5\n5 1\n4 5\n1 4\n3 2\n5 4\n4 2\n6 2\n1 3\n4 2\n5 3\n6 4\n3 6\n1 2\n6 1\n6 6\n3 3\n4 2\n3 5\n4 6\n4 1\n5 4\n6 1\n5 1\n5 6\n6 1\n4 6\n5 5", "output": "1" }, { "input": "65\n5 4\n6 3\n5 4\n4 5\n5 3\n3 6\n1 3\n3 1\n1 3\n6 1\n6 4\n1 3\n2 2\n4 6\n4 1\n5 6\n6 5\n1 1\n1 3\n6 6\n4 1\n2 4\n5 4\n4 1\n5 5\n5 3\n6 2\n2 6\n4 2\n2 2\n6 2\n3 3\n4 5\n4 3\n3 1\n1 4\n4 5\n3 2\n5 5\n4 6\n5 1\n3 4\n5 4\n5 2\n1 6\n4 2\n3 4\n3 4\n1 3\n1 2\n3 3\n3 6\n6 4\n4 6\n6 2\n6 5\n3 2\n2 1\n6 4\n2 1\n1 5\n5 2\n6 5\n3 6\n5 1", "output": "1" }, { "input": "70\n4 1\n2 6\n1 1\n5 6\n5 1\n2 3\n3 5\n1 1\n1 1\n4 6\n4 3\n1 5\n2 2\n2 3\n3 1\n6 4\n3 1\n4 2\n5 4\n1 3\n3 5\n5 2\n5 6\n4 4\n4 5\n2 2\n4 5\n3 2\n3 5\n2 5\n2 6\n5 5\n2 6\n5 1\n1 1\n2 5\n3 1\n1 2\n6 4\n6 5\n5 5\n5 1\n1 5\n2 2\n6 3\n4 3\n6 2\n5 5\n1 1\n6 2\n6 6\n3 4\n2 2\n3 5\n1 5\n2 5\n4 5\n2 4\n6 3\n5 1\n2 6\n4 2\n1 4\n1 6\n6 2\n5 2\n5 6\n2 5\n5 6\n5 5", "output": "-1" }, { "input": "70\n4 3\n6 4\n5 5\n3 1\n1 2\n2 5\n4 6\n4 2\n3 2\n4 2\n1 5\n2 2\n4 3\n1 2\n6 1\n6 6\n1 6\n5 1\n2 2\n6 3\n4 2\n4 3\n1 2\n6 6\n3 3\n6 5\n6 2\n3 6\n6 6\n4 6\n5 2\n5 4\n3 3\n1 6\n5 6\n2 3\n4 6\n1 1\n1 2\n6 6\n1 1\n3 4\n1 6\n2 6\n3 4\n6 3\n5 3\n1 2\n2 3\n4 6\n2 1\n6 4\n4 6\n4 6\n4 2\n5 5\n3 5\n3 2\n4 3\n3 6\n1 4\n3 6\n1 4\n1 6\n1 5\n5 6\n4 4\n3 3\n3 5\n2 2", "output": "0" }, { "input": "75\n1 3\n4 5\n4 1\n6 5\n2 1\n1 4\n5 4\n1 5\n5 3\n1 2\n4 1\n1 1\n5 1\n5 3\n1 5\n4 2\n2 2\n6 3\n1 2\n4 3\n2 5\n5 3\n5 5\n4 1\n4 6\n2 5\n6 1\n2 4\n6 4\n5 2\n6 2\n2 4\n1 3\n5 4\n6 5\n5 4\n6 4\n1 5\n4 6\n1 5\n1 1\n4 4\n3 5\n6 3\n6 5\n1 5\n2 1\n1 5\n6 6\n2 2\n2 2\n4 4\n6 6\n5 4\n4 5\n3 2\n2 4\n1 1\n4 3\n3 2\n5 4\n1 6\n1 2\n2 2\n3 5\n2 6\n1 1\n2 2\n2 3\n6 2\n3 6\n4 4\n5 1\n4 1\n4 1", "output": "0" }, { "input": "75\n1 1\n2 1\n5 5\n6 5\n6 3\n1 6\n6 1\n4 4\n2 1\n6 2\n3 1\n6 4\n1 6\n2 2\n4 3\n4 2\n1 2\n6 2\n4 2\n5 1\n1 2\n3 2\n6 6\n6 3\n2 4\n4 1\n4 1\n2 4\n5 5\n2 3\n5 5\n4 5\n3 1\n1 5\n4 3\n2 3\n3 5\n4 6\n5 6\n1 6\n2 3\n2 2\n1 2\n5 6\n1 4\n1 5\n1 3\n6 2\n1 2\n4 2\n2 1\n1 3\n6 4\n4 1\n5 2\n6 2\n3 5\n2 3\n4 2\n5 1\n5 6\n3 2\n2 1\n6 6\n2 1\n6 2\n1 1\n3 2\n1 2\n3 5\n4 6\n1 3\n3 4\n5 5\n6 2", "output": "1" }, { "input": "80\n3 1\n6 3\n2 2\n2 2\n6 3\n6 1\n6 5\n1 4\n3 6\n6 5\n1 3\n2 4\n1 4\n3 1\n5 3\n5 3\n1 4\n2 5\n4 3\n4 4\n4 5\n6 1\n3 1\n2 6\n4 2\n3 1\n6 5\n2 6\n2 2\n5 1\n1 3\n5 1\n2 1\n4 3\n6 3\n3 5\n4 3\n5 6\n3 3\n4 1\n5 1\n6 5\n5 1\n2 5\n6 1\n3 2\n4 3\n3 3\n5 6\n1 6\n5 2\n1 5\n5 6\n6 4\n2 2\n4 2\n4 6\n4 2\n4 4\n6 5\n5 2\n6 2\n4 6\n6 4\n4 3\n5 1\n4 1\n3 5\n3 2\n3 2\n5 3\n5 4\n3 4\n1 3\n1 2\n6 6\n6 3\n6 1\n5 6\n3 2", "output": "0" }, { "input": "80\n4 5\n3 3\n3 6\n4 5\n3 4\n6 5\n1 5\n2 5\n5 6\n5 1\n5 1\n1 2\n5 5\n5 1\n2 3\n1 1\n4 5\n4 1\n1 1\n5 5\n5 6\n5 2\n5 4\n4 2\n6 2\n5 3\n3 2\n4 2\n1 3\n1 6\n2 1\n6 6\n4 5\n6 4\n2 2\n1 6\n6 2\n4 3\n2 3\n4 6\n4 6\n6 2\n3 4\n4 3\n5 5\n1 6\n3 2\n4 6\n2 3\n1 6\n5 4\n4 2\n5 4\n1 1\n4 3\n5 1\n3 6\n6 2\n3 1\n4 1\n5 3\n2 2\n3 4\n3 6\n3 5\n5 5\n5 1\n3 5\n2 6\n6 3\n6 5\n3 3\n5 6\n1 2\n3 1\n6 3\n3 4\n6 6\n6 6\n1 2", "output": "-1" }, { "input": "85\n6 3\n4 1\n1 2\n3 5\n6 4\n6 2\n2 6\n1 2\n1 5\n6 2\n1 4\n6 6\n2 4\n4 6\n4 5\n1 6\n3 1\n2 5\n5 1\n5 2\n3 5\n1 1\n4 1\n2 3\n1 1\n3 3\n6 4\n1 4\n1 1\n3 6\n1 5\n1 6\n2 5\n2 2\n5 1\n6 6\n1 3\n1 5\n5 6\n4 5\n4 3\n5 5\n1 3\n6 3\n4 6\n2 4\n5 6\n6 2\n4 5\n1 4\n1 4\n6 5\n1 6\n6 1\n1 6\n5 5\n2 1\n5 2\n2 3\n1 6\n1 6\n1 6\n5 6\n2 4\n6 5\n6 5\n4 2\n5 4\n3 4\n4 3\n6 6\n3 3\n3 2\n3 6\n2 5\n2 1\n2 5\n3 4\n1 2\n5 4\n6 2\n5 1\n1 4\n3 4\n4 5", "output": "0" }, { "input": "85\n3 1\n3 2\n6 3\n1 3\n2 1\n3 6\n1 4\n2 5\n6 5\n1 6\n1 5\n1 1\n4 3\n3 5\n4 6\n3 2\n6 6\n4 4\n4 1\n5 5\n4 2\n6 2\n2 2\n4 5\n6 1\n3 4\n4 5\n3 5\n4 2\n3 5\n4 4\n3 1\n4 4\n6 4\n1 4\n5 5\n1 5\n2 2\n6 5\n5 6\n6 5\n3 2\n3 2\n6 1\n6 5\n2 1\n4 6\n2 1\n3 1\n5 6\n1 3\n5 4\n1 4\n1 4\n5 3\n2 3\n1 3\n2 2\n5 3\n2 3\n2 3\n1 3\n3 6\n4 4\n6 6\n6 2\n5 1\n5 5\n5 5\n1 2\n1 4\n2 4\n3 6\n4 6\n6 3\n6 4\n5 5\n3 2\n5 4\n5 4\n4 5\n6 4\n2 1\n5 2\n5 1", "output": "-1" }, { "input": "90\n5 2\n5 5\n5 1\n4 6\n4 3\n5 3\n5 6\n5 1\n3 4\n1 3\n4 2\n1 6\n6 4\n1 2\n6 1\n4 1\n6 2\n6 5\n6 2\n5 4\n3 6\n1 1\n5 5\n2 2\n1 6\n3 5\n6 5\n1 6\n1 5\n2 3\n2 6\n2 3\n3 3\n1 3\n5 1\n2 5\n3 6\n1 2\n4 4\n1 6\n2 3\n1 5\n2 5\n1 3\n2 2\n4 6\n3 6\n6 3\n1 2\n4 3\n4 5\n4 6\n3 2\n6 5\n6 2\n2 5\n2 4\n1 3\n1 6\n4 3\n1 3\n6 4\n4 6\n4 1\n1 1\n4 1\n4 4\n6 2\n6 5\n1 1\n2 2\n3 1\n1 4\n6 2\n5 2\n1 4\n1 3\n6 5\n3 2\n6 4\n3 4\n2 6\n2 2\n6 3\n4 6\n1 2\n4 2\n3 4\n2 3\n1 5", "output": "-1" }, { "input": "90\n1 4\n3 5\n4 2\n2 5\n4 3\n2 6\n2 6\n3 2\n4 4\n6 1\n4 3\n2 3\n5 3\n6 6\n2 2\n6 3\n4 1\n4 4\n5 6\n6 4\n4 2\n5 6\n4 6\n4 4\n6 4\n4 1\n5 3\n3 2\n4 4\n5 2\n5 4\n6 4\n1 2\n3 3\n3 4\n6 4\n1 6\n4 2\n3 2\n1 1\n2 2\n5 1\n6 6\n4 1\n5 2\n3 6\n2 1\n2 2\n4 6\n6 5\n4 4\n5 5\n5 6\n1 6\n1 4\n5 6\n3 6\n6 3\n5 6\n6 5\n5 1\n6 1\n6 6\n6 3\n1 5\n4 5\n3 1\n6 6\n3 4\n6 2\n1 4\n2 2\n3 2\n5 6\n2 4\n1 4\n6 3\n4 6\n1 4\n5 2\n1 2\n6 5\n1 5\n1 4\n4 2\n2 5\n3 2\n5 1\n5 4\n5 3", "output": "-1" }, { "input": "95\n4 3\n3 2\n5 5\n5 3\n1 6\n4 4\n5 5\n6 5\n3 5\n1 5\n4 2\n5 1\n1 2\n2 3\n6 4\n2 3\n6 3\n6 5\n5 6\n1 4\n2 6\n2 6\n2 5\n2 1\n3 1\n3 5\n2 2\n6 1\n2 4\n4 6\n6 6\n6 4\n3 2\n5 1\n4 3\n6 5\n2 3\n4 1\n2 5\n6 5\n6 5\n6 5\n5 1\n5 4\n4 6\n3 2\n2 5\n2 6\n4 6\n6 3\n6 4\n5 6\n4 6\n2 4\n3 4\n1 4\n2 4\n2 3\n5 6\n6 4\n3 1\n5 1\n3 6\n3 5\n2 6\n6 3\n4 3\n3 1\n6 1\n2 2\n6 3\n2 2\n2 2\n6 4\n6 1\n2 1\n5 6\n5 4\n5 2\n3 4\n3 6\n2 1\n1 6\n5 5\n2 6\n2 3\n3 6\n1 3\n1 5\n5 1\n1 2\n2 2\n5 3\n6 4\n4 5", "output": "0" }, { "input": "95\n4 5\n5 6\n3 2\n5 1\n4 3\n4 1\n6 1\n5 2\n2 4\n5 3\n2 3\n6 4\n4 1\n1 6\n2 6\n2 3\n4 6\n2 4\n3 4\n4 2\n5 5\n1 1\n1 5\n4 3\n4 5\n6 2\n6 1\n6 3\n5 5\n4 1\n5 1\n2 3\n5 1\n3 6\n6 6\n4 5\n4 4\n4 3\n1 6\n6 6\n4 6\n6 4\n1 2\n6 2\n4 6\n6 6\n5 5\n6 1\n5 2\n4 5\n6 6\n6 5\n4 4\n1 5\n4 6\n4 1\n3 6\n5 1\n3 1\n4 6\n4 5\n1 3\n5 4\n4 5\n2 2\n6 1\n5 2\n6 5\n2 2\n1 1\n6 3\n6 1\n2 6\n3 3\n2 1\n4 6\n2 4\n5 5\n5 2\n3 2\n1 2\n6 6\n6 2\n5 1\n2 6\n5 2\n2 2\n5 5\n3 5\n3 3\n2 6\n5 3\n4 3\n1 6\n5 4", "output": "-1" }, { "input": "100\n1 1\n3 5\n2 1\n1 2\n3 4\n5 6\n5 6\n6 1\n5 5\n2 4\n5 5\n5 6\n6 2\n6 6\n2 6\n1 4\n2 2\n3 2\n1 3\n5 5\n6 3\n5 6\n1 1\n1 2\n1 2\n2 1\n2 3\n1 6\n4 3\n1 1\n2 5\n2 4\n4 4\n1 5\n3 3\n6 1\n3 5\n1 1\n3 6\n3 1\n4 2\n4 3\n3 6\n6 6\n1 6\n6 2\n2 5\n5 4\n6 3\n1 4\n2 6\n6 2\n3 4\n6 1\n6 5\n4 6\n6 5\n4 4\n3 1\n6 3\n5 1\n2 4\n5 1\n1 2\n2 4\n2 1\n6 6\n5 3\n4 6\n6 3\n5 5\n3 3\n1 1\n6 5\n4 3\n2 6\n1 5\n3 5\n2 4\n4 5\n1 6\n2 3\n6 3\n5 5\n2 6\n2 6\n3 4\n3 2\n6 1\n3 4\n6 4\n3 3\n2 3\n5 1\n3 1\n6 2\n2 3\n6 4\n1 4\n1 2", "output": "-1" }, { "input": "100\n1 1\n5 5\n1 2\n5 3\n5 5\n2 2\n1 5\n3 4\n3 2\n1 3\n5 6\n4 5\n2 1\n5 5\n2 2\n1 6\n6 1\n5 1\n4 1\n4 6\n3 5\n6 1\n2 3\n5 6\n3 6\n2 3\n5 6\n1 6\n3 2\n2 2\n3 3\n6 5\n5 5\n1 4\n5 6\n6 4\n1 4\n1 2\n2 6\n3 2\n6 4\n5 3\n3 3\n6 4\n4 6\n2 2\n5 6\n5 1\n1 2\n3 4\n4 5\n1 1\n3 4\n5 2\n4 5\n3 3\n1 1\n3 4\n1 6\n2 4\n1 3\n3 2\n6 5\n1 6\n3 6\n2 3\n2 6\n5 1\n5 5\n5 6\n4 1\n6 2\n3 6\n5 3\n2 2\n2 4\n6 6\n3 6\n4 6\n2 5\n5 3\n1 2\n3 4\n3 4\n6 2\n2 4\n2 2\n4 6\n3 5\n4 2\n5 6\n4 2\n2 3\n6 2\n5 6\n2 1\n3 3\n6 6\n4 3\n4 2", "output": "1" }, { "input": "1\n2 2", "output": "0" }, { "input": "3\n2 4\n6 6\n3 3", "output": "-1" }, { "input": "2\n3 6\n4 1", "output": "1" }, { "input": "3\n1 1\n1 1\n3 3", "output": "-1" }, { "input": "3\n2 3\n1 1\n2 3", "output": "1" }, { "input": "3\n2 2\n2 1\n1 2", "output": "1" }, { "input": "3\n1 1\n1 1\n1 1", "output": "-1" } ]
1,577,898,990
2,147,483,647
Python 3
OK
TESTS
59
248
512,000
n = int(input()) pc = [] upper = 0 lower = 0 time = 0 for i in range(n): a = list(map(int, input().split())) pc.append(a) for i in range(len(pc)): upper = 0 lower = 0 for j in pc: upper += j[0] lower += j[1] if upper % 2 == 0 and lower % 2 == 0: break else: pc[i][1], pc[i][0] = pc[i][0], pc[i][1] time += 1 if upper % 2 == 0 and lower % 2 == 0: if time >= 1: print(1) else: print(0) else: print(-1)
Title: Domino Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera has got *n* domino pieces in a row. Each piece consists of two halves — the upper one and the lower one. Each of the halves contains a number from 1 to 6. Valera loves even integers very much, so he wants the sum of the numbers on the upper halves and the sum of the numbers on the lower halves to be even. To do that, Valera can rotate the dominoes by 180 degrees. After the rotation the upper and the lower halves swap places. This action takes one second. Help Valera find out the minimum time he must spend rotating dominoes to make his wish come true. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=100), denoting the number of dominoes Valera has. Next *n* lines contain two space-separated integers *x**i*,<=*y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=6). Number *x**i* is initially written on the upper half of the *i*-th domino, *y**i* is initially written on the lower half. Output Specification: Print a single number — the minimum required number of seconds. If Valera can't do the task in any time, print <=-<=1. Demo Input: ['2\n4 2\n6 4\n', '1\n2 3\n', '3\n1 4\n2 3\n4 4\n'] Demo Output: ['0\n', '-1\n', '1\n'] Note: In the first test case the sum of the numbers on the upper halves equals 10 and the sum of the numbers on the lower halves equals 6. Both numbers are even, so Valera doesn't required to do anything. In the second sample Valera has only one piece of domino. It is written 3 on the one of its halves, therefore one of the sums will always be odd. In the third case Valera can rotate the first piece, and after that the sum on the upper halves will be equal to 10, and the sum on the lower halves will be equal to 8.
```python n = int(input()) pc = [] upper = 0 lower = 0 time = 0 for i in range(n): a = list(map(int, input().split())) pc.append(a) for i in range(len(pc)): upper = 0 lower = 0 for j in pc: upper += j[0] lower += j[1] if upper % 2 == 0 and lower % 2 == 0: break else: pc[i][1], pc[i][0] = pc[i][0], pc[i][1] time += 1 if upper % 2 == 0 and lower % 2 == 0: if time >= 1: print(1) else: print(0) else: print(-1) ```
3
208
A
Dubstep
PROGRAMMING
900
[ "strings" ]
null
null
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them. Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club. For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX". Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
[ "WUBWUBABCWUB\n", "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n" ]
[ "ABC ", "WE ARE THE CHAMPIONS MY FRIEND " ]
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya. In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
500
[ { "input": "WUBWUBABCWUB", "output": "ABC " }, { "input": "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB", "output": "WE ARE THE CHAMPIONS MY FRIEND " }, { "input": "WUBWUBWUBSR", "output": "SR " }, { "input": "RWUBWUBWUBLWUB", "output": "R L " }, { "input": "ZJWUBWUBWUBJWUBWUBWUBL", "output": "ZJ J L " }, { "input": "CWUBBWUBWUBWUBEWUBWUBWUBQWUBWUBWUB", "output": "C B E Q " }, { "input": "WUBJKDWUBWUBWBIRAQKFWUBWUBYEWUBWUBWUBWVWUBWUB", "output": "JKD WBIRAQKF YE WV " }, { "input": "WUBKSDHEMIXUJWUBWUBRWUBWUBWUBSWUBWUBWUBHWUBWUBWUB", "output": "KSDHEMIXUJ R S H " }, { "input": "OGWUBWUBWUBXWUBWUBWUBIWUBWUBWUBKOWUBWUB", "output": "OG X I KO " }, { "input": "QWUBQQWUBWUBWUBIWUBWUBWWWUBWUBWUBJOPJPBRH", "output": "Q QQ I WW JOPJPBRH " }, { "input": "VSRNVEATZTLGQRFEGBFPWUBWUBWUBAJWUBWUBWUBPQCHNWUBCWUB", "output": "VSRNVEATZTLGQRFEGBFP AJ PQCHN C " }, { "input": "WUBWUBEWUBWUBWUBIQMJNIQWUBWUBWUBGZZBQZAUHYPWUBWUBWUBPMRWUBWUBWUBDCV", "output": "E IQMJNIQ GZZBQZAUHYP PMR DCV " }, { "input": "WUBWUBWUBFVWUBWUBWUBBPSWUBWUBWUBRXNETCJWUBWUBWUBJDMBHWUBWUBWUBBWUBWUBVWUBWUBB", "output": "FV BPS RXNETCJ JDMBH B V B " }, { "input": "WUBWUBWUBFBQWUBWUBWUBIDFSYWUBWUBWUBCTWDMWUBWUBWUBSXOWUBWUBWUBQIWUBWUBWUBL", "output": "FBQ IDFSY CTWDM SXO QI L " }, { "input": "IWUBWUBQLHDWUBYIIKZDFQWUBWUBWUBCXWUBWUBUWUBWUBWUBKWUBWUBWUBNL", "output": "I QLHD YIIKZDFQ CX U K NL " }, { "input": "KWUBUPDYXGOKUWUBWUBWUBAGOAHWUBIZDWUBWUBWUBIYWUBWUBWUBVWUBWUBWUBPWUBWUBWUBE", "output": "K UPDYXGOKU AGOAH IZD IY V P E " }, { "input": "WUBWUBOWUBWUBWUBIPVCQAFWYWUBWUBWUBQWUBWUBWUBXHDKCPYKCTWWYWUBWUBWUBVWUBWUBWUBFZWUBWUB", "output": "O IPVCQAFWY Q XHDKCPYKCTWWY V FZ " }, { "input": "PAMJGYWUBWUBWUBXGPQMWUBWUBWUBTKGSXUYWUBWUBWUBEWUBWUBWUBNWUBWUBWUBHWUBWUBWUBEWUBWUB", "output": "PAMJGY XGPQM TKGSXUY E N H E " }, { "input": "WUBYYRTSMNWUWUBWUBWUBCWUBWUBWUBCWUBWUBWUBFSYUINDWOBVWUBWUBWUBFWUBWUBWUBAUWUBWUBWUBVWUBWUBWUBJB", "output": "YYRTSMNWU C C FSYUINDWOBV F AU V JB " }, { "input": "WUBWUBYGPYEYBNRTFKOQCWUBWUBWUBUYGRTQEGWLFYWUBWUBWUBFVWUBHPWUBWUBWUBXZQWUBWUBWUBZDWUBWUBWUBM", "output": "YGPYEYBNRTFKOQC UYGRTQEGWLFY FV HP XZQ ZD M " }, { "input": "WUBZVMJWUBWUBWUBFOIMJQWKNZUBOFOFYCCWUBWUBWUBAUWWUBRDRADWUBWUBWUBCHQVWUBWUBWUBKFTWUBWUBWUBW", "output": "ZVMJ FOIMJQWKNZUBOFOFYCC AUW RDRAD CHQV KFT W " }, { "input": "WUBWUBZBKOKHQLGKRVIMZQMQNRWUBWUBWUBDACWUBWUBNZHFJMPEYKRVSWUBWUBWUBPPHGAVVPRZWUBWUBWUBQWUBWUBAWUBG", "output": "ZBKOKHQLGKRVIMZQMQNR DAC NZHFJMPEYKRVS PPHGAVVPRZ Q A G " }, { "input": "WUBWUBJWUBWUBWUBNFLWUBWUBWUBGECAWUBYFKBYJWTGBYHVSSNTINKWSINWSMAWUBWUBWUBFWUBWUBWUBOVWUBWUBLPWUBWUBWUBN", "output": "J NFL GECA YFKBYJWTGBYHVSSNTINKWSINWSMA F OV LP N " }, { "input": "WUBWUBLCWUBWUBWUBZGEQUEATJVIXETVTWUBWUBWUBEXMGWUBWUBWUBRSWUBWUBWUBVWUBWUBWUBTAWUBWUBWUBCWUBWUBWUBQG", "output": "LC ZGEQUEATJVIXETVT EXMG RS V TA C QG " }, { "input": "WUBMPWUBWUBWUBORWUBWUBDLGKWUBWUBWUBVVZQCAAKVJTIKWUBWUBWUBTJLUBZJCILQDIFVZWUBWUBYXWUBWUBWUBQWUBWUBWUBLWUB", "output": "MP OR DLGK VVZQCAAKVJTIK TJLUBZJCILQDIFVZ YX Q L " }, { "input": "WUBNXOLIBKEGXNWUBWUBWUBUWUBGITCNMDQFUAOVLWUBWUBWUBAIJDJZJHFMPVTPOXHPWUBWUBWUBISCIOWUBWUBWUBGWUBWUBWUBUWUB", "output": "NXOLIBKEGXN U GITCNMDQFUAOVL AIJDJZJHFMPVTPOXHP ISCIO G U " }, { "input": "WUBWUBNMMWCZOLYPNBELIYVDNHJUNINWUBWUBWUBDXLHYOWUBWUBWUBOJXUWUBWUBWUBRFHTGJCEFHCGWARGWUBWUBWUBJKWUBWUBSJWUBWUB", "output": "NMMWCZOLYPNBELIYVDNHJUNIN DXLHYO OJXU RFHTGJCEFHCGWARG JK SJ " }, { "input": "SGWLYSAUJOJBNOXNWUBWUBWUBBOSSFWKXPDPDCQEWUBWUBWUBDIRZINODWUBWUBWUBWWUBWUBWUBPPHWUBWUBWUBRWUBWUBWUBQWUBWUBWUBJWUB", "output": "SGWLYSAUJOJBNOXN BOSSFWKXPDPDCQE DIRZINOD W PPH R Q J " }, { "input": "TOWUBWUBWUBGBTBNWUBWUBWUBJVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSAWUBWUBWUBSWUBWUBWUBTOLVXWUBWUBWUBNHWUBWUBWUBO", "output": "TO GBTBN JVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSA S TOLVX NH O " }, { "input": "WUBWUBWSPLAYSZSAUDSWUBWUBWUBUWUBWUBWUBKRWUBWUBWUBRSOKQMZFIYZQUWUBWUBWUBELSHUWUBWUBWUBUKHWUBWUBWUBQXEUHQWUBWUBWUBBWUBWUBWUBR", "output": "WSPLAYSZSAUDS U KR RSOKQMZFIYZQU ELSHU UKH QXEUHQ B R " }, { "input": "WUBXEMWWVUHLSUUGRWUBWUBWUBAWUBXEGILZUNKWUBWUBWUBJDHHKSWUBWUBWUBDTSUYSJHWUBWUBWUBPXFWUBMOHNJWUBWUBWUBZFXVMDWUBWUBWUBZMWUBWUB", "output": "XEMWWVUHLSUUGR A XEGILZUNK JDHHKS DTSUYSJH PXF MOHNJ ZFXVMD ZM " }, { "input": "BMBWUBWUBWUBOQKWUBWUBWUBPITCIHXHCKLRQRUGXJWUBWUBWUBVWUBWUBWUBJCWUBWUBWUBQJPWUBWUBWUBBWUBWUBWUBBMYGIZOOXWUBWUBWUBTAGWUBWUBHWUB", "output": "BMB OQK PITCIHXHCKLRQRUGXJ V JC QJP B BMYGIZOOX TAG H " }, { "input": "CBZNWUBWUBWUBNHWUBWUBWUBYQSYWUBWUBWUBMWUBWUBWUBXRHBTMWUBWUBWUBPCRCWUBWUBWUBTZUYLYOWUBWUBWUBCYGCWUBWUBWUBCLJWUBWUBWUBSWUBWUBWUB", "output": "CBZN NH YQSY M XRHBTM PCRC TZUYLYO CYGC CLJ S " }, { "input": "DPDWUBWUBWUBEUQKWPUHLTLNXHAEKGWUBRRFYCAYZFJDCJLXBAWUBWUBWUBHJWUBOJWUBWUBWUBNHBJEYFWUBWUBWUBRWUBWUBWUBSWUBWWUBWUBWUBXDWUBWUBWUBJWUB", "output": "DPD EUQKWPUHLTLNXHAEKG RRFYCAYZFJDCJLXBA HJ OJ NHBJEYF R S W XD J " }, { "input": "WUBWUBWUBISERPQITVIYERSCNWUBWUBWUBQWUBWUBWUBDGSDIPWUBWUBWUBCAHKDZWEXBIBJVVSKKVQJWUBWUBWUBKIWUBWUBWUBCWUBWUBWUBAWUBWUBWUBPWUBWUBWUBHWUBWUBWUBF", "output": "ISERPQITVIYERSCN Q DGSDIP CAHKDZWEXBIBJVVSKKVQJ KI C A P H F " }, { "input": "WUBWUBWUBIWUBWUBLIKNQVWUBWUBWUBPWUBWUBWUBHWUBWUBWUBMWUBWUBWUBDPRSWUBWUBWUBBSAGYLQEENWXXVWUBWUBWUBXMHOWUBWUBWUBUWUBWUBWUBYRYWUBWUBWUBCWUBWUBWUBY", "output": "I LIKNQV P H M DPRS BSAGYLQEENWXXV XMHO U YRY C Y " }, { "input": "WUBWUBWUBMWUBWUBWUBQWUBWUBWUBITCFEYEWUBWUBWUBHEUWGNDFNZGWKLJWUBWUBWUBMZPWUBWUBWUBUWUBWUBWUBBWUBWUBWUBDTJWUBHZVIWUBWUBWUBPWUBFNHHWUBWUBWUBVTOWUB", "output": "M Q ITCFEYE HEUWGNDFNZGWKLJ MZP U B DTJ HZVI P FNHH VTO " }, { "input": "WUBWUBNDNRFHYJAAUULLHRRDEDHYFSRXJWUBWUBWUBMUJVDTIRSGYZAVWKRGIFWUBWUBWUBHMZWUBWUBWUBVAIWUBWUBWUBDDKJXPZRGWUBWUBWUBSGXWUBWUBWUBIFKWUBWUBWUBUWUBWUBWUBW", "output": "NDNRFHYJAAUULLHRRDEDHYFSRXJ MUJVDTIRSGYZAVWKRGIF HMZ VAI DDKJXPZRG SGX IFK U W " }, { "input": "WUBOJMWRSLAXXHQRTPMJNCMPGWUBWUBWUBNYGMZIXNLAKSQYWDWUBWUBWUBXNIWUBWUBWUBFWUBWUBWUBXMBWUBWUBWUBIWUBWUBWUBINWUBWUBWUBWDWUBWUBWUBDDWUBWUBWUBD", "output": "OJMWRSLAXXHQRTPMJNCMPG NYGMZIXNLAKSQYWD XNI F XMB I IN WD DD D " }, { "input": "WUBWUBWUBREHMWUBWUBWUBXWUBWUBWUBQASNWUBWUBWUBNLSMHLCMTICWUBWUBWUBVAWUBWUBWUBHNWUBWUBWUBNWUBWUBWUBUEXLSFOEULBWUBWUBWUBXWUBWUBWUBJWUBWUBWUBQWUBWUBWUBAWUBWUB", "output": "REHM X QASN NLSMHLCMTIC VA HN N UEXLSFOEULB X J Q A " }, { "input": "WUBWUBWUBSTEZTZEFFIWUBWUBWUBSWUBWUBWUBCWUBFWUBHRJPVWUBWUBWUBDYJUWUBWUBWUBPWYDKCWUBWUBWUBCWUBWUBWUBUUEOGCVHHBWUBWUBWUBEXLWUBWUBWUBVCYWUBWUBWUBMWUBWUBWUBYWUB", "output": "STEZTZEFFI S C F HRJPV DYJU PWYDKC C UUEOGCVHHB EXL VCY M Y " }, { "input": "WPPNMSQOQIWUBWUBWUBPNQXWUBWUBWUBHWUBWUBWUBNFLWUBWUBWUBGWSGAHVJFNUWUBWUBWUBFWUBWUBWUBWCMLRICFSCQQQTNBWUBWUBWUBSWUBWUBWUBKGWUBWUBWUBCWUBWUBWUBBMWUBWUBWUBRWUBWUB", "output": "WPPNMSQOQI PNQX H NFL GWSGAHVJFNU F WCMLRICFSCQQQTNB S KG C BM R " }, { "input": "YZJOOYITZRARKVFYWUBWUBRZQGWUBWUBWUBUOQWUBWUBWUBIWUBWUBWUBNKVDTBOLETKZISTWUBWUBWUBWLWUBQQFMMGSONZMAWUBZWUBWUBWUBQZUXGCWUBWUBWUBIRZWUBWUBWUBLTTVTLCWUBWUBWUBY", "output": "YZJOOYITZRARKVFY RZQG UOQ I NKVDTBOLETKZIST WL QQFMMGSONZMA Z QZUXGC IRZ LTTVTLC Y " }, { "input": "WUBCAXNCKFBVZLGCBWCOAWVWOFKZVQYLVTWUBWUBWUBNLGWUBWUBWUBAMGDZBDHZMRMQMDLIRMIWUBWUBWUBGAJSHTBSWUBWUBWUBCXWUBWUBWUBYWUBZLXAWWUBWUBWUBOHWUBWUBWUBZWUBWUBWUBGBWUBWUBWUBE", "output": "CAXNCKFBVZLGCBWCOAWVWOFKZVQYLVT NLG AMGDZBDHZMRMQMDLIRMI GAJSHTBS CX Y ZLXAW OH Z GB E " }, { "input": "WUBWUBCHXSOWTSQWUBWUBWUBCYUZBPBWUBWUBWUBSGWUBWUBWKWORLRRLQYUUFDNWUBWUBWUBYYGOJNEVEMWUBWUBWUBRWUBWUBWUBQWUBWUBWUBIHCKWUBWUBWUBKTWUBWUBWUBRGSNTGGWUBWUBWUBXCXWUBWUBWUBS", "output": "CHXSOWTSQ CYUZBPB SG WKWORLRRLQYUUFDN YYGOJNEVEM R Q IHCK KT RGSNTGG XCX S " }, { "input": "WUBWUBWUBHJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQWUBWUBWUBXTZKGIITWUBWUBWUBAWUBWUBWUBVNCXPUBCQWUBWUBWUBIDPNAWUBWUBWUBOWUBWUBWUBYGFWUBWUBWUBMQOWUBWUBWUBKWUBWUBWUBAZVWUBWUBWUBEP", "output": "HJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQ XTZKGIIT A VNCXPUBCQ IDPNA O YGF MQO K AZV EP " }, { "input": "WUBKYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTVWUBWUBWUBLRMIIWUBWUBWUBGWUBWUBWUBADPSWUBWUBWUBANBWUBWUBPCWUBWUBWUBPWUBWUBWUBGPVNLSWIRFORYGAABUXMWUBWUBWUBOWUBWUBWUBNWUBWUBWUBYWUBWUB", "output": "KYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTV LRMII G ADPS ANB PC P GPVNLSWIRFORYGAABUXM O N Y " }, { "input": "REWUBWUBWUBJDWUBWUBWUBNWUBWUBWUBTWWUBWUBWUBWZDOCKKWUBWUBWUBLDPOVBFRCFWUBWUBAKZIBQKEUAZEEWUBWUBWUBLQYPNPFWUBYEWUBWUBWUBFWUBWUBWUBBPWUBWUBWUBAWWUBWUBWUBQWUBWUBWUBBRWUBWUBWUBXJL", "output": "RE JD N TW WZDOCKK LDPOVBFRCF AKZIBQKEUAZEE LQYPNPF YE F BP AW Q BR XJL " }, { "input": "CUFGJDXGMWUBWUBWUBOMWUBWUBWUBSIEWUBWUBWUBJJWKNOWUBWUBWUBYBHVNRNORGYWUBWUBWUBOAGCAWUBWUBWUBSBLBKTPFKPBIWUBWUBWUBJBWUBWUBWUBRMFCJPGWUBWUBWUBDWUBWUBWUBOJOWUBWUBWUBZPWUBWUBWUBMWUBRWUBWUBWUBFXWWUBWUBWUBO", "output": "CUFGJDXGM OM SIE JJWKNO YBHVNRNORGY OAGCA SBLBKTPFKPBI JB RMFCJPG D OJO ZP M R FXW O " }, { "input": "WUBJZGAEXFMFEWMAKGQLUWUBWUBWUBICYTPQWGENELVYWANKUOJYWUBWUBWUBGWUBWUBWUBHYCJVLPHTUPNEGKCDGQWUBWUBWUBOFWUBWUBWUBCPGSOGZBRPRPVJJEWUBWUBWUBDQBCWUBWUBWUBHWUBWUBWUBMHOHYBMATWUBWUBWUBVWUBWUBWUBSWUBWUBWUBKOWU", "output": "JZGAEXFMFEWMAKGQLU ICYTPQWGENELVYWANKUOJY G HYCJVLPHTUPNEGKCDGQ OF CPGSOGZBRPRPVJJE DQBC H MHOHYBMAT V S KOWU " }, { "input": "A", "output": "A " }, { "input": "WUBA", "output": "A " }, { "input": "WUBWUBA", "output": "A " }, { "input": "AWUBWUBWUB", "output": "A " }, { "input": "AWUBBWUBCWUBD", "output": "A B C D " }, { "input": "WUBWWUBWUBWUBUWUBWUBBWUB", "output": "W U B " }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA " }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAWUBAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA " }, { "input": "WUWUBBWWUBUB", "output": "WU BW UB " }, { "input": "WUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUABWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUB", "output": "WUAB " }, { "input": "ZWUB", "output": "Z " }, { "input": "WU", "output": "WU " }, { "input": "UB", "output": "UB " }, { "input": "U", "output": "U " }, { "input": "WUBW", "output": "W " }, { "input": "WUBWU", "output": "WU " }, { "input": "WUWUB", "output": "WU " }, { "input": "UBWUB", "output": "UB " }, { "input": "WUWUBUBWUBUWUB", "output": "WU UB U " }, { "input": "WUBWWUBAWUB", "output": "W A " }, { "input": "WUUUUU", "output": "WUUUUU " } ]
1,692,286,466
2,147,483,647
Python 3
OK
TESTS
71
124
0
n=input() w=[word for word in n.split("WUB") if word] o=" ".join(w) print(o)
Title: Dubstep Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them. Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club. For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX". Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song. Input Specification: The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word. Output Specification: Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space. Demo Input: ['WUBWUBABCWUB\n', 'WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n'] Demo Output: ['ABC ', 'WE ARE THE CHAMPIONS MY FRIEND '] Note: In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya. In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
```python n=input() w=[word for word in n.split("WUB") if word] o=" ".join(w) print(o) ```
3
669
A
Little Artem and Presents
PROGRAMMING
800
[ "math" ]
null
null
Little Artem got *n* stones on his birthday and now wants to give some of them to Masha. He knows that Masha cares more about the fact of receiving the present, rather than the value of that present, so he wants to give her stones as many times as possible. However, Masha remembers the last present she received, so Artem can't give her the same number of stones twice in a row. For example, he can give her 3 stones, then 1 stone, then again 3 stones, but he can't give her 3 stones and then again 3 stones right after that. How many times can Artem give presents to Masha?
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=109) — number of stones Artem received on his birthday.
Print the maximum possible number of times Artem can give presents to Masha.
[ "1\n", "2\n", "3\n", "4\n" ]
[ "1\n", "1\n", "2\n", "3\n" ]
In the first sample, Artem can only give 1 stone to Masha. In the second sample, Atrem can give Masha 1 or 2 stones, though he can't give her 1 stone two times. In the third sample, Atrem can first give Masha 2 stones, a then 1 more stone. In the fourth sample, Atrem can first give Masha 1 stone, then 2 stones, and finally 1 stone again.
500
[ { "input": "1", "output": "1" }, { "input": "2", "output": "1" }, { "input": "3", "output": "2" }, { "input": "4", "output": "3" }, { "input": "100", "output": "67" }, { "input": "101", "output": "67" }, { "input": "102", "output": "68" }, { "input": "1000000000", "output": "666666667" }, { "input": "5", "output": "3" }, { "input": "6", "output": "4" }, { "input": "999999999", "output": "666666666" }, { "input": "999999998", "output": "666666665" }, { "input": "999999997", "output": "666666665" }, { "input": "999999996", "output": "666666664" }, { "input": "999999995", "output": "666666663" }, { "input": "999999994", "output": "666666663" }, { "input": "999999993", "output": "666666662" }, { "input": "999999992", "output": "666666661" }, { "input": "999999991", "output": "666666661" }, { "input": "1000", "output": "667" }, { "input": "10000", "output": "6667" }, { "input": "100000", "output": "66667" }, { "input": "1000000", "output": "666667" }, { "input": "10000000", "output": "6666667" }, { "input": "100000000", "output": "66666667" }, { "input": "7", "output": "5" } ]
1,639,544,133
2,147,483,647
PyPy 3-64
OK
TESTS
26
109
0
n = int(input()) chislo_par = n // 3 podarkov = chislo_par * 2 n = n - chislo_par * 3 if n == 1 or n == 2: podarkov = podarkov + 1 print(podarkov)
Title: Little Artem and Presents Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Artem got *n* stones on his birthday and now wants to give some of them to Masha. He knows that Masha cares more about the fact of receiving the present, rather than the value of that present, so he wants to give her stones as many times as possible. However, Masha remembers the last present she received, so Artem can't give her the same number of stones twice in a row. For example, he can give her 3 stones, then 1 stone, then again 3 stones, but he can't give her 3 stones and then again 3 stones right after that. How many times can Artem give presents to Masha? Input Specification: The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=109) — number of stones Artem received on his birthday. Output Specification: Print the maximum possible number of times Artem can give presents to Masha. Demo Input: ['1\n', '2\n', '3\n', '4\n'] Demo Output: ['1\n', '1\n', '2\n', '3\n'] Note: In the first sample, Artem can only give 1 stone to Masha. In the second sample, Atrem can give Masha 1 or 2 stones, though he can't give her 1 stone two times. In the third sample, Atrem can first give Masha 2 stones, a then 1 more stone. In the fourth sample, Atrem can first give Masha 1 stone, then 2 stones, and finally 1 stone again.
```python n = int(input()) chislo_par = n // 3 podarkov = chislo_par * 2 n = n - chislo_par * 3 if n == 1 or n == 2: podarkov = podarkov + 1 print(podarkov) ```
3
681
A
A Good Contest
PROGRAMMING
800
[ "implementation" ]
null
null
Codeforces user' handle color depends on his rating — it is red if his rating is greater or equal to 2400; it is orange if his rating is less than 2400 but greater or equal to 2200, etc. Each time participant takes part in a rated contest, his rating is changed depending on his performance. Anton wants the color of his handle to become red. He considers his performance in the rated contest to be good if he outscored some participant, whose handle was colored red before the contest and his rating has increased after it. Anton has written a program that analyses contest results and determines whether he performed good or not. Are you able to do the same?
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants Anton has outscored in this contest . The next *n* lines describe participants results: the *i*-th of them consists of a participant handle *name**i* and two integers *before**i* and *after**i* (<=-<=4000<=≤<=*before**i*,<=*after**i*<=≤<=4000) — participant's rating before and after the contest, respectively. Each handle is a non-empty string, consisting of no more than 10 characters, which might be lowercase and uppercase English letters, digits, characters «_» and «-» characters. It is guaranteed that all handles are distinct.
Print «YES» (quotes for clarity), if Anton has performed good in the contest and «NO» (quotes for clarity) otherwise.
[ "3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749\n", "3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450\n" ]
[ "YES", "NO" ]
In the first sample, Anton has outscored user with handle Burunduk1, whose handle was colored red before the contest and his rating has increased after the contest. In the second sample, Applejack's rating has not increased after the contest, while both Fluttershy's and Pinkie_Pie's handles were not colored red before the contest.
500
[ { "input": "3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749", "output": "YES" }, { "input": "3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450", "output": "NO" }, { "input": "1\nDb -3373 3591", "output": "NO" }, { "input": "5\nQ2bz 960 2342\nhmX 2710 -1348\ngbAe -1969 -963\nE -160 196\npsi 2665 -3155", "output": "NO" }, { "input": "9\nmwAz9lQ 1786 -1631\nnYgYFXZQfY -1849 -1775\nKU4jF -1773 -3376\nopR 3752 2931\nGl -1481 -1002\nR -1111 3778\n0i9B21DC 3650 289\nQ8L2dS0 358 -3305\ng -2662 3968", "output": "NO" }, { "input": "5\nzMSBcOUf -2883 -2238\nYN -3314 -1480\nfHpuccQn06 -1433 -589\naM1NVEPQi 399 3462\n_L 2516 -3290", "output": "NO" }, { "input": "1\na 2400 2401", "output": "YES" }, { "input": "1\nfucker 4000 4000", "output": "NO" }, { "input": "1\nJora 2400 2401", "output": "YES" }, { "input": "1\nACA 2400 2420", "output": "YES" }, { "input": "1\nAca 2400 2420", "output": "YES" }, { "input": "1\nSub_d 2401 2402", "output": "YES" }, { "input": "2\nHack 2400 2401\nDum 1243 555", "output": "YES" }, { "input": "1\nXXX 2400 2500", "output": "YES" }, { "input": "1\nfucker 2400 2401", "output": "YES" }, { "input": "1\nX 2400 2500", "output": "YES" }, { "input": "1\nvineet 2400 2401", "output": "YES" }, { "input": "1\nabc 2400 2500", "output": "YES" }, { "input": "1\naaaaa 2400 2401", "output": "YES" }, { "input": "1\nhoge 2400 2401", "output": "YES" }, { "input": "1\nInfinity 2400 2468", "output": "YES" }, { "input": "1\nBurunduk1 2400 2401", "output": "YES" }, { "input": "1\nFuck 2400 2401", "output": "YES" }, { "input": "1\nfuck 2400 2401", "output": "YES" }, { "input": "3\nApplejack 2400 2401\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450", "output": "YES" }, { "input": "1\nalex 2400 2401", "output": "YES" }, { "input": "1\nA 2400 2401", "output": "YES" }, { "input": "1\na 2400 2455", "output": "YES" }, { "input": "1\nlol 2400 2401", "output": "YES" }, { "input": "2\nBurunduk1 2400 2537\nBudAlNik 2084 2214", "output": "YES" }, { "input": "1\naaaaaa 2400 2401", "output": "YES" }, { "input": "1\nBurunduk1 2400 2500", "output": "YES" }, { "input": "1\nds 2400 2410", "output": "YES" }, { "input": "1\nas 2400 2401", "output": "YES" }, { "input": "1\nabc 2400 2401", "output": "YES" }, { "input": "3\nBudAlNik 2084 2214\nsubscriber 2833 2749\nBurunduk1 2526 2537", "output": "YES" }, { "input": "1\ncaonima 2400 2401", "output": "YES" }, { "input": "1\narr 2400 2500", "output": "YES" }, { "input": "1\nx 2400 2401", "output": "YES" }, { "input": "1\narrr 2400 2500", "output": "YES" }, { "input": "1\nabc 2400 2405", "output": "YES" }, { "input": "3\nBurunduk1 2400 2420\nBudAlNik 2084 2214\nsubscriber 2833 2749", "output": "YES" }, { "input": "1\nBurunduk1 2400 2537", "output": "YES" }, { "input": "1\nHELLO 2400 2401", "output": "YES" }, { "input": "1\neatmore 2400 2500", "output": "YES" }, { "input": "1\nb 2400 2401", "output": "YES" }, { "input": "3\nBurunduk1 2400 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749", "output": "YES" }, { "input": "1\nApplejack 2400 2410", "output": "YES" }, { "input": "1\nabacaba 2400 2451", "output": "YES" }, { "input": "1\nrekt_n00b 2500 2600", "output": "YES" } ]
1,592,845,344
2,147,483,647
Python 3
OK
TESTS
60
124
0
t=int(input()) d=0 for i in range(t): a,b,c=input().split() x=int(b) y=int(c) if(x>=2400 and y-x>0): d+=1 if(d>=1): print("YES") else: print("NO") #3 #Burunduk1 2526 2537 #BudAlNik 2084 2214 #subscriber 2833 2749 #3 #Applejack 2400 2400 #Fluttershy 2390 2431 #Pinkie_Pie -2500 -2450
Title: A Good Contest Time Limit: None seconds Memory Limit: None megabytes Problem Description: Codeforces user' handle color depends on his rating — it is red if his rating is greater or equal to 2400; it is orange if his rating is less than 2400 but greater or equal to 2200, etc. Each time participant takes part in a rated contest, his rating is changed depending on his performance. Anton wants the color of his handle to become red. He considers his performance in the rated contest to be good if he outscored some participant, whose handle was colored red before the contest and his rating has increased after it. Anton has written a program that analyses contest results and determines whether he performed good or not. Are you able to do the same? Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants Anton has outscored in this contest . The next *n* lines describe participants results: the *i*-th of them consists of a participant handle *name**i* and two integers *before**i* and *after**i* (<=-<=4000<=≤<=*before**i*,<=*after**i*<=≤<=4000) — participant's rating before and after the contest, respectively. Each handle is a non-empty string, consisting of no more than 10 characters, which might be lowercase and uppercase English letters, digits, characters «_» and «-» characters. It is guaranteed that all handles are distinct. Output Specification: Print «YES» (quotes for clarity), if Anton has performed good in the contest and «NO» (quotes for clarity) otherwise. Demo Input: ['3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749\n', '3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450\n'] Demo Output: ['YES', 'NO'] Note: In the first sample, Anton has outscored user with handle Burunduk1, whose handle was colored red before the contest and his rating has increased after the contest. In the second sample, Applejack's rating has not increased after the contest, while both Fluttershy's and Pinkie_Pie's handles were not colored red before the contest.
```python t=int(input()) d=0 for i in range(t): a,b,c=input().split() x=int(b) y=int(c) if(x>=2400 and y-x>0): d+=1 if(d>=1): print("YES") else: print("NO") #3 #Burunduk1 2526 2537 #BudAlNik 2084 2214 #subscriber 2833 2749 #3 #Applejack 2400 2400 #Fluttershy 2390 2431 #Pinkie_Pie -2500 -2450 ```
3
908
C
New Year and Curling
PROGRAMMING
1,500
[ "brute force", "geometry", "implementation", "math" ]
null
null
Carol is currently curling. She has *n* disks each with radius *r* on the 2D plane. Initially she has all these disks above the line *y*<==<=10100. She then will slide the disks towards the line *y*<==<=0 one by one in order from 1 to *n*. When she slides the *i*-th disk, she will place its center at the point (*x**i*,<=10100). She will then push it so the disk’s *y* coordinate continuously decreases, and *x* coordinate stays constant. The disk stops once it touches the line *y*<==<=0 or it touches any previous disk. Note that once a disk stops moving, it will not move again, even if hit by another disk. Compute the *y*-coordinates of centers of all the disks after all disks have been pushed.
The first line will contain two integers *n* and *r* (1<=≤<=*n*,<=*r*<=≤<=1<=000), the number of disks, and the radius of the disks, respectively. The next line will contain *n* integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=1<=000) — the *x*-coordinates of the disks.
Print a single line with *n* numbers. The *i*-th number denotes the *y*-coordinate of the center of the *i*-th disk. The output will be accepted if it has absolute or relative error at most 10<=-<=6. Namely, let's assume that your answer for a particular value of a coordinate is *a* and the answer of the jury is *b*. The checker program will consider your answer correct if for all coordinates.
[ "6 2\n5 5 6 8 3 12\n" ]
[ "2 6.0 9.87298334621 13.3370849613 12.5187346573 13.3370849613\n" ]
The final positions of the disks will look as follows: In particular, note the position of the last disk.
1,000
[ { "input": "6 2\n5 5 6 8 3 12", "output": "2 6.0 9.87298334621 13.3370849613 12.5187346573 13.3370849613" }, { "input": "1 1\n5", "output": "1" }, { "input": "5 300\n939 465 129 611 532", "output": "300 667.864105343 1164.9596696 1522.27745533 2117.05388391" }, { "input": "5 1\n416 387 336 116 81", "output": "1 1 1 1 1" }, { "input": "3 10\n1 100 1000", "output": "10 10 10" }, { "input": "2 1\n2 20", "output": "1 1" }, { "input": "3 2\n10 10 100", "output": "2 6.0 2" } ]
1,672,588,958
2,147,483,647
Python 3
OK
TESTS
15
639
0
n,r=list(map(int, input().split())) a=list(map(int, input().split())) r_2=(2*r)**2 c=[] for i in range(n): if i==0: c.append(r) else: x2=a[i] k=[] for j in range(i): x1=a[j] y1=c[j] if abs(x2-x1)<=2*r: k.append((r_2-(x2-x1)**2)**0.5+y1) if len(k)==0: c.append(r) else: c.append(max(k)) print(*c)
Title: New Year and Curling Time Limit: None seconds Memory Limit: None megabytes Problem Description: Carol is currently curling. She has *n* disks each with radius *r* on the 2D plane. Initially she has all these disks above the line *y*<==<=10100. She then will slide the disks towards the line *y*<==<=0 one by one in order from 1 to *n*. When she slides the *i*-th disk, she will place its center at the point (*x**i*,<=10100). She will then push it so the disk’s *y* coordinate continuously decreases, and *x* coordinate stays constant. The disk stops once it touches the line *y*<==<=0 or it touches any previous disk. Note that once a disk stops moving, it will not move again, even if hit by another disk. Compute the *y*-coordinates of centers of all the disks after all disks have been pushed. Input Specification: The first line will contain two integers *n* and *r* (1<=≤<=*n*,<=*r*<=≤<=1<=000), the number of disks, and the radius of the disks, respectively. The next line will contain *n* integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=1<=000) — the *x*-coordinates of the disks. Output Specification: Print a single line with *n* numbers. The *i*-th number denotes the *y*-coordinate of the center of the *i*-th disk. The output will be accepted if it has absolute or relative error at most 10<=-<=6. Namely, let's assume that your answer for a particular value of a coordinate is *a* and the answer of the jury is *b*. The checker program will consider your answer correct if for all coordinates. Demo Input: ['6 2\n5 5 6 8 3 12\n'] Demo Output: ['2 6.0 9.87298334621 13.3370849613 12.5187346573 13.3370849613\n'] Note: The final positions of the disks will look as follows: In particular, note the position of the last disk.
```python n,r=list(map(int, input().split())) a=list(map(int, input().split())) r_2=(2*r)**2 c=[] for i in range(n): if i==0: c.append(r) else: x2=a[i] k=[] for j in range(i): x1=a[j] y1=c[j] if abs(x2-x1)<=2*r: k.append((r_2-(x2-x1)**2)**0.5+y1) if len(k)==0: c.append(r) else: c.append(max(k)) print(*c) ```
3
604
B
More Cowbell
PROGRAMMING
1,400
[ "binary search", "greedy" ]
null
null
Kevin Sun wants to move his precious collection of *n* cowbells from Naperthrill to Exeter, where there is actually grass instead of corn. Before moving, he must pack his cowbells into *k* boxes of a fixed size. In order to keep his collection safe during transportation, he won't place more than two cowbells into a single box. Since Kevin wishes to minimize expenses, he is curious about the smallest size box he can use to pack his entire collection. Kevin is a meticulous cowbell collector and knows that the size of his *i*-th (1<=≤<=*i*<=≤<=*n*) cowbell is an integer *s**i*. In fact, he keeps his cowbells sorted by size, so *s**i*<=-<=1<=≤<=*s**i* for any *i*<=&gt;<=1. Also an expert packer, Kevin can fit one or two cowbells into a box of size *s* if and only if the sum of their sizes does not exceed *s*. Given this information, help Kevin determine the smallest *s* for which it is possible to put all of his cowbells into *k* boxes of size *s*.
The first line of the input contains two space-separated integers *n* and *k* (1<=≤<=*n*<=≤<=2·*k*<=≤<=100<=000), denoting the number of cowbells and the number of boxes, respectively. The next line contains *n* space-separated integers *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*s*1<=≤<=*s*2<=≤<=...<=≤<=*s**n*<=≤<=1<=000<=000), the sizes of Kevin's cowbells. It is guaranteed that the sizes *s**i* are given in non-decreasing order.
Print a single integer, the smallest *s* for which it is possible for Kevin to put all of his cowbells into *k* boxes of size *s*.
[ "2 1\n2 5\n", "4 3\n2 3 5 9\n", "3 2\n3 5 7\n" ]
[ "7\n", "9\n", "8\n" ]
In the first sample, Kevin must pack his two cowbells into the same box. In the second sample, Kevin can pack together the following sets of cowbells: {2, 3}, {5} and {9}. In the third sample, the optimal solution is {3, 5} and {7}.
1,000
[ { "input": "2 1\n2 5", "output": "7" }, { "input": "4 3\n2 3 5 9", "output": "9" }, { "input": "3 2\n3 5 7", "output": "8" }, { "input": "20 11\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "2" }, { "input": "10 10\n3 15 31 61 63 63 68 94 98 100", "output": "100" }, { "input": "100 97\n340 402 415 466 559 565 649 689 727 771 774 776 789 795 973 1088 1212 1293 1429 1514 1587 1599 1929 1997 2278 2529 2656 2677 2839 2894 2951 3079 3237 3250 3556 3568 3569 3578 3615 3641 3673 3892 4142 4418 4515 4766 4846 4916 5225 5269 5352 5460 5472 5635 5732 5886 5941 5976 5984 6104 6113 6402 6409 6460 6550 6563 6925 7006 7289 7401 7441 7451 7709 7731 7742 7750 7752 7827 8101 8154 8376 8379 8432 8534 8578 8630 8706 8814 8882 8972 9041 9053 9109 9173 9473 9524 9547 9775 9791 9983", "output": "9983" }, { "input": "10 9\n7 29 35 38 41 47 54 56 73 74", "output": "74" }, { "input": "1 2342\n12345", "output": "12345" }, { "input": "10 5\n15 15 20 28 38 44 46 52 69 94", "output": "109" }, { "input": "10 9\n6 10 10 32 36 38 69 80 82 93", "output": "93" }, { "input": "10 10\n4 19 22 24 25 43 49 56 78 88", "output": "88" }, { "input": "100 89\n474 532 759 772 803 965 1043 1325 1342 1401 1411 1452 1531 1707 1906 1928 2034 2222 2335 2606 2757 2968 2978 3211 3513 3734 3772 3778 3842 3948 3976 4038 4055 4113 4182 4267 4390 4408 4478 4595 4668 4792 4919 5133 5184 5255 5312 5341 5476 5628 5683 5738 5767 5806 5973 6051 6134 6254 6266 6279 6314 6342 6599 6676 6747 6777 6827 6842 7057 7097 7259 7340 7378 7405 7510 7520 7698 7796 8148 8351 8507 8601 8805 8814 8826 8978 9116 9140 9174 9338 9394 9403 9407 9423 9429 9519 9764 9784 9838 9946", "output": "9946" }, { "input": "100 74\n10 211 323 458 490 592 979 981 1143 1376 1443 1499 1539 1612 1657 1874 2001 2064 2123 2274 2346 2471 2522 2589 2879 2918 2933 2952 3160 3164 3167 3270 3382 3404 3501 3522 3616 3802 3868 3985 4007 4036 4101 4580 4687 4713 4714 4817 4955 5257 5280 5343 5428 5461 5566 5633 5727 5874 5925 6233 6309 6389 6500 6701 6731 6847 6916 7088 7088 7278 7296 7328 7564 7611 7646 7887 7887 8065 8075 8160 8300 8304 8316 8355 8404 8587 8758 8794 8890 9038 9163 9235 9243 9339 9410 9587 9868 9916 9923 9986", "output": "9986" }, { "input": "100 61\n82 167 233 425 432 456 494 507 562 681 683 921 1218 1323 1395 1531 1586 1591 1675 1766 1802 1842 2116 2625 2697 2735 2739 3337 3349 3395 3406 3596 3610 3721 4059 4078 4305 4330 4357 4379 4558 4648 4651 4784 4819 4920 5049 5312 5361 5418 5440 5463 5547 5594 5821 5951 5972 6141 6193 6230 6797 6842 6853 6854 7017 7026 7145 7322 7391 7460 7599 7697 7756 7768 7872 7889 8094 8215 8408 8440 8462 8714 8756 8760 8881 9063 9111 9184 9281 9373 9406 9417 9430 9511 9563 9634 9660 9788 9883 9927", "output": "9927" }, { "input": "100 84\n53 139 150 233 423 570 786 861 995 1017 1072 1196 1276 1331 1680 1692 1739 1748 1826 2067 2280 2324 2368 2389 2607 2633 2760 2782 2855 2996 3030 3093 3513 3536 3557 3594 3692 3707 3823 3832 4009 4047 4088 4095 4408 4537 4565 4601 4784 4878 4935 5029 5252 5322 5389 5407 5511 5567 5857 6182 6186 6198 6280 6290 6353 6454 6458 6567 6843 7166 7216 7257 7261 7375 7378 7539 7542 7762 7771 7797 7980 8363 8606 8612 8663 8801 8808 8823 8918 8975 8997 9240 9245 9259 9356 9755 9759 9760 9927 9970", "output": "9970" }, { "input": "100 50\n130 248 312 312 334 589 702 916 921 1034 1047 1346 1445 1500 1585 1744 1951 2123 2273 2362 2400 2455 2496 2530 2532 2944 3074 3093 3094 3134 3698 3967 4047 4102 4109 4260 4355 4466 4617 4701 4852 4892 4915 4917 4936 4981 4999 5106 5152 5203 5214 5282 5412 5486 5525 5648 5897 5933 5969 6251 6400 6421 6422 6558 6805 6832 6908 6924 6943 6980 7092 7206 7374 7417 7479 7546 7672 7756 7973 8020 8028 8079 8084 8085 8137 8153 8178 8239 8639 8667 8829 9263 9333 9370 9420 9579 9723 9784 9841 9993", "output": "11103" }, { "input": "100 50\n156 182 208 409 496 515 659 761 772 794 827 912 1003 1236 1305 1388 1412 1422 1428 1465 1613 2160 2411 2440 2495 2684 2724 2925 3033 3035 3155 3260 3378 3442 3483 3921 4031 4037 4091 4113 4119 4254 4257 4442 4559 4614 4687 4839 4896 5054 5246 5316 5346 5859 5928 5981 6148 6250 6422 6433 6448 6471 6473 6485 6503 6779 6812 7050 7064 7074 7141 7378 7424 7511 7574 7651 7808 7858 8286 8291 8446 8536 8599 8628 8636 8768 8900 8981 9042 9055 9114 9146 9186 9411 9480 9590 9681 9749 9757 9983", "output": "10676" }, { "input": "100 50\n145 195 228 411 577 606 629 775 1040 1040 1058 1187 1307 1514 1784 1867 1891 2042 2042 2236 2549 2555 2560 2617 2766 2807 2829 2917 3070 3072 3078 3095 3138 3147 3149 3196 3285 3287 3309 3435 3531 3560 3563 3769 3830 3967 4081 4158 4315 4387 4590 4632 4897 4914 5128 5190 5224 5302 5402 5416 5420 5467 5517 5653 5820 5862 5941 6053 6082 6275 6292 6316 6490 6530 6619 6632 6895 7071 7234 7323 7334 7412 7626 7743 8098 8098 8136 8158 8264 8616 8701 8718 8770 8803 8809 8983 9422 9530 9811 9866", "output": "10011" }, { "input": "100 50\n56 298 387 456 518 532 589 792 870 1041 1055 1122 1141 1166 1310 1329 1523 1548 1626 1730 1780 1833 1850 1911 2006 2157 2303 2377 2403 2442 2450 2522 2573 2822 2994 3200 3238 3252 3280 3311 3345 3422 3429 3506 3526 3617 3686 3791 4134 4467 4525 4614 4633 4792 5017 5220 5243 5338 5445 5536 5639 5675 5763 5875 6129 6220 6228 6287 6385 6616 6789 6822 6940 6959 6985 7297 7304 7391 7443 7580 7824 7884 7981 8055 8063 8223 8280 8322 8346 8473 8688 8986 9087 9323 9477 9489 9518 9621 9699 9804", "output": "10009" }, { "input": "100 49990\n221 257 543 613 818 855 884 1195 1233 1293 1327 1474 1567 1568 1728 1789 1809 1957 1994 2198 2217 2289 2298 2360 2441 2454 2517 2519 2597 2652 2909 2958 2970 3271 3310 3409 3450 3646 3950 3965 4016 4116 4134 4159 4462 4624 4631 4783 4804 5031 5276 5538 5729 5845 5880 5894 5959 5961 6028 6105 6184 6335 6370 6523 6532 6677 6762 6868 6998 7066 7245 7360 7490 7492 7645 7677 7786 7804 8038 8131 8207 8400 8507 8556 8575 8599 8673 8676 8712 8816 9123 9158 9216 9369 9628 9707 9768 9800 9876 9934", "output": "9934" }, { "input": "1 50000\n2", "output": "2" }, { "input": "1 40000\n23456", "output": "23456" }, { "input": "1 2\n10", "output": "10" }, { "input": "1 1\n1", "output": "1" }, { "input": "2 2\n2 3", "output": "3" }, { "input": "4 2\n1 2 8 9", "output": "10" } ]
1,666,778,067
2,147,483,647
Python 3
OK
TESTS
54
124
7,270,400
n, k = map(int, input().split()) values = list(map(int, input().split())) start ,end = 0, len(values) - 1 res = 0 while start <= end: length = (end - start) + 1 if (length % k) or length == k: res = max(res, values[end]) else: res = max(res, values[start] + values[end]) start += 1 end -= 1 k -= 1 print(res)
Title: More Cowbell Time Limit: None seconds Memory Limit: None megabytes Problem Description: Kevin Sun wants to move his precious collection of *n* cowbells from Naperthrill to Exeter, where there is actually grass instead of corn. Before moving, he must pack his cowbells into *k* boxes of a fixed size. In order to keep his collection safe during transportation, he won't place more than two cowbells into a single box. Since Kevin wishes to minimize expenses, he is curious about the smallest size box he can use to pack his entire collection. Kevin is a meticulous cowbell collector and knows that the size of his *i*-th (1<=≤<=*i*<=≤<=*n*) cowbell is an integer *s**i*. In fact, he keeps his cowbells sorted by size, so *s**i*<=-<=1<=≤<=*s**i* for any *i*<=&gt;<=1. Also an expert packer, Kevin can fit one or two cowbells into a box of size *s* if and only if the sum of their sizes does not exceed *s*. Given this information, help Kevin determine the smallest *s* for which it is possible to put all of his cowbells into *k* boxes of size *s*. Input Specification: The first line of the input contains two space-separated integers *n* and *k* (1<=≤<=*n*<=≤<=2·*k*<=≤<=100<=000), denoting the number of cowbells and the number of boxes, respectively. The next line contains *n* space-separated integers *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*s*1<=≤<=*s*2<=≤<=...<=≤<=*s**n*<=≤<=1<=000<=000), the sizes of Kevin's cowbells. It is guaranteed that the sizes *s**i* are given in non-decreasing order. Output Specification: Print a single integer, the smallest *s* for which it is possible for Kevin to put all of his cowbells into *k* boxes of size *s*. Demo Input: ['2 1\n2 5\n', '4 3\n2 3 5 9\n', '3 2\n3 5 7\n'] Demo Output: ['7\n', '9\n', '8\n'] Note: In the first sample, Kevin must pack his two cowbells into the same box. In the second sample, Kevin can pack together the following sets of cowbells: {2, 3}, {5} and {9}. In the third sample, the optimal solution is {3, 5} and {7}.
```python n, k = map(int, input().split()) values = list(map(int, input().split())) start ,end = 0, len(values) - 1 res = 0 while start <= end: length = (end - start) + 1 if (length % k) or length == k: res = max(res, values[end]) else: res = max(res, values[start] + values[end]) start += 1 end -= 1 k -= 1 print(res) ```
3
124
A
The number of positions
PROGRAMMING
1,000
[ "math" ]
null
null
Petr stands in line of *n* people, but he doesn't know exactly which position he occupies. He can say that there are no less than *a* people standing in front of him and no more than *b* people standing behind him. Find the number of different positions Petr can occupy.
The only line contains three integers *n*, *a* and *b* (0<=≤<=*a*,<=*b*<=&lt;<=*n*<=≤<=100).
Print the single number — the number of the sought positions.
[ "3 1 1\n", "5 2 3\n" ]
[ "2\n", "3\n" ]
The possible positions in the first sample are: 2 and 3 (if we number the positions starting with 1). In the second sample they are 3, 4 and 5.
500
[ { "input": "3 1 1", "output": "2" }, { "input": "5 2 3", "output": "3" }, { "input": "5 4 0", "output": "1" }, { "input": "6 5 5", "output": "1" }, { "input": "9 4 3", "output": "4" }, { "input": "11 4 6", "output": "7" }, { "input": "13 8 7", "output": "5" }, { "input": "14 5 5", "output": "6" }, { "input": "16 6 9", "output": "10" }, { "input": "20 13 17", "output": "7" }, { "input": "22 4 8", "output": "9" }, { "input": "23 8 14", "output": "15" }, { "input": "26 18 22", "output": "8" }, { "input": "28 6 1", "output": "2" }, { "input": "29 5 23", "output": "24" }, { "input": "32 27 15", "output": "5" }, { "input": "33 11 5", "output": "6" }, { "input": "37 21 15", "output": "16" }, { "input": "39 34 33", "output": "5" }, { "input": "41 27 11", "output": "12" }, { "input": "42 25 16", "output": "17" }, { "input": "45 7 43", "output": "38" }, { "input": "47 16 17", "output": "18" }, { "input": "49 11 37", "output": "38" }, { "input": "51 38 39", "output": "13" }, { "input": "52 29 7", "output": "8" }, { "input": "56 43 12", "output": "13" }, { "input": "58 57 28", "output": "1" }, { "input": "59 12 39", "output": "40" }, { "input": "62 9 52", "output": "53" }, { "input": "63 29 44", "output": "34" }, { "input": "65 30 22", "output": "23" }, { "input": "66 27 38", "output": "39" }, { "input": "71 33 53", "output": "38" }, { "input": "73 14 12", "output": "13" }, { "input": "73 37 35", "output": "36" }, { "input": "76 69 44", "output": "7" }, { "input": "79 25 20", "output": "21" }, { "input": "81 60 20", "output": "21" }, { "input": "81 79 14", "output": "2" }, { "input": "84 0 42", "output": "43" }, { "input": "88 79 8", "output": "9" }, { "input": "90 76 59", "output": "14" }, { "input": "92 2 22", "output": "23" }, { "input": "94 5 88", "output": "89" }, { "input": "94 62 48", "output": "32" }, { "input": "96 22 72", "output": "73" }, { "input": "100 11 88", "output": "89" }, { "input": "100 81 91", "output": "19" }, { "input": "1 0 0", "output": "1" } ]
1,689,466,966
2,147,483,647
Python 3
OK
TESTS
50
92
0
n, a, b = map(int,input().split()) lst = [i for i in range(n)] while lst[-1] - lst[a] > b: a += 1 pos = lst[-1] - lst[a] + 1 print(pos)
Title: The number of positions Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petr stands in line of *n* people, but he doesn't know exactly which position he occupies. He can say that there are no less than *a* people standing in front of him and no more than *b* people standing behind him. Find the number of different positions Petr can occupy. Input Specification: The only line contains three integers *n*, *a* and *b* (0<=≤<=*a*,<=*b*<=&lt;<=*n*<=≤<=100). Output Specification: Print the single number — the number of the sought positions. Demo Input: ['3 1 1\n', '5 2 3\n'] Demo Output: ['2\n', '3\n'] Note: The possible positions in the first sample are: 2 and 3 (if we number the positions starting with 1). In the second sample they are 3, 4 and 5.
```python n, a, b = map(int,input().split()) lst = [i for i in range(n)] while lst[-1] - lst[a] > b: a += 1 pos = lst[-1] - lst[a] + 1 print(pos) ```
3
879
A
Borya's Diagnosis
PROGRAMMING
900
[ "implementation" ]
null
null
It seems that Borya is seriously sick. He is going visit *n* doctors to find out the exact diagnosis. Each of the doctors needs the information about all previous visits, so Borya has to visit them in the prescribed order (i.e. Borya should first visit doctor 1, then doctor 2, then doctor 3 and so on). Borya will get the information about his health from the last doctor. Doctors have a strange working schedule. The doctor *i* goes to work on the *s**i*-th day and works every *d**i* day. So, he works on days *s**i*,<=*s**i*<=+<=*d**i*,<=*s**i*<=+<=2*d**i*,<=.... The doctor's appointment takes quite a long time, so Borya can not see more than one doctor per day. What is the minimum time he needs to visit all doctors?
First line contains an integer *n* — number of doctors (1<=≤<=*n*<=≤<=1000). Next *n* lines contain two numbers *s**i* and *d**i* (1<=≤<=*s**i*,<=*d**i*<=≤<=1000).
Output a single integer — the minimum day at which Borya can visit the last doctor.
[ "3\n2 2\n1 2\n2 2\n", "2\n10 1\n6 5\n" ]
[ "4\n", "11\n" ]
In the first sample case, Borya can visit all doctors on days 2, 3 and 4. In the second sample case, Borya can visit all doctors on days 10 and 11.
500
[ { "input": "3\n2 2\n1 2\n2 2", "output": "4" }, { "input": "2\n10 1\n6 5", "output": "11" }, { "input": "3\n6 10\n3 3\n8 2", "output": "10" }, { "input": "4\n4 8\n10 10\n4 2\n8 2", "output": "14" }, { "input": "5\n7 1\n5 1\n6 1\n1 6\n6 8", "output": "14" }, { "input": "6\n1 3\n2 5\n4 7\n7 5\n6 8\n8 8", "output": "16" }, { "input": "10\n4 10\n8 7\n6 5\n2 1\n2 3\n8 8\n2 4\n2 2\n6 7\n7 9", "output": "34" }, { "input": "1\n1 1", "output": "1" }, { "input": "1\n1000 1000", "output": "1000" }, { "input": "42\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2", "output": "83" }, { "input": "2\n5 5\n5 1", "output": "6" }, { "input": "2\n5 5\n5 5", "output": "10" }, { "input": "2\n1 1\n1 1", "output": "2" }, { "input": "2\n1 6\n7 1", "output": "7" }, { "input": "2\n4 3\n4 5", "output": "9" }, { "input": "2\n1 2\n1 3", "output": "4" }, { "input": "3\n2 3\n5 1\n2 1", "output": "6" }, { "input": "2\n2 1\n6 3", "output": "6" }, { "input": "3\n10 1\n4 4\n12 1", "output": "13" }, { "input": "2\n2 2\n10 2", "output": "10" }, { "input": "2\n1 1\n1000 2", "output": "1000" }, { "input": "14\n1000 1\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1 1", "output": "13001" }, { "input": "2\n2 4\n2 1", "output": "3" }, { "input": "3\n1 100\n100 3\n200 1", "output": "200" }, { "input": "7\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1 1", "output": "6001" }, { "input": "2\n5 5\n15 5", "output": "15" }, { "input": "2\n2 2\n2 4", "output": "6" }, { "input": "2\n1 1\n10 1", "output": "10" }, { "input": "2\n10 1\n100 1", "output": "100" }, { "input": "15\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1 1", "output": "14001" }, { "input": "3\n2 1\n1 3\n4 7", "output": "11" }, { "input": "2\n5 5\n100 5", "output": "100" }, { "input": "2\n1 10\n2 30", "output": "2" }, { "input": "4\n2 2\n2 2\n2 2\n2 2", "output": "8" }, { "input": "1\n10 10", "output": "10" } ]
1,574,683,214
2,147,483,647
PyPy 3
OK
TESTS
51
358
2,969,600
n ,Day = int(input()), 0 for i in range(n): x ,y = map(int, input().split()) if i==0: Day = x continue while(Day>=x):x+=y Day = x print(Day)
Title: Borya's Diagnosis Time Limit: None seconds Memory Limit: None megabytes Problem Description: It seems that Borya is seriously sick. He is going visit *n* doctors to find out the exact diagnosis. Each of the doctors needs the information about all previous visits, so Borya has to visit them in the prescribed order (i.e. Borya should first visit doctor 1, then doctor 2, then doctor 3 and so on). Borya will get the information about his health from the last doctor. Doctors have a strange working schedule. The doctor *i* goes to work on the *s**i*-th day and works every *d**i* day. So, he works on days *s**i*,<=*s**i*<=+<=*d**i*,<=*s**i*<=+<=2*d**i*,<=.... The doctor's appointment takes quite a long time, so Borya can not see more than one doctor per day. What is the minimum time he needs to visit all doctors? Input Specification: First line contains an integer *n* — number of doctors (1<=≤<=*n*<=≤<=1000). Next *n* lines contain two numbers *s**i* and *d**i* (1<=≤<=*s**i*,<=*d**i*<=≤<=1000). Output Specification: Output a single integer — the minimum day at which Borya can visit the last doctor. Demo Input: ['3\n2 2\n1 2\n2 2\n', '2\n10 1\n6 5\n'] Demo Output: ['4\n', '11\n'] Note: In the first sample case, Borya can visit all doctors on days 2, 3 and 4. In the second sample case, Borya can visit all doctors on days 10 and 11.
```python n ,Day = int(input()), 0 for i in range(n): x ,y = map(int, input().split()) if i==0: Day = x continue while(Day>=x):x+=y Day = x print(Day) ```
3
883
M
Quadcopter Competition
PROGRAMMING
1,100
[ "greedy", "math" ]
null
null
Polycarp takes part in a quadcopter competition. According to the rules a flying robot should: - start the race from some point of a field, - go around the flag, - close cycle returning back to the starting point. Polycarp knows the coordinates of the starting point (*x*1,<=*y*1) and the coordinates of the point where the flag is situated (*x*2,<=*y*2). Polycarp’s quadcopter can fly only parallel to the sides of the field each tick changing exactly one coordinate by 1. It means that in one tick the quadcopter can fly from the point (*x*,<=*y*) to any of four points: (*x*<=-<=1,<=*y*), (*x*<=+<=1,<=*y*), (*x*,<=*y*<=-<=1) or (*x*,<=*y*<=+<=1). Thus the quadcopter path is a closed cycle starting and finishing in (*x*1,<=*y*1) and containing the point (*x*2,<=*y*2) strictly inside. What is the minimal length of the quadcopter path?
The first line contains two integer numbers *x*1 and *y*1 (<=-<=100<=≤<=*x*1,<=*y*1<=≤<=100) — coordinates of the quadcopter starting (and finishing) point. The second line contains two integer numbers *x*2 and *y*2 (<=-<=100<=≤<=*x*2,<=*y*2<=≤<=100) — coordinates of the flag. It is guaranteed that the quadcopter starting point and the flag do not coincide.
Print the length of minimal path of the quadcopter to surround the flag and return back.
[ "1 5\n5 2\n", "0 1\n0 0\n" ]
[ "18\n", "8\n" ]
none
0
[ { "input": "1 5\n5 2", "output": "18" }, { "input": "0 1\n0 0", "output": "8" }, { "input": "-100 -100\n100 100", "output": "804" }, { "input": "-100 -100\n-100 100", "output": "406" }, { "input": "-100 -100\n100 -100", "output": "406" }, { "input": "100 -100\n-100 -100", "output": "406" }, { "input": "100 -100\n-100 100", "output": "804" }, { "input": "100 -100\n100 100", "output": "406" }, { "input": "-100 100\n-100 -100", "output": "406" }, { "input": "-100 100\n100 -100", "output": "804" }, { "input": "-100 100\n100 100", "output": "406" }, { "input": "100 100\n-100 -100", "output": "804" }, { "input": "100 100\n-100 100", "output": "406" }, { "input": "100 100\n100 -100", "output": "406" }, { "input": "45 -43\n45 -44", "output": "8" }, { "input": "76 76\n75 75", "output": "8" }, { "input": "-34 -56\n-35 -56", "output": "8" }, { "input": "56 -7\n55 -6", "output": "8" }, { "input": "43 -11\n43 -10", "output": "8" }, { "input": "1 -3\n2 -2", "output": "8" }, { "input": "55 71\n56 71", "output": "8" }, { "input": "54 -87\n55 -88", "output": "8" }, { "input": "22 98\n100 33", "output": "290" }, { "input": "37 84\n-83 5", "output": "402" }, { "input": "52 74\n-73 -39", "output": "480" }, { "input": "66 51\n51 -71", "output": "278" }, { "input": "-31 44\n73 86", "output": "296" }, { "input": "-20 34\n-9 55", "output": "68" }, { "input": "-5 19\n-91 -86", "output": "386" }, { "input": "-82 5\n28 -17", "output": "268" }, { "input": "-90 -100\n55 48", "output": "590" }, { "input": "-75 -14\n-32 8", "output": "134" }, { "input": "-53 -28\n-13 -28", "output": "86" }, { "input": "-42 -46\n10 -64", "output": "144" }, { "input": "55 -42\n25 2", "output": "152" }, { "input": "70 -64\n-54 70", "output": "520" }, { "input": "93 -78\n-32 -75", "output": "260" }, { "input": "8 -93\n79 -6", "output": "320" }, { "input": "50 43\n54 10", "output": "78" }, { "input": "65 32\n-37 71", "output": "286" }, { "input": "80 18\n-15 -58", "output": "346" }, { "input": "94 92\n4 -1", "output": "370" }, { "input": "-10 96\n27 64", "output": "142" }, { "input": "-96 78\n-56 32", "output": "176" }, { "input": "-81 64\n-37 -8", "output": "236" }, { "input": "-58 49\n74 -40", "output": "446" }, { "input": "-62 -55\n1 18", "output": "276" }, { "input": "-51 -69\n-78 86", "output": "368" }, { "input": "-29 -80\n-56 -47", "output": "124" }, { "input": "-14 -94\n55 -90", "output": "150" }, { "input": "83 -2\n82 83", "output": "176" }, { "input": "98 -16\n-96 40", "output": "504" }, { "input": "17 -34\n-86 -93", "output": "328" }, { "input": "32 -48\n33 -37", "output": "28" }, { "input": "74 87\n3 92", "output": "156" }, { "input": "89 73\n-80 49", "output": "390" }, { "input": "4 58\n-61 -80", "output": "410" }, { "input": "15 48\n50 -20", "output": "210" }, { "input": "-82 45\n81 46", "output": "332" }, { "input": "-68 26\n-2 6", "output": "176" }, { "input": "-53 4\n-92 -31", "output": "152" }, { "input": "-30 94\n31 -58", "output": "430" }, { "input": "-38 -11\n58 99", "output": "416" }, { "input": "-27 -25\n-28 68", "output": "192" }, { "input": "-5 -39\n-10 -77", "output": "90" }, { "input": "-90 -54\n9 -9", "output": "292" }, { "input": "7 -57\n28 61", "output": "282" }, { "input": "18 -67\n-51 21", "output": "318" }, { "input": "41 -82\n-33 -15", "output": "286" }, { "input": "56 -8\n91 -55", "output": "168" }, { "input": "-23 -13\n-24 -12", "output": "8" }, { "input": "1 32\n1 33", "output": "8" }, { "input": "25 76\n24 76", "output": "8" }, { "input": "-29 -78\n-28 -79", "output": "8" }, { "input": "-77 19\n-76 19", "output": "8" }, { "input": "-53 63\n-53 62", "output": "8" }, { "input": "86 12\n86 11", "output": "8" }, { "input": "14 56\n13 56", "output": "8" }, { "input": "63 41\n62 40", "output": "8" }, { "input": "0 -4\n1 -4", "output": "8" }, { "input": "24 41\n24 42", "output": "8" }, { "input": "48 85\n49 86", "output": "8" }, { "input": "0 0\n0 1", "output": "8" }, { "input": "0 0\n1 0", "output": "8" }, { "input": "0 0\n1 1", "output": "8" }, { "input": "0 1\n0 0", "output": "8" }, { "input": "0 1\n1 0", "output": "8" }, { "input": "0 1\n1 1", "output": "8" }, { "input": "1 0\n0 0", "output": "8" }, { "input": "1 0\n0 1", "output": "8" }, { "input": "1 0\n1 1", "output": "8" }, { "input": "1 1\n0 0", "output": "8" }, { "input": "1 1\n0 1", "output": "8" }, { "input": "1 1\n1 0", "output": "8" }, { "input": "100 100\n99 -100", "output": "406" }, { "input": "100 100\n-100 99", "output": "406" }, { "input": "-100 -100\n-99 100", "output": "406" }, { "input": "-100 -100\n100 -99", "output": "406" }, { "input": "0 0\n1 2", "output": "10" }, { "input": "0 0\n2 1", "output": "10" } ]
1,508,574,265
1,165
PyPy 3
OK
TESTS1
42
93
23,142,400
x1,y1=map(int,input().split()) x2,y2=map(int,input().split()) print(2*(max(abs(x1-x2)+1,2)+max(abs(y1-y2)+1,2)))
Title: Quadcopter Competition Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarp takes part in a quadcopter competition. According to the rules a flying robot should: - start the race from some point of a field, - go around the flag, - close cycle returning back to the starting point. Polycarp knows the coordinates of the starting point (*x*1,<=*y*1) and the coordinates of the point where the flag is situated (*x*2,<=*y*2). Polycarp’s quadcopter can fly only parallel to the sides of the field each tick changing exactly one coordinate by 1. It means that in one tick the quadcopter can fly from the point (*x*,<=*y*) to any of four points: (*x*<=-<=1,<=*y*), (*x*<=+<=1,<=*y*), (*x*,<=*y*<=-<=1) or (*x*,<=*y*<=+<=1). Thus the quadcopter path is a closed cycle starting and finishing in (*x*1,<=*y*1) and containing the point (*x*2,<=*y*2) strictly inside. What is the minimal length of the quadcopter path? Input Specification: The first line contains two integer numbers *x*1 and *y*1 (<=-<=100<=≤<=*x*1,<=*y*1<=≤<=100) — coordinates of the quadcopter starting (and finishing) point. The second line contains two integer numbers *x*2 and *y*2 (<=-<=100<=≤<=*x*2,<=*y*2<=≤<=100) — coordinates of the flag. It is guaranteed that the quadcopter starting point and the flag do not coincide. Output Specification: Print the length of minimal path of the quadcopter to surround the flag and return back. Demo Input: ['1 5\n5 2\n', '0 1\n0 0\n'] Demo Output: ['18\n', '8\n'] Note: none
```python x1,y1=map(int,input().split()) x2,y2=map(int,input().split()) print(2*(max(abs(x1-x2)+1,2)+max(abs(y1-y2)+1,2))) ```
3
465
B
Inbox (100500)
PROGRAMMING
1,000
[ "implementation" ]
null
null
Over time, Alexey's mail box got littered with too many letters. Some of them are read, while others are unread. Alexey's mail program can either show a list of all letters or show the content of a single letter. As soon as the program shows the content of an unread letter, it becomes read letter (if the program shows the content of a read letter nothing happens). In one click he can do any of the following operations: - Move from the list of letters to the content of any single letter.- Return to the list of letters from single letter viewing mode.- In single letter viewing mode, move to the next or to the previous letter in the list. You cannot move from the first letter to the previous one or from the last letter to the next one. The program cannot delete the letters from the list or rearrange them. Alexey wants to read all the unread letters and go watch football. Now he is viewing the list of all letters and for each letter he can see if it is read or unread. What minimum number of operations does Alexey need to perform to read all unread letters?
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of letters in the mailbox. The second line contains *n* space-separated integers (zeros and ones) — the state of the letter list. The *i*-th number equals either 1, if the *i*-th number is unread, or 0, if the *i*-th letter is read.
Print a single number — the minimum number of operations needed to make all the letters read.
[ "5\n0 1 0 1 0\n", "5\n1 1 0 0 1\n", "2\n0 0\n" ]
[ "3\n", "4\n", "0\n" ]
In the first sample Alexey needs three operations to cope with the task: open the second letter, move to the third one, move to the fourth one. In the second sample the action plan: open the first letter, move to the second letter, return to the list, open the fifth letter. In the third sample all letters are already read.
1,000
[ { "input": "5\n0 1 0 1 0", "output": "3" }, { "input": "5\n1 1 0 0 1", "output": "4" }, { "input": "2\n0 0", "output": "0" }, { "input": "9\n1 0 1 0 1 0 1 0 1", "output": "9" }, { "input": "5\n1 1 1 1 1", "output": "5" }, { "input": "14\n0 0 1 1 1 0 1 1 1 0 1 1 1 0", "output": "11" }, { "input": "23\n1 1 1 0 1 1 0 1 1 0 1 1 1 0 1 1 0 1 1 0 1 1 1", "output": "23" }, { "input": "27\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0", "output": "25" }, { "input": "10\n1 0 0 0 0 1 0 0 0 1", "output": "5" }, { "input": "10\n1 0 0 1 0 0 1 1 0 1", "output": "8" }, { "input": "27\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "39\n1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1", "output": "39" }, { "input": "48\n1 0 1 0 1 0 1 0 0 1 0 1 0 0 1 0 1 0 0 1 0 1 0 1 0 0 1 0 1 0 0 1 0 0 1 0 0 1 0 1 0 1 0 0 1 0 0 1", "output": "39" }, { "input": "71\n0 0 0 0 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 0 0 0 0 0 0", "output": "59" }, { "input": "99\n1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1", "output": "99" }, { "input": "99\n1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1 0 1 1 1", "output": "99" }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "100" }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "99" }, { "input": "193\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "1" }, { "input": "213\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "5" }, { "input": "2\n1 0", "output": "1" }, { "input": "1\n1", "output": "1" }, { "input": "1\n0", "output": "0" }, { "input": "5\n0 0 0 0 1", "output": "1" }, { "input": "12\n0 1 1 0 1 1 0 1 1 0 0 0", "output": "8" }, { "input": "3\n1 0 0", "output": "1" }, { "input": "5\n0 0 1 0 0", "output": "1" }, { "input": "3\n0 1 0", "output": "1" }, { "input": "6\n1 1 0 0 0 0", "output": "2" }, { "input": "4\n0 1 0 0", "output": "1" }, { "input": "5\n1 1 1 0 0", "output": "3" }, { "input": "4\n1 0 0 0", "output": "1" }, { "input": "6\n1 1 1 1 0 0", "output": "4" } ]
1,679,455,237
2,147,483,647
Python 3
OK
TESTS
44
46
0
n = int(input()) data = input().split() #disregard starting zeroes: i = 0 while i < n and data[i] == '0': i+=1 #disregard trailing zeroes: j = n - 1 while j > 0 and data[j] == '0': j -=1 #count occurrences of groups of zeros: ones = 0 count = 0 while i <= j: if data[i] =='1': i +=1 ones += 1 else: zeros = 0 while i <= j and data[i] == '0': zeros += 1 i +=1 if zeros > 1: count += 1 else: ones += 1 print(count + ones)
Title: Inbox (100500) Time Limit: None seconds Memory Limit: None megabytes Problem Description: Over time, Alexey's mail box got littered with too many letters. Some of them are read, while others are unread. Alexey's mail program can either show a list of all letters or show the content of a single letter. As soon as the program shows the content of an unread letter, it becomes read letter (if the program shows the content of a read letter nothing happens). In one click he can do any of the following operations: - Move from the list of letters to the content of any single letter.- Return to the list of letters from single letter viewing mode.- In single letter viewing mode, move to the next or to the previous letter in the list. You cannot move from the first letter to the previous one or from the last letter to the next one. The program cannot delete the letters from the list or rearrange them. Alexey wants to read all the unread letters and go watch football. Now he is viewing the list of all letters and for each letter he can see if it is read or unread. What minimum number of operations does Alexey need to perform to read all unread letters? Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of letters in the mailbox. The second line contains *n* space-separated integers (zeros and ones) — the state of the letter list. The *i*-th number equals either 1, if the *i*-th number is unread, or 0, if the *i*-th letter is read. Output Specification: Print a single number — the minimum number of operations needed to make all the letters read. Demo Input: ['5\n0 1 0 1 0\n', '5\n1 1 0 0 1\n', '2\n0 0\n'] Demo Output: ['3\n', '4\n', '0\n'] Note: In the first sample Alexey needs three operations to cope with the task: open the second letter, move to the third one, move to the fourth one. In the second sample the action plan: open the first letter, move to the second letter, return to the list, open the fifth letter. In the third sample all letters are already read.
```python n = int(input()) data = input().split() #disregard starting zeroes: i = 0 while i < n and data[i] == '0': i+=1 #disregard trailing zeroes: j = n - 1 while j > 0 and data[j] == '0': j -=1 #count occurrences of groups of zeros: ones = 0 count = 0 while i <= j: if data[i] =='1': i +=1 ones += 1 else: zeros = 0 while i <= j and data[i] == '0': zeros += 1 i +=1 if zeros > 1: count += 1 else: ones += 1 print(count + ones) ```
3
610
A
Pasha and Stick
PROGRAMMING
1,000
[ "combinatorics", "math" ]
null
null
Pasha has a wooden stick of some positive integer length *n*. He wants to perform exactly three cuts to get four parts of the stick. Each part must have some positive integer length and the sum of these lengths will obviously be *n*. Pasha likes rectangles but hates squares, so he wonders, how many ways are there to split a stick into four parts so that it's possible to form a rectangle using these parts, but is impossible to form a square. Your task is to help Pasha and count the number of such ways. Two ways to cut the stick are considered distinct if there exists some integer *x*, such that the number of parts of length *x* in the first way differ from the number of parts of length *x* in the second way.
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=2·109) — the length of Pasha's stick.
The output should contain a single integer — the number of ways to split Pasha's stick into four parts of positive integer length so that it's possible to make a rectangle by connecting the ends of these parts, but is impossible to form a square.
[ "6\n", "20\n" ]
[ "1\n", "4\n" ]
There is only one way to divide the stick in the first sample {1, 1, 2, 2}. Four ways to divide the stick in the second sample are {1, 1, 9, 9}, {2, 2, 8, 8}, {3, 3, 7, 7} and {4, 4, 6, 6}. Note that {5, 5, 5, 5} doesn't work.
500
[ { "input": "6", "output": "1" }, { "input": "20", "output": "4" }, { "input": "1", "output": "0" }, { "input": "2", "output": "0" }, { "input": "3", "output": "0" }, { "input": "4", "output": "0" }, { "input": "2000000000", "output": "499999999" }, { "input": "1924704072", "output": "481176017" }, { "input": "73740586", "output": "18435146" }, { "input": "1925088820", "output": "481272204" }, { "input": "593070992", "output": "148267747" }, { "input": "1925473570", "output": "481368392" }, { "input": "629490186", "output": "157372546" }, { "input": "1980649112", "output": "495162277" }, { "input": "36661322", "output": "9165330" }, { "input": "1943590793", "output": "0" }, { "input": "71207034", "output": "17801758" }, { "input": "1757577394", "output": "439394348" }, { "input": "168305294", "output": "42076323" }, { "input": "1934896224", "output": "483724055" }, { "input": "297149088", "output": "74287271" }, { "input": "1898001634", "output": "474500408" }, { "input": "176409698", "output": "44102424" }, { "input": "1873025522", "output": "468256380" }, { "input": "5714762", "output": "1428690" }, { "input": "1829551192", "output": "457387797" }, { "input": "16269438", "output": "4067359" }, { "input": "1663283390", "output": "415820847" }, { "input": "42549941", "output": "0" }, { "input": "1967345604", "output": "491836400" }, { "input": "854000", "output": "213499" }, { "input": "1995886626", "output": "498971656" }, { "input": "10330019", "output": "0" }, { "input": "1996193634", "output": "499048408" }, { "input": "9605180", "output": "2401294" }, { "input": "1996459740", "output": "499114934" }, { "input": "32691948", "output": "8172986" }, { "input": "1975903308", "output": "493975826" }, { "input": "1976637136", "output": "494159283" }, { "input": "29803038", "output": "7450759" }, { "input": "1977979692", "output": "494494922" }, { "input": "1978595336", "output": "494648833" }, { "input": "27379344", "output": "6844835" }, { "input": "1979729912", "output": "494932477" }, { "input": "1980253780", "output": "495063444" }, { "input": "1980751584", "output": "495187895" }, { "input": "53224878", "output": "13306219" }, { "input": "5", "output": "0" }, { "input": "7", "output": "0" }, { "input": "8", "output": "1" }, { "input": "9", "output": "0" }, { "input": "10", "output": "2" }, { "input": "11", "output": "0" }, { "input": "12", "output": "2" }, { "input": "13", "output": "0" }, { "input": "14", "output": "3" }, { "input": "15", "output": "0" }, { "input": "16", "output": "3" }, { "input": "17", "output": "0" }, { "input": "18", "output": "4" }, { "input": "19", "output": "0" }, { "input": "21", "output": "0" }, { "input": "22", "output": "5" }, { "input": "23", "output": "0" }, { "input": "24", "output": "5" }, { "input": "25", "output": "0" }, { "input": "26", "output": "6" }, { "input": "27", "output": "0" }, { "input": "28", "output": "6" }, { "input": "29", "output": "0" }, { "input": "30", "output": "7" }, { "input": "111", "output": "0" }, { "input": "55", "output": "0" }, { "input": "105", "output": "0" }, { "input": "199", "output": "0" }, { "input": "151", "output": "0" } ]
1,665,842,568
2,147,483,647
Python 3
OK
TESTS
76
46
0
n = int(input()) print([((n//2)-1)//2,0][n%2==1])
Title: Pasha and Stick Time Limit: None seconds Memory Limit: None megabytes Problem Description: Pasha has a wooden stick of some positive integer length *n*. He wants to perform exactly three cuts to get four parts of the stick. Each part must have some positive integer length and the sum of these lengths will obviously be *n*. Pasha likes rectangles but hates squares, so he wonders, how many ways are there to split a stick into four parts so that it's possible to form a rectangle using these parts, but is impossible to form a square. Your task is to help Pasha and count the number of such ways. Two ways to cut the stick are considered distinct if there exists some integer *x*, such that the number of parts of length *x* in the first way differ from the number of parts of length *x* in the second way. Input Specification: The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=2·109) — the length of Pasha's stick. Output Specification: The output should contain a single integer — the number of ways to split Pasha's stick into four parts of positive integer length so that it's possible to make a rectangle by connecting the ends of these parts, but is impossible to form a square. Demo Input: ['6\n', '20\n'] Demo Output: ['1\n', '4\n'] Note: There is only one way to divide the stick in the first sample {1, 1, 2, 2}. Four ways to divide the stick in the second sample are {1, 1, 9, 9}, {2, 2, 8, 8}, {3, 3, 7, 7} and {4, 4, 6, 6}. Note that {5, 5, 5, 5} doesn't work.
```python n = int(input()) print([((n//2)-1)//2,0][n%2==1]) ```
3
734
A
Anton and Danik
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
Anton likes to play chess, and so does his friend Danik. Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie. Now Anton wonders, who won more games, he or Danik? Help him determine this.
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played. The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game.
If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output. If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output. If Anton and Danik won the same number of games, print "Friendship" (without quotes).
[ "6\nADAAAA\n", "7\nDDDAADA\n", "6\nDADADA\n" ]
[ "Anton\n", "Danik\n", "Friendship\n" ]
In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton". In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik". In the third sample, both Anton and Danik won 3 games and the answer is "Friendship".
500
[ { "input": "6\nADAAAA", "output": "Anton" }, { "input": "7\nDDDAADA", "output": "Danik" }, { "input": "6\nDADADA", "output": "Friendship" }, { "input": "10\nDDDDADDADD", "output": "Danik" }, { "input": "40\nAAAAAAAAADDAAAAAAAAAAADADDAAAAAAAAAAADAA", "output": "Anton" }, { "input": "200\nDDDDDDDADDDDDDAADADAADAAADAADADAAADDDADDDDDDADDDAADDDAADADDDDDADDDAAAADAAADDDDDAAADAADDDAAAADDADADDDAADDAADAAADAADAAAADDAADDADAAAADADDDAAAAAADDAADAADAADADDDAAADAAAADADDADAAAAAADADADDDADDDAADDADDDAAAAD", "output": "Friendship" }, { "input": "1\nA", "output": "Anton" }, { "input": "1\nD", "output": "Danik" }, { "input": "2\nDA", "output": "Friendship" }, { "input": "4\nDADA", "output": "Friendship" }, { "input": "4\nDAAD", "output": "Friendship" }, { "input": "3\nADD", "output": "Danik" }, { "input": "3\nDAD", "output": "Danik" }, { "input": "2\nDA", "output": "Friendship" }, { "input": "379\nAADAAAAAADDAAAAAADAADADADDAAAAADADDAADAAAADDDADAAAAAAADAADAAAAAAADAAAAAAAAADAAAAAAADAAAAAAAAAAADDDADAAAAAAAADAADADAAAADAAAAAAAAAAAAAAAAADAAAADDDAADAAAAAAADAAADAAADAADDDADDAAADAAAAAADDDADDDAAADAAAADAAAAAAAAADAAADAAAAAAAAADAAAAAAAAAAAAAAAAAADADAAAAAAAAAAADAAAAADAAAADAAAAAAAAAAAAADADAADAAAAAAAADAADAAAAAAAADAAAAAAAADDDAAAAAADAAADAAAAAADAADAAAAAADAAAADADAADAAAAAADAAAADAADDAADAADAAA", "output": "Anton" } ]
1,693,399,049
2,147,483,647
Python 3
OK
TESTS
25
46
921,600
n = int(input()) s = list(input()) d_c = s.count('D') d_a = s.count('A') if d_c > d_a: print('Danik') elif d_c < d_a: print('Anton') else: print('Friendship')
Title: Anton and Danik Time Limit: None seconds Memory Limit: None megabytes Problem Description: Anton likes to play chess, and so does his friend Danik. Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie. Now Anton wonders, who won more games, he or Danik? Help him determine this. Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played. The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game. Output Specification: If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output. If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output. If Anton and Danik won the same number of games, print "Friendship" (without quotes). Demo Input: ['6\nADAAAA\n', '7\nDDDAADA\n', '6\nDADADA\n'] Demo Output: ['Anton\n', 'Danik\n', 'Friendship\n'] Note: In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton". In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik". In the third sample, both Anton and Danik won 3 games and the answer is "Friendship".
```python n = int(input()) s = list(input()) d_c = s.count('D') d_a = s.count('A') if d_c > d_a: print('Danik') elif d_c < d_a: print('Anton') else: print('Friendship') ```
3
707
A
Brain's Photos
PROGRAMMING
800
[ "implementation" ]
null
null
Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead. As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such). Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour! As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white. Photo can be represented as a matrix sized *n*<=×<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors: - 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black) The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored.
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of photo pixel matrix rows and columns respectively. Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'.
Print the "#Black&amp;White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line.
[ "2 2\nC M\nY Y\n", "3 2\nW W\nW W\nB B\n", "1 1\nW\n" ]
[ "#Color", "#Black&amp;White", "#Black&amp;White" ]
none
500
[ { "input": "2 2\nC M\nY Y", "output": "#Color" }, { "input": "3 2\nW W\nW W\nB B", "output": "#Black&White" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "2 3\nW W W\nB G Y", "output": "#Color" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "5 5\nW G B Y M\nG B Y M C\nB Y M C W\nY M C W G\nM C W G B", "output": "#Color" }, { "input": "1 6\nC M Y W G B", "output": "#Color" }, { "input": "1 3\nW G B", "output": "#Black&White" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "5 5\nW G B W G\nG B W G B\nB W G B W\nW G B W G\nG B W G B", "output": "#Black&White" }, { "input": "2 3\nW W W\nB G C", "output": "#Color" }, { "input": "2 3\nW W W\nB G M", "output": "#Color" }, { "input": "3 3\nC B W\nB Y M\nB B W", "output": "#Color" }, { "input": "1 3\nW C W", "output": "#Color" }, { "input": "3 3\nB W B\nB C W\nB W W", "output": "#Color" }, { "input": "1 2\nW Y", "output": "#Color" }, { "input": "1 1\nG", "output": "#Black&White" }, { "input": "1 3\nB G W", "output": "#Black&White" }, { "input": "2 2\nW W\nB C", "output": "#Color" }, { "input": "1 1\nM", "output": "#Color" }, { "input": "1 2\nW C", "output": "#Color" }, { "input": "2 3\nW W M\nW W M", "output": "#Color" }, { "input": "3 2\nW W\nW W\nB C", "output": "#Color" }, { "input": "2 3\nW W C\nW W W", "output": "#Color" }, { "input": "1 3\nG G G", "output": "#Black&White" }, { "input": "1 1\nC", "output": "#Color" }, { "input": "1 2\nC W", "output": "#Color" }, { "input": "1 3\nW W C", "output": "#Color" }, { "input": "2 2\nW B\nB G", "output": "#Black&White" }, { "input": "2 2\nB B\nY Y", "output": "#Color" }, { "input": "2 2\nG G\nC C", "output": "#Color" }, { "input": "1 2\nB C", "output": "#Color" }, { "input": "1 4\nG G G C", "output": "#Color" }, { "input": "1 1\nB", "output": "#Black&White" }, { "input": "2 1\nY\nB", "output": "#Color" } ]
1,688,935,858
2,147,483,647
Python 3
OK
TESTS
50
46
0
color: bool = False for i in range(int(input()[0])): for c in input(): if (c != 'C' and c != 'M' and c != 'Y'): continue color = True break print("#Black&White") if not color else print("#Color")
Title: Brain's Photos Time Limit: None seconds Memory Limit: None megabytes Problem Description: Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead. As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such). Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour! As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white. Photo can be represented as a matrix sized *n*<=×<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors: - 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black) The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored. Input Specification: The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of photo pixel matrix rows and columns respectively. Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'. Output Specification: Print the "#Black&amp;White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line. Demo Input: ['2 2\nC M\nY Y\n', '3 2\nW W\nW W\nB B\n', '1 1\nW\n'] Demo Output: ['#Color', '#Black&amp;White', '#Black&amp;White'] Note: none
```python color: bool = False for i in range(int(input()[0])): for c in input(): if (c != 'C' and c != 'M' and c != 'Y'): continue color = True break print("#Black&White") if not color else print("#Color") ```
3
387
B
George and Round
PROGRAMMING
1,200
[ "brute force", "greedy", "two pointers" ]
null
null
George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*. To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities. George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=≥<=*d*), by changing limits on the input data. However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity.
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=3000) — the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1<=&lt;<=*a*2<=&lt;<=...<=&lt;<=*a**n*<=≤<=106) — the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b*1<=≤<=*b*2...<=≤<=*b**m*<=≤<=106) — the complexities of the problems prepared by George.
Print a single integer — the answer to the problem.
[ "3 5\n1 2 3\n1 2 2 3 3\n", "3 5\n1 2 3\n1 1 1 1 1\n", "3 1\n2 3 4\n1\n" ]
[ "0\n", "2\n", "3\n" ]
In the first sample the set of the prepared problems meets the requirements for a good round. In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round. In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2, 3, 4.
1,000
[ { "input": "3 5\n1 2 3\n1 2 2 3 3", "output": "0" }, { "input": "3 5\n1 2 3\n1 1 1 1 1", "output": "2" }, { "input": "3 1\n2 3 4\n1", "output": "3" }, { "input": "29 100\n20 32 41 67 72 155 331 382 399 412 465 470 484 511 515 529 616 637 679 715 733 763 826 843 862 903 925 979 989\n15 15 15 17 18 19 19 20 21 21 22 24 25 26 26 27 28 31 32 32 37 38 38 39 39 40 41 42 43 43 45 45 46 47 49 49 50 50 50 51 52 53 53 55 56 57 59 59 59 60 60 62 62 63 63 64 64 64 66 67 69 69 70 70 72 72 73 74 75 76 77 78 80 80 81 81 83 83 83 84 86 86 86 86 87 88 89 91 91 91 92 93 94 94 96 97 97 97 98 98", "output": "24" } ]
1,433,266,030
2,147,483,647
Python 3
OK
TESTS
41
62
614,400
n, m = map(int, input().split()) c = list(sorted(map(int, input().split()))) d = list(sorted(map(int, input().split()))) i, j = 0, 0 while i < n and j < m: if c[i] <= d[j]: i += 1 j += 1 print(n-i)
Title: George and Round Time Limit: None seconds Memory Limit: None megabytes Problem Description: George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*. To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities. George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=≥<=*d*), by changing limits on the input data. However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity. Input Specification: The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=3000) — the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1<=&lt;<=*a*2<=&lt;<=...<=&lt;<=*a**n*<=≤<=106) — the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b*1<=≤<=*b*2...<=≤<=*b**m*<=≤<=106) — the complexities of the problems prepared by George. Output Specification: Print a single integer — the answer to the problem. Demo Input: ['3 5\n1 2 3\n1 2 2 3 3\n', '3 5\n1 2 3\n1 1 1 1 1\n', '3 1\n2 3 4\n1\n'] Demo Output: ['0\n', '2\n', '3\n'] Note: In the first sample the set of the prepared problems meets the requirements for a good round. In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round. In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2, 3, 4.
```python n, m = map(int, input().split()) c = list(sorted(map(int, input().split()))) d = list(sorted(map(int, input().split()))) i, j = 0, 0 while i < n and j < m: if c[i] <= d[j]: i += 1 j += 1 print(n-i) ```
3
270
A
Fancy Fence
PROGRAMMING
1,100
[ "geometry", "implementation", "math" ]
null
null
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot. He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*. Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
The first line of input contains an integer *t* (0<=&lt;<=*t*<=&lt;<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=&lt;<=*a*<=&lt;<=180) — the angle the robot can make corners at measured in degrees.
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
[ "3\n30\n60\n90\n" ]
[ "NO\nYES\nYES\n" ]
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the second test case, the fence is a regular triangle, and in the last test case — a square.
500
[ { "input": "3\n30\n60\n90", "output": "NO\nYES\nYES" }, { "input": "6\n1\n2\n3\n170\n179\n25", "output": "NO\nNO\nNO\nYES\nYES\nNO" } ]
1,666,080,044
2,147,483,647
Python 3
OK
TESTS
3
62
0
# -*- coding: utf-8 -*- """ Created on Tue Oct 18 16:00:10 2022 @author: hp """ t = int(input()) for i in range(t): x = int(input()) if 360 % (180 - x) == 0: print('YES') else: print('NO')
Title: Fancy Fence Time Limit: None seconds Memory Limit: None megabytes Problem Description: Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot. He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*. Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*? Input Specification: The first line of input contains an integer *t* (0<=&lt;<=*t*<=&lt;<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=&lt;<=*a*<=&lt;<=180) — the angle the robot can make corners at measured in degrees. Output Specification: For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible. Demo Input: ['3\n30\n60\n90\n'] Demo Output: ['NO\nYES\nYES\n'] Note: In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the second test case, the fence is a regular triangle, and in the last test case — a square.
```python # -*- coding: utf-8 -*- """ Created on Tue Oct 18 16:00:10 2022 @author: hp """ t = int(input()) for i in range(t): x = int(input()) if 360 % (180 - x) == 0: print('YES') else: print('NO') ```
3
994
A
Fingerprints
PROGRAMMING
800
[ "implementation" ]
null
null
You are locked in a room with a door that has a keypad with 10 keys corresponding to digits from 0 to 9. To escape from the room, you need to enter a correct code. You also have a sequence of digits. Some keys on the keypad have fingerprints. You believe the correct code is the longest not necessarily contiguous subsequence of the sequence you have that only contains digits with fingerprints on the corresponding keys. Find such code.
The first line contains two integers $n$ and $m$ ($1 \le n, m \le 10$) representing the number of digits in the sequence you have and the number of keys on the keypad that have fingerprints. The next line contains $n$ distinct space-separated integers $x_1, x_2, \ldots, x_n$ ($0 \le x_i \le 9$) representing the sequence. The next line contains $m$ distinct space-separated integers $y_1, y_2, \ldots, y_m$ ($0 \le y_i \le 9$) — the keys with fingerprints.
In a single line print a space-separated sequence of integers representing the code. If the resulting sequence is empty, both printing nothing and printing a single line break is acceptable.
[ "7 3\n3 5 7 1 6 2 8\n1 2 7\n", "4 4\n3 4 1 0\n0 1 7 9\n" ]
[ "7 1 2\n", "1 0\n" ]
In the first example, the only digits with fingerprints are $1$, $2$ and $7$. All three of them appear in the sequence you know, $7$ first, then $1$ and then $2$. Therefore the output is 7 1 2. Note that the order is important, and shall be the same as the order in the original sequence. In the second example digits $0$, $1$, $7$ and $9$ have fingerprints, however only $0$ and $1$ appear in the original sequence. $1$ appears earlier, so the output is 1 0. Again, the order is important.
500
[ { "input": "7 3\n3 5 7 1 6 2 8\n1 2 7", "output": "7 1 2" }, { "input": "4 4\n3 4 1 0\n0 1 7 9", "output": "1 0" }, { "input": "9 4\n9 8 7 6 5 4 3 2 1\n2 4 6 8", "output": "8 6 4 2" }, { "input": "10 5\n3 7 1 2 4 6 9 0 5 8\n4 3 0 7 9", "output": "3 7 4 9 0" }, { "input": "10 10\n1 2 3 4 5 6 7 8 9 0\n4 5 6 7 1 2 3 0 9 8", "output": "1 2 3 4 5 6 7 8 9 0" }, { "input": "1 1\n4\n4", "output": "4" }, { "input": "3 7\n6 3 4\n4 9 0 1 7 8 6", "output": "6 4" }, { "input": "10 1\n9 0 8 1 7 4 6 5 2 3\n0", "output": "0" }, { "input": "5 10\n6 0 3 8 1\n3 1 0 5 4 7 2 8 9 6", "output": "6 0 3 8 1" }, { "input": "8 2\n7 2 9 6 1 0 3 4\n6 3", "output": "6 3" }, { "input": "5 4\n7 0 1 4 9\n0 9 5 3", "output": "0 9" }, { "input": "10 1\n9 6 2 0 1 8 3 4 7 5\n6", "output": "6" }, { "input": "10 2\n7 1 0 2 4 6 5 9 3 8\n3 2", "output": "2 3" }, { "input": "5 9\n3 7 9 2 4\n3 8 4 5 9 6 1 0 2", "output": "3 9 2 4" }, { "input": "10 6\n7 1 2 3 8 0 6 4 5 9\n1 5 8 2 3 6", "output": "1 2 3 8 6 5" }, { "input": "8 2\n7 4 8 9 2 5 6 1\n6 4", "output": "4 6" }, { "input": "10 2\n1 0 3 5 8 9 4 7 6 2\n0 3", "output": "0 3" }, { "input": "7 6\n9 2 8 6 1 3 7\n4 2 0 3 1 8", "output": "2 8 1 3" }, { "input": "1 6\n3\n6 8 2 4 5 3", "output": "3" }, { "input": "1 8\n0\n9 2 4 8 1 5 0 7", "output": "0" }, { "input": "6 9\n7 3 9 4 1 0\n9 1 5 8 0 6 2 7 4", "output": "7 9 4 1 0" }, { "input": "10 2\n4 9 6 8 3 0 1 5 7 2\n0 1", "output": "0 1" }, { "input": "10 5\n5 2 8 0 9 7 6 1 4 3\n9 6 4 1 2", "output": "2 9 6 1 4" }, { "input": "6 3\n8 3 9 2 7 6\n5 4 3", "output": "3" }, { "input": "4 10\n8 3 9 6\n4 9 6 2 7 0 8 1 3 5", "output": "8 3 9 6" }, { "input": "1 2\n1\n1 0", "output": "1" }, { "input": "3 6\n1 2 3\n4 5 6 1 2 3", "output": "1 2 3" }, { "input": "1 2\n2\n1 2", "output": "2" }, { "input": "1 10\n9\n0 1 2 3 4 5 6 7 8 9", "output": "9" } ]
1,579,175,598
2,147,483,647
PyPy 3
OK
TESTS
31
156
0
import sys import math import bisect def main(): n, m = map(int, input().split()) A = list(map(int, input().split())) B = list(map(int, input().split())) C = [] for a in A: if a in B: C.append(a) print(' '.join(list(str(a) for a in C))) if __name__ == "__main__": main()
Title: Fingerprints Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are locked in a room with a door that has a keypad with 10 keys corresponding to digits from 0 to 9. To escape from the room, you need to enter a correct code. You also have a sequence of digits. Some keys on the keypad have fingerprints. You believe the correct code is the longest not necessarily contiguous subsequence of the sequence you have that only contains digits with fingerprints on the corresponding keys. Find such code. Input Specification: The first line contains two integers $n$ and $m$ ($1 \le n, m \le 10$) representing the number of digits in the sequence you have and the number of keys on the keypad that have fingerprints. The next line contains $n$ distinct space-separated integers $x_1, x_2, \ldots, x_n$ ($0 \le x_i \le 9$) representing the sequence. The next line contains $m$ distinct space-separated integers $y_1, y_2, \ldots, y_m$ ($0 \le y_i \le 9$) — the keys with fingerprints. Output Specification: In a single line print a space-separated sequence of integers representing the code. If the resulting sequence is empty, both printing nothing and printing a single line break is acceptable. Demo Input: ['7 3\n3 5 7 1 6 2 8\n1 2 7\n', '4 4\n3 4 1 0\n0 1 7 9\n'] Demo Output: ['7 1 2\n', '1 0\n'] Note: In the first example, the only digits with fingerprints are $1$, $2$ and $7$. All three of them appear in the sequence you know, $7$ first, then $1$ and then $2$. Therefore the output is 7 1 2. Note that the order is important, and shall be the same as the order in the original sequence. In the second example digits $0$, $1$, $7$ and $9$ have fingerprints, however only $0$ and $1$ appear in the original sequence. $1$ appears earlier, so the output is 1 0. Again, the order is important.
```python import sys import math import bisect def main(): n, m = map(int, input().split()) A = list(map(int, input().split())) B = list(map(int, input().split())) C = [] for a in A: if a in B: C.append(a) print(' '.join(list(str(a) for a in C))) if __name__ == "__main__": main() ```
3
556
A
Case of the Zeros and Ones
PROGRAMMING
900
[ "greedy" ]
null
null
Andrewid the Android is a galaxy-famous detective. In his free time he likes to think about strings containing zeros and ones. Once he thought about a string of length *n* consisting of zeroes and ones. Consider the following operation: we choose any two adjacent positions in the string, and if one them contains 0, and the other contains 1, then we are allowed to remove these two digits from the string, obtaining a string of length *n*<=-<=2 as a result. Now Andreid thinks about what is the minimum length of the string that can remain after applying the described operation several times (possibly, zero)? Help him to calculate this number.
First line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=2·105), the length of the string that Andreid has. The second line contains the string of length *n* consisting only from zeros and ones.
Output the minimum length of the string that may remain after applying the described operations several times.
[ "4\n1100\n", "5\n01010\n", "8\n11101111\n" ]
[ "0\n", "1\n", "6\n" ]
In the first sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/10df55364c21c6e8d5da31b6ab6f6294c4fc26b3.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the second sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/19ec5dcd85f0b5cf757aa076ace72df39634de2d.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the third sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/dc34a159e4230375fa325555527ebc748811f188.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
250
[ { "input": "4\n1100", "output": "0" }, { "input": "5\n01010", "output": "1" }, { "input": "8\n11101111", "output": "6" }, { "input": "1\n0", "output": "1" }, { "input": "1\n1", "output": "1" }, { "input": "2\n00", "output": "2" }, { "input": "2\n01", "output": "0" }, { "input": "2\n10", "output": "0" }, { "input": "2\n11", "output": "2" }, { "input": "3\n001", "output": "1" }, { "input": "6\n110110", "output": "2" }, { "input": "7\n0000011", "output": "3" }, { "input": "6\n110010", "output": "0" }, { "input": "6\n110100", "output": "0" }, { "input": "3\n100", "output": "1" }, { "input": "6\n010111", "output": "2" }, { "input": "8\n01011100", "output": "0" }, { "input": "6\n001011", "output": "0" }, { "input": "7\n1110000", "output": "1" }, { "input": "9\n011111101", "output": "5" } ]
1,671,043,504
2,147,483,647
Python 3
OK
TESTS
49
78
409,600
n = int (input ()) a = input () one = 0 ; ze = 0 for i in range (len(a)): if a [i] == "1": one += 1 else : ze += 1 print (abs (one-ze))
Title: Case of the Zeros and Ones Time Limit: None seconds Memory Limit: None megabytes Problem Description: Andrewid the Android is a galaxy-famous detective. In his free time he likes to think about strings containing zeros and ones. Once he thought about a string of length *n* consisting of zeroes and ones. Consider the following operation: we choose any two adjacent positions in the string, and if one them contains 0, and the other contains 1, then we are allowed to remove these two digits from the string, obtaining a string of length *n*<=-<=2 as a result. Now Andreid thinks about what is the minimum length of the string that can remain after applying the described operation several times (possibly, zero)? Help him to calculate this number. Input Specification: First line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=2·105), the length of the string that Andreid has. The second line contains the string of length *n* consisting only from zeros and ones. Output Specification: Output the minimum length of the string that may remain after applying the described operations several times. Demo Input: ['4\n1100\n', '5\n01010\n', '8\n11101111\n'] Demo Output: ['0\n', '1\n', '6\n'] Note: In the first sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/10df55364c21c6e8d5da31b6ab6f6294c4fc26b3.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the second sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/19ec5dcd85f0b5cf757aa076ace72df39634de2d.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the third sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/dc34a159e4230375fa325555527ebc748811f188.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
```python n = int (input ()) a = input () one = 0 ; ze = 0 for i in range (len(a)): if a [i] == "1": one += 1 else : ze += 1 print (abs (one-ze)) ```
3
841
A
Generous Kefa
PROGRAMMING
900
[ "brute force", "implementation" ]
null
null
One day Kefa found *n* baloons. For convenience, we denote color of *i*-th baloon as *s**i* — lowercase letter of the Latin alphabet. Also Kefa has *k* friends. Friend will be upset, If he get two baloons of the same color. Kefa want to give out all baloons to his friends. Help Kefa to find out, can he give out all his baloons, such that no one of his friens will be upset — print «YES», if he can, and «NO», otherwise. Note, that Kefa's friend will not upset, if he doesn't get baloons at all.
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100) — the number of baloons and friends. Next line contains string *s* — colors of baloons.
Answer to the task — «YES» or «NO» in a single line. You can choose the case (lower or upper) for each letter arbitrary.
[ "4 2\naabb\n", "6 3\naacaab\n" ]
[ "YES\n", "NO\n" ]
In the first sample Kefa can give 1-st and 3-rd baloon to the first friend, and 2-nd and 4-th to the second. In the second sample Kefa needs to give to all his friends baloons of color a, but one baloon will stay, thats why answer is «NO».
500
[ { "input": "4 2\naabb", "output": "YES" }, { "input": "6 3\naacaab", "output": "NO" }, { "input": "2 2\nlu", "output": "YES" }, { "input": "5 3\novvoo", "output": "YES" }, { "input": "36 13\nbzbzcffczzcbcbzzfzbbfzfzzbfbbcbfccbf", "output": "YES" }, { "input": "81 3\nooycgmvvrophvcvpoupepqllqttwcocuilvyxbyumdmmfapvpnxhjhxfuagpnntonibicaqjvwfhwxhbv", "output": "NO" }, { "input": "100 100\nxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx", "output": "YES" }, { "input": "100 1\nnubcvvjvbjgnjsdkajimdcxvewbcytvfkihunycdrlconddlwgzjasjlsrttlrzsumzpyumpveglfqzmaofbshbojmwuwoxxvrod", "output": "NO" }, { "input": "100 13\nvyldolgryldqrvoldvzvrdrgorlorszddtgqvrlisxxrxdxlqtvtgsrqlzixoyrozxzogqxlsgzdddzqrgitxxritoolzolgrtvl", "output": "YES" }, { "input": "18 6\njzwtnkvmscqhmdlsxy", "output": "YES" }, { "input": "21 2\nfscegcqgzesefghhwcexs", "output": "NO" }, { "input": "32 22\ncduamsptaklqtxlyoutlzepxgyfkvngc", "output": "YES" }, { "input": "49 27\noxyorfnkzwsfllnyvdhdanppuzrnbxehugvmlkgeymqjlmfxd", "output": "YES" }, { "input": "50 24\nxxutzjwbggcwvxztttkmzovtmuwttzcbwoztttohzzxghuuthv", "output": "YES" }, { "input": "57 35\nglxshztrqqfyxthqamagvtmrdparhelnzrqvcwqxjytkbuitovkdxueul", "output": "YES" }, { "input": "75 23\nittttiiuitutuiiuuututiuttiuiuutuuuiuiuuuuttuuttuutuiiuiuiiuiitttuututuiuuii", "output": "NO" }, { "input": "81 66\nfeqevfqfebhvubhuuvfuqheuqhbeeuebehuvhffvbqvqvfbqqvvhevqffbqqhvvqhfeehuhqeqhueuqqq", "output": "YES" }, { "input": "93 42\npqeiafraiavfcteumflpcbpozcomlvpovlzdbldvoopnhdoeqaopzthiuzbzmeieiatthdeqovaqfipqlddllmfcrrnhb", "output": "YES" }, { "input": "100 53\nizszyqyndzwzyzgsdagdwdazadiawizinagqqgczaqqnawgijziziawzszdjdcqjdjqiwgadydcnqisaayjiqqsscwwzjzaycwwc", "output": "YES" }, { "input": "100 14\nvkrdcqbvkwuckpmnbydmczdxoagdsgtqxvhaxntdcxhjcrjyvukhugoglbmyoaqexgtcfdgemmizoniwtmisqqwcwfusmygollab", "output": "YES" }, { "input": "100 42\naaaaaiiiiaiiiaaiaiiaaiiiiiaaaaaiaiiiaiiiiaiiiaaaaaiiiaaaiiaaiiiaiiiaiaaaiaiiiiaaiiiaiiaiaiiaiiiaaaia", "output": "NO" }, { "input": "100 89\ntjbkmydejporbqhcbztkcumxjjgsrvxpuulbhzeeckkbchpbxwhedrlhjsabcexcohgdzouvsgphjdthpuqrlkgzxvqbuhqxdsmf", "output": "YES" }, { "input": "100 100\njhpyiuuzizhubhhpxbbhpyxzhbpjphzppuhiahihiappbhuypyauhizpbibzixjbzxzpbphuiaypyujappuxiyuyaajaxjupbahb", "output": "YES" }, { "input": "100 3\nsszoovvzysavsvzsozzvoozvysozsaszayaszasaysszzzysosyayyvzozovavzoyavsooaoyvoozvvozsaosvayyovazzszzssa", "output": "NO" }, { "input": "100 44\ndluthkxwnorabqsukgnxnvhmsmzilyulpursnxkdsavgemiuizbyzebhyjejgqrvuckhaqtuvdmpziesmpmewpvozdanjyvwcdgo", "output": "YES" }, { "input": "100 90\ntljonbnwnqounictqqctgonktiqoqlocgoblngijqokuquoolciqwnctgoggcbojtwjlculoikbggquqncittwnjbkgkgubnioib", "output": "YES" }, { "input": "100 79\nykxptzgvbqxlregvkvucewtydvnhqhuggdsyqlvcfiuaiddnrrnstityyehiamrggftsqyduwxpuldztyzgmfkehprrneyvtknmf", "output": "YES" }, { "input": "100 79\naagwekyovbviiqeuakbqbqifwavkfkutoriovgfmittulhwojaptacekdirgqoovlleeoqkkdukpadygfwavppohgdrmymmulgci", "output": "YES" }, { "input": "100 93\nearrehrehenaddhdnrdddhdahnadndheeennrearrhraharddreaeraddhehhhrdnredanndneheddrraaneerreedhnadnerhdn", "output": "YES" }, { "input": "100 48\nbmmaebaebmmmbbmxvmammbvvebvaemvbbaxvbvmaxvvmveaxmbbxaaemxmxvxxxvxbmmxaaaevvaxmvamvvmaxaxavexbmmbmmev", "output": "YES" }, { "input": "100 55\nhsavbkehaaesffaeeffakhkhfehbbvbeasahbbbvkesbfvkefeesesevbsvfkbffakvshsbkahfkfakebsvafkbvsskfhfvaasss", "output": "YES" }, { "input": "100 2\ncscffcffsccffsfsfffccssfsscfsfsssffcffsscfccssfffcfscfsscsccccfsssffffcfcfsfffcsfsccffscffcfccccfffs", "output": "NO" }, { "input": "100 3\nzrgznxgdpgfoiifrrrsjfuhvtqxjlgochhyemismjnanfvvpzzvsgajcbsulxyeoepjfwvhkqogiiwqxjkrpsyaqdlwffoockxnc", "output": "NO" }, { "input": "100 5\njbltyyfjakrjeodqepxpkjideulofbhqzxjwlarufwzwsoxhaexpydpqjvhybmvjvntuvhvflokhshpicbnfgsqsmrkrfzcrswwi", "output": "NO" }, { "input": "100 1\nfnslnqktlbmxqpvcvnemxcutebdwepoxikifkzaaixzzydffpdxodmsxjribmxuqhueifdlwzytxkklwhljswqvlejedyrgguvah", "output": "NO" }, { "input": "100 21\nddjenetwgwmdtjbpzssyoqrtirvoygkjlqhhdcjgeurqpunxpupwaepcqkbjjfhnvgpyqnozhhrmhfwararmlcvpgtnopvjqsrka", "output": "YES" }, { "input": "100 100\nnjrhiauqlgkkpkuvciwzivjbbplipvhslqgdkfnmqrxuxnycmpheenmnrglotzuyxycosfediqcuadklsnzjqzfxnbjwvfljnlvq", "output": "YES" }, { "input": "100 100\nbbbbbbbtbbttbtbbbttbttbtbbttttbbbtbttbbbtbttbtbbttttbbbbbtbbttbtbbtbttbbbtbtbtbtbtbtbbbttbbtbtbtbbtb", "output": "YES" }, { "input": "14 5\nfssmmsfffmfmmm", "output": "NO" }, { "input": "2 1\nff", "output": "NO" }, { "input": "2 1\nhw", "output": "YES" }, { "input": "2 2\nss", "output": "YES" }, { "input": "1 1\nl", "output": "YES" }, { "input": "100 50\nfffffttttttjjjuuuvvvvvdddxxxxwwwwgggbsssncccczzyyyyyhhhhhkrreeeeeeaaaaaiiillllllllooooqqqqqqmmpppppp", "output": "YES" }, { "input": "100 50\nbbbbbbbbgggggggggggaaaaaaaahhhhhhhhhhpppppppppsssssssrrrrrrrrllzzzzzzzeeeeeeekkkkkkkwwwwwwwwjjjjjjjj", "output": "YES" }, { "input": "100 50\nwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxxxxzzzzzzzzzzzzzzzzzzbbbbbbbbbbbbbbbbbbbbjjjjjjjjjjjjjjjjjjjjjjjj", "output": "YES" }, { "input": "100 80\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm", "output": "YES" }, { "input": "100 10\nbbttthhhhiiiiiiijjjjjvvvvpppssssseeeeeeewwwwgggkkkkkkkkmmmddddduuuzzzzllllnnnnnxxyyyffffccraaaaooooq", "output": "YES" }, { "input": "100 20\nssssssssssbbbbbbbhhhhhhhyyyyyyyzzzzzzzzzzzzcccccxxxxxxxxxxddddmmmmmmmeeeeeeejjjjjjjjjwwwwwwwtttttttt", "output": "YES" }, { "input": "1 2\na", "output": "YES" }, { "input": "3 1\nabb", "output": "NO" }, { "input": "2 1\naa", "output": "NO" }, { "input": "2 1\nab", "output": "YES" }, { "input": "6 2\naaaaaa", "output": "NO" }, { "input": "8 4\naaaaaaaa", "output": "NO" }, { "input": "4 2\naaaa", "output": "NO" }, { "input": "4 3\naaaa", "output": "NO" }, { "input": "1 3\na", "output": "YES" }, { "input": "4 3\nzzzz", "output": "NO" }, { "input": "4 1\naaaa", "output": "NO" }, { "input": "3 4\nabc", "output": "YES" }, { "input": "2 5\nab", "output": "YES" }, { "input": "2 4\nab", "output": "YES" }, { "input": "1 10\na", "output": "YES" }, { "input": "5 2\nzzzzz", "output": "NO" }, { "input": "53 26\naaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbbbbbbb", "output": "NO" }, { "input": "4 1\nabab", "output": "NO" }, { "input": "4 1\nabcb", "output": "NO" }, { "input": "4 2\nabbb", "output": "NO" }, { "input": "5 2\nabccc", "output": "NO" }, { "input": "2 3\nab", "output": "YES" }, { "input": "4 3\nbbbs", "output": "YES" }, { "input": "10 2\nazzzzzzzzz", "output": "NO" }, { "input": "1 2\nb", "output": "YES" }, { "input": "1 3\nb", "output": "YES" }, { "input": "4 5\nabcd", "output": "YES" }, { "input": "4 6\naabb", "output": "YES" }, { "input": "5 2\naaaab", "output": "NO" }, { "input": "3 5\naaa", "output": "YES" }, { "input": "5 3\nazzzz", "output": "NO" }, { "input": "4 100\naabb", "output": "YES" }, { "input": "3 10\naaa", "output": "YES" }, { "input": "3 4\naaa", "output": "YES" }, { "input": "12 5\naaaaabbbbbbb", "output": "NO" }, { "input": "5 2\naabbb", "output": "NO" }, { "input": "10 5\nzzzzzzzzzz", "output": "NO" }, { "input": "2 4\naa", "output": "YES" }, { "input": "1 5\na", "output": "YES" }, { "input": "10 5\naaaaaaaaaa", "output": "NO" }, { "input": "6 3\naaaaaa", "output": "NO" }, { "input": "7 1\nabcdeee", "output": "NO" }, { "input": "18 3\naaaaaabbbbbbcccccc", "output": "NO" }, { "input": "8 2\naabbccdd", "output": "YES" }, { "input": "4 2\nzzzz", "output": "NO" }, { "input": "4 2\nabaa", "output": "NO" }, { "input": "3 2\naaa", "output": "NO" }, { "input": "3 1\nzzz", "output": "NO" }, { "input": "5 4\nzzzzz", "output": "NO" }, { "input": "6 2\naabbbc", "output": "NO" }, { "input": "3 6\naaa", "output": "YES" }, { "input": "2 1\nzz", "output": "NO" }, { "input": "10 3\naaaeeeeeee", "output": "NO" }, { "input": "4 5\naabb", "output": "YES" }, { "input": "3 1\naaa", "output": "NO" }, { "input": "5 2\naazzz", "output": "NO" }, { "input": "6 2\nabbbbc", "output": "NO" }, { "input": "4 2\nxxxx", "output": "NO" }, { "input": "6 3\nzzzzzz", "output": "NO" }, { "input": "3 2\nabb", "output": "YES" }, { "input": "3 2\nzzz", "output": "NO" }, { "input": "6 5\nzzzzzz", "output": "NO" }, { "input": "6 3\nbcaaaa", "output": "NO" }, { "input": "100 100\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "YES" }, { "input": "3 6\nabc", "output": "YES" } ]
1,587,373,668
2,147,483,647
PyPy 3
OK
TESTS
114
171
0
n, k = [ int(i) for i in input().strip().split(' ')] f = [ 0 for i in range(26)] s = input().strip() for i in s: f[ord(i)-ord('a')] = f[ord(i)-ord('a')] + 1 if max(f)>k: print('NO') else: print('YES')
Title: Generous Kefa Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Kefa found *n* baloons. For convenience, we denote color of *i*-th baloon as *s**i* — lowercase letter of the Latin alphabet. Also Kefa has *k* friends. Friend will be upset, If he get two baloons of the same color. Kefa want to give out all baloons to his friends. Help Kefa to find out, can he give out all his baloons, such that no one of his friens will be upset — print «YES», if he can, and «NO», otherwise. Note, that Kefa's friend will not upset, if he doesn't get baloons at all. Input Specification: The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100) — the number of baloons and friends. Next line contains string *s* — colors of baloons. Output Specification: Answer to the task — «YES» or «NO» in a single line. You can choose the case (lower or upper) for each letter arbitrary. Demo Input: ['4 2\naabb\n', '6 3\naacaab\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample Kefa can give 1-st and 3-rd baloon to the first friend, and 2-nd and 4-th to the second. In the second sample Kefa needs to give to all his friends baloons of color a, but one baloon will stay, thats why answer is «NO».
```python n, k = [ int(i) for i in input().strip().split(' ')] f = [ 0 for i in range(26)] s = input().strip() for i in s: f[ord(i)-ord('a')] = f[ord(i)-ord('a')] + 1 if max(f)>k: print('NO') else: print('YES') ```
3
268
A
Games
PROGRAMMING
800
[ "brute force" ]
null
null
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
In a single line print the number of games where the host team is going to play in the guest uniform.
[ "3\n1 2\n2 4\n3 4\n", "4\n100 42\n42 100\n5 42\n100 5\n", "2\n1 2\n1 2\n" ]
[ "1\n", "5\n", "0\n" ]
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
500
[ { "input": "3\n1 2\n2 4\n3 4", "output": "1" }, { "input": "4\n100 42\n42 100\n5 42\n100 5", "output": "5" }, { "input": "2\n1 2\n1 2", "output": "0" }, { "input": "7\n4 7\n52 55\n16 4\n55 4\n20 99\n3 4\n7 52", "output": "6" }, { "input": "10\n68 42\n1 35\n25 70\n59 79\n65 63\n46 6\n28 82\n92 62\n43 96\n37 28", "output": "1" }, { "input": "30\n10 39\n89 1\n78 58\n75 99\n36 13\n77 50\n6 97\n79 28\n27 52\n56 5\n93 96\n40 21\n33 74\n26 37\n53 59\n98 56\n61 65\n42 57\n9 7\n25 63\n74 34\n96 84\n95 47\n12 23\n34 21\n71 6\n27 13\n15 47\n64 14\n12 77", "output": "6" }, { "input": "30\n46 100\n87 53\n34 84\n44 66\n23 20\n50 34\n90 66\n17 39\n13 22\n94 33\n92 46\n63 78\n26 48\n44 61\n3 19\n41 84\n62 31\n65 89\n23 28\n58 57\n19 85\n26 60\n75 66\n69 67\n76 15\n64 15\n36 72\n90 89\n42 69\n45 35", "output": "4" }, { "input": "2\n46 6\n6 46", "output": "2" }, { "input": "29\n8 18\n33 75\n69 22\n97 95\n1 97\n78 10\n88 18\n13 3\n19 64\n98 12\n79 92\n41 72\n69 15\n98 31\n57 74\n15 56\n36 37\n15 66\n63 100\n16 42\n47 56\n6 4\n73 15\n30 24\n27 71\n12 19\n88 69\n85 6\n50 11", "output": "10" }, { "input": "23\n43 78\n31 28\n58 80\n66 63\n20 4\n51 95\n40 20\n50 14\n5 34\n36 39\n77 42\n64 97\n62 89\n16 56\n8 34\n58 16\n37 35\n37 66\n8 54\n50 36\n24 8\n68 48\n85 33", "output": "6" }, { "input": "13\n76 58\n32 85\n99 79\n23 58\n96 59\n72 35\n53 43\n96 55\n41 78\n75 10\n28 11\n72 7\n52 73", "output": "0" }, { "input": "18\n6 90\n70 79\n26 52\n67 81\n29 95\n41 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 2", "output": "1" }, { "input": "18\n6 90\n100 79\n26 100\n67 100\n29 100\n100 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 100", "output": "8" }, { "input": "30\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "450" }, { "input": "30\n100 99\n58 59\n56 57\n54 55\n52 53\n50 51\n48 49\n46 47\n44 45\n42 43\n40 41\n38 39\n36 37\n34 35\n32 33\n30 31\n28 29\n26 27\n24 25\n22 23\n20 21\n18 19\n16 17\n14 15\n12 13\n10 11\n8 9\n6 7\n4 5\n2 3", "output": "0" }, { "input": "15\n9 3\n2 6\n7 6\n5 10\n9 5\n8 1\n10 5\n2 8\n4 5\n9 8\n5 3\n3 8\n9 8\n4 10\n8 5", "output": "20" }, { "input": "15\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n1 2", "output": "108" }, { "input": "25\n2 1\n1 2\n1 2\n1 2\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n1 2\n2 1\n2 1\n2 1\n2 1\n1 2", "output": "312" }, { "input": "25\n91 57\n2 73\n54 57\n2 57\n23 57\n2 6\n57 54\n57 23\n91 54\n91 23\n57 23\n91 57\n54 2\n6 91\n57 54\n2 57\n57 91\n73 91\n57 23\n91 57\n2 73\n91 2\n23 6\n2 73\n23 6", "output": "96" }, { "input": "28\n31 66\n31 91\n91 31\n97 66\n31 66\n31 66\n66 91\n91 31\n97 31\n91 97\n97 31\n66 31\n66 97\n91 31\n31 66\n31 66\n66 31\n31 97\n66 97\n97 31\n31 91\n66 91\n91 66\n31 66\n91 66\n66 31\n66 31\n91 97", "output": "210" }, { "input": "29\n78 27\n50 68\n24 26\n68 43\n38 78\n26 38\n78 28\n28 26\n27 24\n23 38\n24 26\n24 43\n61 50\n38 78\n27 23\n61 26\n27 28\n43 23\n28 78\n43 27\n43 78\n27 61\n28 38\n61 78\n50 26\n43 27\n26 78\n28 50\n43 78", "output": "73" }, { "input": "29\n80 27\n69 80\n27 80\n69 80\n80 27\n80 27\n80 27\n80 69\n27 69\n80 69\n80 27\n27 69\n69 27\n80 69\n27 69\n69 80\n27 69\n80 69\n80 27\n69 27\n27 69\n27 80\n80 27\n69 80\n27 69\n80 69\n69 80\n69 80\n27 80", "output": "277" }, { "input": "30\n19 71\n7 89\n89 71\n21 7\n19 21\n7 89\n19 71\n89 8\n89 21\n19 8\n21 7\n8 89\n19 89\n7 21\n19 8\n19 7\n7 19\n8 21\n71 21\n71 89\n7 19\n7 19\n21 7\n21 19\n21 19\n71 8\n21 8\n71 19\n19 71\n8 21", "output": "154" }, { "input": "30\n44 17\n44 17\n44 17\n17 44\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n44 17\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n17 44\n44 17\n44 17\n44 17\n17 44\n17 44\n44 17\n17 44\n44 17\n44 17\n44 17", "output": "418" }, { "input": "22\n78 92\n15 92\n92 78\n78 80\n92 16\n24 80\n92 16\n16 92\n78 16\n24 78\n80 78\n92 80\n16 80\n80 78\n15 78\n92 16\n24 15\n24 80\n80 16\n16 80\n92 80\n24 80", "output": "74" }, { "input": "24\n9 83\n90 31\n83 3\n83 3\n21 31\n83 3\n32 31\n12 21\n31 21\n90 32\n32 21\n12 9\n12 31\n9 83\n83 12\n32 3\n32 83\n90 31\n9 32\n31 21\n83 90\n32 21\n21 3\n32 9", "output": "59" }, { "input": "30\n67 21\n85 39\n85 87\n21 39\n66 85\n10 95\n10 21\n87 85\n82 21\n67 21\n95 10\n21 39\n82 21\n21 66\n66 39\n95 30\n67 85\n66 82\n85 82\n21 66\n10 39\n67 10\n21 85\n10 82\n85 95\n10 85\n21 39\n85 39\n39 10\n95 67", "output": "100" }, { "input": "4\n8 7\n8 7\n7 8\n7 8", "output": "8" }, { "input": "6\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1", "output": "10" }, { "input": "12\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "72" }, { "input": "4\n1 2\n1 2\n2 1\n2 1", "output": "8" } ]
1,681,271,252
2,147,483,647
Python 3
OK
TESTS
31
92
0
n=int(input()) lst=[] lst1=[] c=0 for i in range(n): a,b=input().split() lst.append(a) lst1.append(b) for i in range(len(lst)): for j in range(len(lst1)): if lst[i]==lst1[j]: c=c+1 print(c)
Title: Games Time Limit: None seconds Memory Limit: None megabytes Problem Description: Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question. Input Specification: The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively. Output Specification: In a single line print the number of games where the host team is going to play in the guest uniform. Demo Input: ['3\n1 2\n2 4\n3 4\n', '4\n100 42\n42 100\n5 42\n100 5\n', '2\n1 2\n1 2\n'] Demo Output: ['1\n', '5\n', '0\n'] Note: In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
```python n=int(input()) lst=[] lst1=[] c=0 for i in range(n): a,b=input().split() lst.append(a) lst1.append(b) for i in range(len(lst)): for j in range(len(lst1)): if lst[i]==lst1[j]: c=c+1 print(c) ```
3
902
A
Visiting a Friend
PROGRAMMING
1,100
[ "greedy", "implementation" ]
null
null
Pig is visiting a friend. Pig's house is located at point 0, and his friend's house is located at point *m* on an axis. Pig can use teleports to move along the axis. To use a teleport, Pig should come to a certain point (where the teleport is located) and choose where to move: for each teleport there is the rightmost point it can move Pig to, this point is known as the limit of the teleport. Formally, a teleport located at point *x* with limit *y* can move Pig from point *x* to any point within the segment [*x*;<=*y*], including the bounds. Determine if Pig can visit the friend using teleports only, or he should use his car.
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*m*<=≤<=100) — the number of teleports and the location of the friend's house. The next *n* lines contain information about teleports. The *i*-th of these lines contains two integers *a**i* and *b**i* (0<=≤<=*a**i*<=≤<=*b**i*<=≤<=*m*), where *a**i* is the location of the *i*-th teleport, and *b**i* is its limit. It is guaranteed that *a**i*<=≥<=*a**i*<=-<=1 for every *i* (2<=≤<=*i*<=≤<=*n*).
Print "YES" if there is a path from Pig's house to his friend's house that uses only teleports, and "NO" otherwise. You can print each letter in arbitrary case (upper or lower).
[ "3 5\n0 2\n2 4\n3 5\n", "3 7\n0 4\n2 5\n6 7\n" ]
[ "YES\n", "NO\n" ]
The first example is shown on the picture below: Pig can use the first teleport from his house (point 0) to reach point 2, then using the second teleport go from point 2 to point 3, then using the third teleport go from point 3 to point 5, where his friend lives. The second example is shown on the picture below: You can see that there is no path from Pig's house to his friend's house that uses only teleports.
500
[ { "input": "3 5\n0 2\n2 4\n3 5", "output": "YES" }, { "input": "3 7\n0 4\n2 5\n6 7", "output": "NO" }, { "input": "1 1\n0 0", "output": "NO" }, { "input": "30 10\n0 7\n1 2\n1 2\n1 4\n1 4\n1 3\n2 2\n2 4\n2 6\n2 9\n2 2\n3 5\n3 8\n4 8\n4 5\n4 6\n5 6\n5 7\n6 6\n6 9\n6 7\n6 9\n7 7\n7 7\n8 8\n8 8\n9 9\n9 9\n10 10\n10 10", "output": "NO" }, { "input": "30 100\n0 27\n4 82\n11 81\n14 32\n33 97\n33 34\n37 97\n38 52\n45 91\n49 56\n50 97\n57 70\n59 94\n59 65\n62 76\n64 65\n65 95\n67 77\n68 100\n71 73\n80 94\n81 92\n84 85\n85 100\n88 91\n91 95\n92 98\n92 98\n99 100\n100 100", "output": "YES" }, { "input": "70 10\n0 4\n0 4\n0 8\n0 9\n0 1\n0 5\n0 7\n1 3\n1 8\n1 8\n1 6\n1 6\n1 2\n1 3\n1 2\n1 3\n2 5\n2 4\n2 3\n2 4\n2 6\n2 2\n2 5\n2 7\n3 7\n3 4\n3 7\n3 4\n3 8\n3 4\n3 9\n3 3\n3 7\n3 9\n3 3\n3 9\n4 6\n4 7\n4 5\n4 7\n5 8\n5 5\n5 9\n5 7\n5 5\n6 6\n6 9\n6 7\n6 8\n6 9\n6 8\n7 7\n7 8\n7 7\n7 8\n8 9\n8 8\n8 9\n8 8\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10", "output": "NO" }, { "input": "30 10\n0 7\n1 2\n1 2\n1 4\n1 4\n1 3\n2 2\n2 4\n2 6\n2 9\n2 2\n3 5\n3 8\n4 8\n4 5\n4 6\n5 6\n5 7\n6 6\n6 9\n6 7\n6 9\n7 7\n7 7\n8 10\n8 10\n9 9\n9 9\n10 10\n10 10", "output": "YES" }, { "input": "50 100\n0 95\n1 100\n1 38\n2 82\n5 35\n7 71\n8 53\n11 49\n15 27\n17 84\n17 75\n18 99\n18 43\n18 69\n21 89\n27 60\n27 29\n38 62\n38 77\n39 83\n40 66\n48 80\n48 100\n50 51\n50 61\n53 77\n53 63\n55 58\n56 68\n60 82\n62 95\n66 74\n67 83\n69 88\n69 81\n69 88\n69 98\n70 91\n70 76\n71 90\n72 99\n81 99\n85 87\n88 97\n88 93\n90 97\n90 97\n92 98\n98 99\n100 100", "output": "YES" }, { "input": "70 10\n0 4\n0 4\n0 8\n0 9\n0 1\n0 5\n0 7\n1 3\n1 8\n1 8\n1 10\n1 9\n1 6\n1 2\n1 3\n1 2\n2 6\n2 5\n2 4\n2 3\n2 10\n2 2\n2 6\n2 2\n3 10\n3 7\n3 7\n3 4\n3 7\n3 4\n3 8\n3 4\n3 10\n3 5\n3 3\n3 7\n4 8\n4 8\n4 9\n4 6\n5 7\n5 10\n5 7\n5 8\n5 5\n6 8\n6 9\n6 10\n6 6\n6 9\n6 7\n7 8\n7 9\n7 10\n7 10\n8 8\n8 8\n8 9\n8 10\n9 10\n9 9\n9 10\n9 10\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10", "output": "YES" }, { "input": "85 10\n0 9\n0 4\n0 2\n0 5\n0 1\n0 8\n0 7\n1 2\n1 4\n1 5\n1 9\n1 1\n1 6\n1 6\n2 5\n2 7\n2 7\n2 7\n2 7\n3 4\n3 7\n3 9\n3 5\n3 3\n4 4\n4 6\n4 5\n5 6\n5 6\n5 6\n5 6\n5 7\n5 8\n5 5\n5 7\n5 8\n5 9\n5 8\n6 8\n6 7\n6 8\n6 9\n6 9\n6 6\n6 9\n6 7\n7 7\n7 7\n7 7\n7 8\n7 7\n7 8\n7 8\n7 9\n8 8\n8 8\n8 8\n8 8\n8 8\n8 9\n8 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10", "output": "NO" }, { "input": "30 40\n0 0\n4 8\n5 17\n7 32\n7 16\n8 16\n10 19\n12 22\n12 27\n13 21\n13 28\n13 36\n14 28\n14 18\n18 21\n21 26\n21 36\n22 38\n23 32\n24 30\n26 35\n29 32\n29 32\n31 34\n31 31\n33 33\n33 35\n35 40\n38 38\n40 40", "output": "NO" }, { "input": "70 100\n0 99\n1 87\n1 94\n1 4\n2 72\n3 39\n3 69\n4 78\n5 85\n7 14\n8 59\n12 69\n14 15\n14 76\n17 17\n19 53\n19 57\n19 21\n21 35\n21 83\n24 52\n24 33\n27 66\n27 97\n30 62\n30 74\n30 64\n32 63\n35 49\n37 60\n40 99\n40 71\n41 83\n42 66\n42 46\n45 83\n51 76\n53 69\n54 82\n54 96\n54 88\n55 91\n56 88\n58 62\n62 87\n64 80\n67 90\n67 69\n68 92\n72 93\n74 93\n77 79\n77 91\n78 97\n78 98\n81 85\n81 83\n81 83\n84 85\n86 88\n89 94\n89 92\n92 97\n96 99\n97 98\n97 99\n99 99\n100 100\n100 100\n100 100", "output": "NO" }, { "input": "1 10\n0 10", "output": "YES" }, { "input": "70 40\n0 34\n1 16\n3 33\n4 36\n4 22\n5 9\n5 9\n7 16\n8 26\n9 29\n9 25\n10 15\n10 22\n10 29\n10 20\n11 27\n11 26\n11 12\n12 19\n13 21\n14 31\n14 36\n15 34\n15 37\n16 21\n17 31\n18 22\n20 27\n20 32\n20 20\n20 29\n21 29\n21 34\n21 30\n22 40\n23 23\n23 28\n24 29\n25 38\n26 35\n27 37\n28 39\n28 33\n28 40\n28 33\n29 31\n29 33\n30 38\n30 36\n30 30\n30 38\n31 37\n31 35\n31 32\n31 36\n33 39\n33 40\n35 38\n36 38\n37 38\n37 40\n38 39\n38 40\n38 39\n39 39\n39 40\n40 40\n40 40\n40 40\n40 40", "output": "YES" }, { "input": "50 40\n0 9\n1 26\n1 27\n2 33\n2 5\n3 30\n4 28\n5 31\n5 27\n5 29\n7 36\n8 32\n8 13\n9 24\n10 10\n10 30\n11 26\n11 22\n11 40\n11 31\n12 26\n13 25\n14 32\n17 19\n21 29\n22 36\n24 27\n25 39\n25 27\n27 32\n27 29\n27 39\n27 29\n28 38\n30 38\n32 40\n32 38\n33 33\n33 40\n34 35\n34 34\n34 38\n34 38\n35 37\n36 39\n36 39\n37 37\n38 40\n39 39\n40 40", "output": "YES" }, { "input": "70 40\n0 34\n1 16\n3 33\n4 36\n4 22\n5 9\n5 9\n7 16\n8 26\n9 29\n9 25\n10 15\n10 22\n10 29\n10 20\n11 27\n11 26\n11 12\n12 19\n13 21\n14 31\n14 36\n15 34\n15 37\n16 21\n17 31\n18 22\n20 27\n20 32\n20 20\n20 29\n21 29\n21 34\n21 30\n22 22\n23 28\n23 39\n24 24\n25 27\n26 38\n27 39\n28 33\n28 39\n28 34\n28 33\n29 30\n29 35\n30 30\n30 38\n30 34\n30 31\n31 36\n31 31\n31 32\n31 38\n33 34\n33 34\n35 36\n36 38\n37 38\n37 39\n38 38\n38 38\n38 38\n39 39\n39 39\n40 40\n40 40\n40 40\n40 40", "output": "NO" }, { "input": "10 100\n0 34\n8 56\n17 79\n24 88\n28 79\n45 79\n48 93\n55 87\n68 93\n88 99", "output": "NO" }, { "input": "10 10\n0 2\n3 8\n3 5\n3 3\n3 9\n3 8\n5 7\n6 10\n7 10\n9 10", "output": "NO" }, { "input": "50 10\n0 2\n0 2\n0 6\n1 9\n1 3\n1 2\n1 6\n1 1\n1 1\n2 7\n2 6\n2 4\n3 9\n3 8\n3 8\n3 8\n3 6\n3 4\n3 7\n3 4\n3 6\n3 5\n4 8\n5 5\n5 7\n6 7\n6 6\n7 7\n7 7\n7 7\n7 8\n7 8\n8 8\n8 8\n8 9\n8 8\n8 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10", "output": "NO" }, { "input": "10 40\n0 21\n1 19\n4 33\n6 26\n8 39\n15 15\n20 24\n27 27\n29 39\n32 37", "output": "NO" }, { "input": "50 10\n0 2\n0 2\n0 6\n1 9\n1 3\n1 2\n1 6\n1 1\n1 1\n2 7\n2 6\n2 4\n3 9\n3 8\n3 8\n3 8\n3 6\n3 4\n3 7\n3 4\n3 6\n3 10\n4 6\n5 9\n5 5\n6 7\n6 10\n7 8\n7 7\n7 7\n7 7\n7 10\n8 8\n8 8\n8 10\n8 8\n8 8\n9 10\n9 10\n9 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10", "output": "YES" }, { "input": "1 1\n0 1", "output": "YES" }, { "input": "30 40\n0 0\n4 8\n5 17\n7 32\n7 16\n8 16\n10 19\n12 22\n12 27\n13 21\n13 28\n13 36\n14 28\n14 18\n18 21\n21 26\n21 36\n22 38\n23 32\n24 30\n26 35\n29 32\n29 32\n31 34\n31 31\n33 33\n33 35\n35 36\n38 38\n40 40", "output": "NO" }, { "input": "30 100\n0 27\n4 82\n11 81\n14 32\n33 97\n33 34\n37 97\n38 52\n45 91\n49 56\n50 97\n57 70\n59 94\n59 65\n62 76\n64 65\n65 95\n67 77\n68 82\n71 94\n80 90\n81 88\n84 93\n85 89\n88 92\n91 97\n92 99\n92 97\n99 99\n100 100", "output": "NO" }, { "input": "10 100\n0 34\n8 56\n17 79\n24 88\n28 79\n45 79\n48 93\n55 87\n68 93\n79 100", "output": "YES" }, { "input": "10 40\n0 21\n1 19\n4 33\n6 26\n8 39\n15 15\n20 24\n27 27\n29 39\n37 40", "output": "YES" }, { "input": "85 10\n0 9\n0 4\n0 2\n0 5\n0 1\n0 8\n0 7\n1 2\n1 10\n1 2\n1 5\n1 10\n1 8\n1 1\n2 8\n2 7\n2 5\n2 5\n2 7\n3 5\n3 7\n3 5\n3 4\n3 7\n4 7\n4 8\n4 6\n5 7\n5 10\n5 5\n5 6\n5 6\n5 6\n5 6\n5 7\n5 8\n5 5\n5 7\n6 10\n6 9\n6 7\n6 10\n6 8\n6 7\n6 10\n6 10\n7 8\n7 9\n7 8\n7 8\n7 8\n7 8\n7 7\n7 7\n8 8\n8 8\n8 10\n8 9\n8 9\n8 9\n8 9\n9 9\n9 10\n9 9\n9 9\n9 9\n9 9\n9 10\n9 10\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10", "output": "YES" }, { "input": "50 100\n0 95\n1 7\n1 69\n2 83\n5 67\n7 82\n8 31\n11 25\n15 44\n17 75\n17 27\n18 43\n18 69\n18 40\n21 66\n27 29\n27 64\n38 77\n38 90\n39 52\n40 60\n48 91\n48 98\n50 89\n50 63\n53 54\n53 95\n55 76\n56 59\n60 96\n62 86\n66 70\n67 77\n69 88\n69 98\n69 80\n69 95\n70 74\n70 77\n71 99\n72 73\n81 87\n85 99\n88 96\n88 91\n90 97\n90 99\n92 92\n98 99\n100 100", "output": "NO" }, { "input": "50 40\n0 9\n1 26\n1 27\n2 33\n2 5\n3 30\n4 28\n5 31\n5 27\n5 29\n7 36\n8 32\n8 13\n9 24\n10 10\n10 30\n11 26\n11 22\n11 35\n11 23\n12 36\n13 31\n14 31\n17 17\n21 25\n22 33\n24 26\n25 32\n25 25\n27 39\n27 29\n27 34\n27 32\n28 34\n30 36\n32 37\n32 33\n33 35\n33 33\n34 38\n34 38\n34 36\n34 36\n35 36\n36 36\n36 39\n37 37\n38 39\n39 39\n40 40", "output": "NO" }, { "input": "10 10\n0 2\n3 8\n3 5\n3 3\n3 9\n3 8\n5 7\n6 9\n7 7\n9 9", "output": "NO" }, { "input": "70 100\n0 99\n1 87\n1 94\n1 4\n2 72\n3 39\n3 69\n4 78\n5 85\n7 14\n8 59\n12 69\n14 15\n14 76\n17 17\n19 53\n19 57\n19 21\n21 35\n21 83\n24 52\n24 33\n27 66\n27 97\n30 62\n30 74\n30 64\n32 63\n35 49\n37 60\n40 99\n40 71\n41 83\n42 66\n42 46\n45 83\n51 76\n53 69\n54 82\n54 96\n54 88\n55 91\n56 88\n58 62\n62 87\n64 80\n67 90\n67 69\n68 92\n72 93\n74 93\n77 79\n77 91\n78 97\n78 98\n81 85\n81 83\n81 83\n84 85\n86 88\n89 94\n89 100\n92 97\n96 96\n97 98\n97 100\n99 100\n100 100\n100 100\n100 100", "output": "YES" }, { "input": "2 2\n0 2\n0 1", "output": "YES" }, { "input": "2 100\n0 49\n50 100", "output": "NO" }, { "input": "2 100\n0 50\n50 100", "output": "YES" }, { "input": "10 100\n0 10\n10 20\n20 30\n30 40\n40 50\n50 60\n60 70\n70 80\n80 90\n90 100", "output": "YES" }, { "input": "100 10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 10", "output": "YES" }, { "input": "1 4\n1 4", "output": "NO" }, { "input": "3 5\n0 2\n2 5\n3 4", "output": "YES" }, { "input": "2 5\n0 5\n1 2", "output": "YES" }, { "input": "5 5\n0 2\n0 2\n3 5\n3 5\n3 5", "output": "NO" }, { "input": "4 10\n0 3\n2 10\n4 10\n5 7", "output": "YES" }, { "input": "3 8\n0 0\n1 8\n2 8", "output": "NO" }, { "input": "6 8\n0 3\n1 5\n2 3\n5 6\n6 7\n7 8", "output": "YES" } ]
1,513,839,963
2,147,483,647
Python 3
OK
TESTS
55
62
5,632,000
a = input().split() a = list(map(int,a)) n,m = a[0],a[1] list1 = [] for i in range(0,n): a = input().split() a = list(map(int,a)) list1.append(a) if list1[0][0] != 0: print ('NO') else: list2 = [0] for i in range(0,n): if list1[i][0] in list2: for each in range(list1[i][0],list1[i][1] + 1): list2.append(each) if m in list2: print ('YES') else: print ('NO')
Title: Visiting a Friend Time Limit: None seconds Memory Limit: None megabytes Problem Description: Pig is visiting a friend. Pig's house is located at point 0, and his friend's house is located at point *m* on an axis. Pig can use teleports to move along the axis. To use a teleport, Pig should come to a certain point (where the teleport is located) and choose where to move: for each teleport there is the rightmost point it can move Pig to, this point is known as the limit of the teleport. Formally, a teleport located at point *x* with limit *y* can move Pig from point *x* to any point within the segment [*x*;<=*y*], including the bounds. Determine if Pig can visit the friend using teleports only, or he should use his car. Input Specification: The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*m*<=≤<=100) — the number of teleports and the location of the friend's house. The next *n* lines contain information about teleports. The *i*-th of these lines contains two integers *a**i* and *b**i* (0<=≤<=*a**i*<=≤<=*b**i*<=≤<=*m*), where *a**i* is the location of the *i*-th teleport, and *b**i* is its limit. It is guaranteed that *a**i*<=≥<=*a**i*<=-<=1 for every *i* (2<=≤<=*i*<=≤<=*n*). Output Specification: Print "YES" if there is a path from Pig's house to his friend's house that uses only teleports, and "NO" otherwise. You can print each letter in arbitrary case (upper or lower). Demo Input: ['3 5\n0 2\n2 4\n3 5\n', '3 7\n0 4\n2 5\n6 7\n'] Demo Output: ['YES\n', 'NO\n'] Note: The first example is shown on the picture below: Pig can use the first teleport from his house (point 0) to reach point 2, then using the second teleport go from point 2 to point 3, then using the third teleport go from point 3 to point 5, where his friend lives. The second example is shown on the picture below: You can see that there is no path from Pig's house to his friend's house that uses only teleports.
```python a = input().split() a = list(map(int,a)) n,m = a[0],a[1] list1 = [] for i in range(0,n): a = input().split() a = list(map(int,a)) list1.append(a) if list1[0][0] != 0: print ('NO') else: list2 = [0] for i in range(0,n): if list1[i][0] in list2: for each in range(list1[i][0],list1[i][1] + 1): list2.append(each) if m in list2: print ('YES') else: print ('NO') ```
3
32
B
Borze
PROGRAMMING
800
[ "expression parsing", "implementation" ]
B. Borze
2
256
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
Output the decoded ternary number. It can have leading zeroes.
[ ".-.--\n", "--.\n", "-..-.--\n" ]
[ "012", "20", "1012" ]
none
1,000
[ { "input": ".-.--", "output": "012" }, { "input": "--.", "output": "20" }, { "input": "-..-.--", "output": "1012" }, { "input": "---..", "output": "210" }, { "input": "..--.---..", "output": "0020210" }, { "input": "-.....----.", "output": "10000220" }, { "input": ".", "output": "0" }, { "input": "-.", "output": "1" }, { "input": "--", "output": "2" }, { "input": "..", "output": "00" }, { "input": "--.", "output": "20" }, { "input": ".--.", "output": "020" }, { "input": ".-.-..", "output": "0110" }, { "input": "----.-.", "output": "2201" }, { "input": "-..--.-.", "output": "10201" }, { "input": "..--..--.", "output": "0020020" }, { "input": "-.-.---.--..-..-.-.-..-..-.--.", "output": "112120010111010120" }, { "input": "---.-.-.------..-..-..-..-.-..-.--.-.-..-.-.-----..-.-.", "output": "21112220010101011012011011221011" }, { "input": "-.-..--.-.-.-.-.-..-.-.-.---------.--.---..--...--.-----.-.-.-...--.-.-.---.------.--..-.--.-----.-...-..------", "output": "11020111110111222212021020002022111100201121222020012022110010222" }, { "input": "-.-..-.--.---..---.-..---.-...-.-.----..-.---.-.---..-.--.---.-.-------.---.--....----.-.---.---.---.----.-----..---.-.-.-.-----.--.-------.-..", "output": "110120210211021100112200121121012021122212120000220121212122022102111122120222110" }, { "input": ".-..-.-.---.-----.--.---...-.--.-.-....-..", "output": "01011212212021001201100010" }, { "input": ".------.-.---..--...-..-..-.-.-.--.--.-..-.--...-.-.---.-.-.------..--..-.---..----.-..-.--.---.-.----.-.---...-.-.-.-----.-.-.---.---.-.....-.-...-----.-...-.---.-..-.-----.--...---.-.-..-.--.-.---..", "output": "022201210200010101112020101200011211122200200121022010120211220121001112211121211000011002211001211012212000211101201210" }, { "input": ".-.--.---.-----.-.-----.-.-..-----..-..----..--.-.--.----..---.---..-.-.-----..-------.----..----.-..---...-----..-..-----...-..-.-.-----....---..---..-.-----...-.--...--.-.---.-.-.-.-.-...---..----.", "output": "01202122112211102210102200201202200212101122102221220022010210022101022100101122100021021012210012000201211111100210220" }, { "input": "..-.-.-.---.-.-.-..-.-..-.-.---.-------.---..-----.---....-.---.--.--.-.---.---------.-..---.-.-.--..---.---.-.---.-.-..-.-..-.-.-.----.--.-....--------.-.---..----.------.-.-.--.--.-----.-----.----", "output": "0011121111011011212221210221210001212020121222211021112002121121110110111220201000222201210220222011202022122122" }, { "input": "-..-------.------.-..--.-.-..--.-.-..-----..-.-.-..-..-..--.---..-----..---..-..--.-..-.-.---...-.....-------.---.-----.-...-.-...-.-.---.---.-----.--.--...-.--..-.-..-...-.-.-.-.---..---.-..-.-.-.-..", "output": "102221222010201102011022101110101020210221021010201011210010000222121221100110011212122120200012001101001111210211011110" }, { "input": ".-.----.-.--..-.-.-.-..----..-.-...--.-.---.---.-------..-.--..-......--.------.--.----.--...-.--.--..-----..-.....--.--.-.-.------..--------.----------..-.---.----.---.-..--..-.....-..------.--.", "output": "012201200111102200110020121212221012001000002022202022020001202002210100002020112220022220222220012122021102001000010222020" }, { "input": "------.-----.-....--.-.----.-.---.-.-..---.-.---.-----..-...-.-.---..-.-.-..-.-.-...-.-.-.----..--.------.----.-..-.--...-.-------...-.-..-.-.--.--.---..--..--------.--.-.-.---.-.-.-...----.--..-.--..", "output": "222022110002012201211102112122101001121011101110011122002022202201012000122210011011202021020022220201121111002202001200" }, { "input": "-.---...----...--.--...-.--.----", "output": "121002200020200012022" }, { "input": "--.--.--.---.--.-.---.-.-..-..--.-..---.-.....-..---.-----.--...-.-.-------.-.--.-.----.-..-.------.", "output": "202020212012111010201021100001021221200011222112012201012220" } ]
1,635,000,838
2,147,483,647
Python 3
OK
TESTS
30
124
4,505,600
val = input() previous = "" answer = [] for current in val: # 0 if current == "." and previous != "-": answer.append(0) previous = "" if current == "." and previous == "-": answer.append(1) previous = "" if current == "-" and previous == "-": answer.append(2) previous = "" else: previous = current for item in answer: print(item, end="") print()
Title: Borze Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet. Input Specification: The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes). Output Specification: Output the decoded ternary number. It can have leading zeroes. Demo Input: ['.-.--\n', '--.\n', '-..-.--\n'] Demo Output: ['012', '20', '1012'] Note: none
```python val = input() previous = "" answer = [] for current in val: # 0 if current == "." and previous != "-": answer.append(0) previous = "" if current == "." and previous == "-": answer.append(1) previous = "" if current == "-" and previous == "-": answer.append(2) previous = "" else: previous = current for item in answer: print(item, end="") print() ```
3.960608
227
B
Effective Approach
PROGRAMMING
1,100
[ "implementation" ]
null
null
Once at a team training Vasya, Petya and Sasha got a problem on implementing linear search in an array. According to the boys, linear search works as follows. The array elements in a pre-selected order are in turn compared with the number that you need to find. Once you find the array element that is equal to the required one, the search ends. The efficiency of the algorithm is the number of performed comparisons. The fewer comparisons the linear search has made, the more effective it is. Vasya believes that a linear search would work better if it sequentially iterates through the elements, starting with the 1-st one (in this problem we consider the elements of the array indexed from 1 to *n*) and ending with the *n*-th one. And Petya says that Vasya is wrong: the search will need less comparisons if it sequentially iterates the elements starting from the *n*-th and ending with the 1-st one. Sasha argues that the two approaches are equivalent. To finally begin the task, the teammates decided to settle the debate and compare the two approaches on an example. For this, they took an array that is a permutation of integers from 1 to *n*, and generated *m* queries of the form: find element with value *b**i* in the array. They want to calculate for both approaches how many comparisons in total the linear search will need to respond to all queries. If the first search needs fewer comparisons, then the winner of the dispute is Vasya. If the second one does, then the winner is Petya. If both approaches make the same number of comparisons, then Sasha's got the upper hand. But the problem is, linear search is too slow. That's why the boys aren't going to find out who is right before the end of the training, unless you come in here. Help them to determine who will win the dispute.
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of elements in the array. The second line contains *n* distinct space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the elements of array. The third line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. The last line contains *m* space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*) — the search queries. Note that the queries can repeat.
Print two integers, showing how many comparisons Vasya's approach needs and how many comparisons Petya's approach needs. Separate the numbers by spaces. Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier.
[ "2\n1 2\n1\n1\n", "2\n2 1\n1\n1\n", "3\n3 1 2\n3\n1 2 3\n" ]
[ "1 2\n", "2 1\n", "6 6\n" ]
In the first sample Vasya's approach will make one comparison (it starts with the 1-st element and immediately finds the required number), and Petya's approach makes two comparisons (first he compares with the 2-nd array element, doesn't find the search item and compares with the 1-st element). In the second sample, on the contrary, Vasya's approach will need two comparisons (first with 1-st element, and then with the 2-nd), and Petya's approach will find the required value in one comparison (the first comparison with the 2-nd element).
1,000
[ { "input": "2\n1 2\n1\n1", "output": "1 2" }, { "input": "2\n2 1\n1\n1", "output": "2 1" }, { "input": "3\n3 1 2\n3\n1 2 3", "output": "6 6" }, { "input": "9\n2 9 3 1 6 4 7 8 5\n9\n5 1 5 2 8 4 4 4 5", "output": "58 32" }, { "input": "10\n3 10 9 2 7 6 5 8 4 1\n1\n4", "output": "9 2" }, { "input": "10\n5 2 10 8 3 1 9 7 6 4\n9\n2 5 9 2 3 2 5 9 8", "output": "31 68" }, { "input": "9\n3 8 4 7 1 2 5 6 9\n3\n2 7 1", "output": "15 15" }, { "input": "9\n5 3 8 4 2 6 1 7 9\n4\n6 1 9 2", "output": "27 13" }, { "input": "4\n1 3 2 4\n4\n3 1 2 3", "output": "8 12" }, { "input": "3\n1 2 3\n8\n3 2 1 1 2 3 1 2", "output": "15 17" } ]
1,693,647,079
2,147,483,647
PyPy 3-64
OK
TESTS
34
248
23,552,000
n = int(input()) #len of n_array n_array = {i:a for a,i in enumerate(map(int,input().split()))} m = int(input()) #len of m_array m_array = sum(n_array[i] for i in map(int,input().split())) print(m_array+m,(n*m)-m_array)
Title: Effective Approach Time Limit: None seconds Memory Limit: None megabytes Problem Description: Once at a team training Vasya, Petya and Sasha got a problem on implementing linear search in an array. According to the boys, linear search works as follows. The array elements in a pre-selected order are in turn compared with the number that you need to find. Once you find the array element that is equal to the required one, the search ends. The efficiency of the algorithm is the number of performed comparisons. The fewer comparisons the linear search has made, the more effective it is. Vasya believes that a linear search would work better if it sequentially iterates through the elements, starting with the 1-st one (in this problem we consider the elements of the array indexed from 1 to *n*) and ending with the *n*-th one. And Petya says that Vasya is wrong: the search will need less comparisons if it sequentially iterates the elements starting from the *n*-th and ending with the 1-st one. Sasha argues that the two approaches are equivalent. To finally begin the task, the teammates decided to settle the debate and compare the two approaches on an example. For this, they took an array that is a permutation of integers from 1 to *n*, and generated *m* queries of the form: find element with value *b**i* in the array. They want to calculate for both approaches how many comparisons in total the linear search will need to respond to all queries. If the first search needs fewer comparisons, then the winner of the dispute is Vasya. If the second one does, then the winner is Petya. If both approaches make the same number of comparisons, then Sasha's got the upper hand. But the problem is, linear search is too slow. That's why the boys aren't going to find out who is right before the end of the training, unless you come in here. Help them to determine who will win the dispute. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of elements in the array. The second line contains *n* distinct space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the elements of array. The third line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. The last line contains *m* space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*) — the search queries. Note that the queries can repeat. Output Specification: Print two integers, showing how many comparisons Vasya's approach needs and how many comparisons Petya's approach needs. Separate the numbers by spaces. Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier. Demo Input: ['2\n1 2\n1\n1\n', '2\n2 1\n1\n1\n', '3\n3 1 2\n3\n1 2 3\n'] Demo Output: ['1 2\n', '2 1\n', '6 6\n'] Note: In the first sample Vasya's approach will make one comparison (it starts with the 1-st element and immediately finds the required number), and Petya's approach makes two comparisons (first he compares with the 2-nd array element, doesn't find the search item and compares with the 1-st element). In the second sample, on the contrary, Vasya's approach will need two comparisons (first with 1-st element, and then with the 2-nd), and Petya's approach will find the required value in one comparison (the first comparison with the 2-nd element).
```python n = int(input()) #len of n_array n_array = {i:a for a,i in enumerate(map(int,input().split()))} m = int(input()) #len of m_array m_array = sum(n_array[i] for i in map(int,input().split())) print(m_array+m,(n*m)-m_array) ```
3
705
A
Hulk
PROGRAMMING
800
[ "implementation" ]
null
null
Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings. Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on... For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on. Please help Dr. Banner.
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate.
Print Dr.Banner's feeling in one line.
[ "1\n", "2\n", "3\n" ]
[ "I hate it\n", "I hate that I love it\n", "I hate that I love that I hate it\n" ]
none
500
[ { "input": "1", "output": "I hate it" }, { "input": "2", "output": "I hate that I love it" }, { "input": "3", "output": "I hate that I love that I hate it" }, { "input": "4", "output": "I hate that I love that I hate that I love it" }, { "input": "5", "output": "I hate that I love that I hate that I love that I hate it" }, { "input": "10", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it" }, { "input": "18", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it" }, { "input": "19", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it" }, { "input": "76", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "77", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "81", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "82", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "85", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "86", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "100", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "99", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "98", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "33", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it" }, { "input": "34", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it" }, { "input": "57", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "100", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." } ]
1,692,696,203
2,147,483,647
Python 3
OK
TESTS
21
46
0
def hulk(n): if n == 1: return "I hate it" feel = hulk(n - 1) if n % 2 == 0: return feel.replace("it", "that I love it") else: return feel.replace("it", "that I hate it") n = int(input()) result = hulk(n) print(result)
Title: Hulk Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings. Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on... For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on. Please help Dr. Banner. Input Specification: The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate. Output Specification: Print Dr.Banner's feeling in one line. Demo Input: ['1\n', '2\n', '3\n'] Demo Output: ['I hate it\n', 'I hate that I love it\n', 'I hate that I love that I hate it\n'] Note: none
```python def hulk(n): if n == 1: return "I hate it" feel = hulk(n - 1) if n % 2 == 0: return feel.replace("it", "that I love it") else: return feel.replace("it", "that I hate it") n = int(input()) result = hulk(n) print(result) ```
3
53
A
Autocomplete
PROGRAMMING
1,100
[ "implementation" ]
A. Autocomplete
2
256
Autocomplete is a program function that enables inputting the text (in editors, command line shells, browsers etc.) completing the text by its inputted part. Vasya is busy working on a new browser called 'BERowser'. He happens to be working on the autocomplete function in the address line at this very moment. A list consisting of *n* last visited by the user pages and the inputted part *s* are known. Your task is to complete *s* to make it an address of one of the pages from the list. You have to find the lexicographically smallest address having a prefix *s*.
The first line contains the *s* line which is the inputted part. The second line contains an integer *n* (1<=≤<=*n*<=≤<=100) which is the number of visited pages. Then follow *n* lines which are the visited pages, one on each line. All the lines have lengths of from 1 to 100 symbols inclusively and consist of lowercase Latin letters only.
If *s* is not the beginning of any of *n* addresses of the visited pages, print *s*. Otherwise, print the lexicographically minimal address of one of the visited pages starting from *s*. The lexicographical order is the order of words in a dictionary. The lexicographical comparison of lines is realized by the '&lt;' operator in the modern programming languages.
[ "next\n2\nnextpermutation\nnextelement\n", "find\n4\nfind\nfindfirstof\nfindit\nfand\n", "find\n4\nfondfind\nfondfirstof\nfondit\nfand\n" ]
[ "nextelement\n", "find\n", "find\n" ]
none
500
[ { "input": "next\n2\nnextpermutation\nnextelement", "output": "nextelement" }, { "input": "find\n4\nfind\nfindfirstof\nfindit\nfand", "output": "find" }, { "input": "find\n4\nfondfind\nfondfirstof\nfondit\nfand", "output": "find" }, { "input": "kudljmxcse\n4\nkudljmxcse\nszjebdoad\nchz\na", "output": "kudljmxcse" }, { "input": "ntqwpa\n5\nvvepyowvn\nntqwpakay\nhh\nygiafasda\nntqwpadm", "output": "ntqwpadm" }, { "input": "aflb\n6\nsaej\nujxsiijg\npp\nhgoprw\ncp\nnt", "output": "aflb" }, { "input": "dzwzyj\n7\nwvixktp\ndzwzyjuhn\ndzwzyjqrbd\ndzwzyji\ndzwzyjyfys\ndzwzyjrcb\nxptb", "output": "dzwzyji" }, { "input": "wmblbphwdjjskzmlsyiznluiudelhlvcpyrooajvbwudnnstdhesauyxjugdwhrrwg\n1\nwjhsbxrrhadgtnybsugdtprncwerwezxuaxnqfpnosbispmnymnaqssdkjeynrnn", "output": "wmblbphwdjjskzmlsyiznluiudelhlvcpyrooajvbwudnnstdhesauyxjugdwhrrwg" }, { "input": "hzkqvwliymwjbejfpnydrbwskhyrtrlsdinfrgwmnbdpwytcnjeoowxrfgfuaffzayjylvzu\n1\nhzkqvwliymwjbejfpnydrbwskhyrtrlsdinfrgwmnbdpwytcnjeoowxrfgfuaffzayjylvzubwjlvhhsfurqb", "output": "hzkqvwliymwjbejfpnydrbwskhyrtrlsdinfrgwmnbdpwytcnjeoowxrfgfuaffzayjylvzubwjlvhhsfurqb" }, { "input": "msjnqudojxtzvpc\n2\nvlxclsvqbucmbrkwwtoxek\nmsjnqudojxtzvpcldwjyystsxrtexfhllzhnkidmhmyxpld", "output": "msjnqudojxtzvpcldwjyystsxrtexfhllzhnkidmhmyxpld" } ]
1,537,335,987
2,147,483,647
Python 3
OK
TESTS
25
218
0
n=input() k=len(n) ta=[] p=int(input()) for x in range(p): ol=input() if ol[0:k]==n: ta.append(ol[k:]) else: pass if ta==list(): print(n) else: ta.sort() print(n+ta[0])
Title: Autocomplete Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Autocomplete is a program function that enables inputting the text (in editors, command line shells, browsers etc.) completing the text by its inputted part. Vasya is busy working on a new browser called 'BERowser'. He happens to be working on the autocomplete function in the address line at this very moment. A list consisting of *n* last visited by the user pages and the inputted part *s* are known. Your task is to complete *s* to make it an address of one of the pages from the list. You have to find the lexicographically smallest address having a prefix *s*. Input Specification: The first line contains the *s* line which is the inputted part. The second line contains an integer *n* (1<=≤<=*n*<=≤<=100) which is the number of visited pages. Then follow *n* lines which are the visited pages, one on each line. All the lines have lengths of from 1 to 100 symbols inclusively and consist of lowercase Latin letters only. Output Specification: If *s* is not the beginning of any of *n* addresses of the visited pages, print *s*. Otherwise, print the lexicographically minimal address of one of the visited pages starting from *s*. The lexicographical order is the order of words in a dictionary. The lexicographical comparison of lines is realized by the '&lt;' operator in the modern programming languages. Demo Input: ['next\n2\nnextpermutation\nnextelement\n', 'find\n4\nfind\nfindfirstof\nfindit\nfand\n', 'find\n4\nfondfind\nfondfirstof\nfondit\nfand\n'] Demo Output: ['nextelement\n', 'find\n', 'find\n'] Note: none
```python n=input() k=len(n) ta=[] p=int(input()) for x in range(p): ol=input() if ol[0:k]==n: ta.append(ol[k:]) else: pass if ta==list(): print(n) else: ta.sort() print(n+ta[0]) ```
3.9455
486
A
Calculating Function
PROGRAMMING
800
[ "implementation", "math" ]
null
null
For a positive integer *n* let's define a function *f*: *f*(*n*)<==<=<=-<=1<=+<=2<=-<=3<=+<=..<=+<=(<=-<=1)*n**n* Your task is to calculate *f*(*n*) for a given integer *n*.
The single line contains the positive integer *n* (1<=≤<=*n*<=≤<=1015).
Print *f*(*n*) in a single line.
[ "4\n", "5\n" ]
[ "2\n", "-3\n" ]
*f*(4) =  - 1 + 2 - 3 + 4 = 2 *f*(5) =  - 1 + 2 - 3 + 4 - 5 =  - 3
500
[ { "input": "4", "output": "2" }, { "input": "5", "output": "-3" }, { "input": "1000000000", "output": "500000000" }, { "input": "1000000001", "output": "-500000001" }, { "input": "1000000000000000", "output": "500000000000000" }, { "input": "100", "output": "50" }, { "input": "101", "output": "-51" }, { "input": "102", "output": "51" }, { "input": "103", "output": "-52" }, { "input": "104", "output": "52" }, { "input": "105", "output": "-53" }, { "input": "106", "output": "53" }, { "input": "107", "output": "-54" }, { "input": "108", "output": "54" }, { "input": "109", "output": "-55" }, { "input": "208170109961052", "output": "104085054980526" }, { "input": "46017661651072", "output": "23008830825536" }, { "input": "4018154546667", "output": "-2009077273334" }, { "input": "288565475053", "output": "-144282737527" }, { "input": "3052460231", "output": "-1526230116" }, { "input": "29906716", "output": "14953358" }, { "input": "87897701693326", "output": "43948850846663" }, { "input": "8240", "output": "4120" }, { "input": "577935", "output": "-288968" }, { "input": "62", "output": "31" }, { "input": "1", "output": "-1" }, { "input": "2", "output": "1" }, { "input": "9999999999999", "output": "-5000000000000" }, { "input": "1000000000000", "output": "500000000000" }, { "input": "99999999999999", "output": "-50000000000000" }, { "input": "999999999999999", "output": "-500000000000000" }, { "input": "42191359342", "output": "21095679671" }, { "input": "100000000000000", "output": "50000000000000" }, { "input": "145645214654154", "output": "72822607327077" }, { "input": "4294967296", "output": "2147483648" }, { "input": "3037000499", "output": "-1518500250" }, { "input": "10000000000001", "output": "-5000000000001" }, { "input": "100000017040846", "output": "50000008520423" }, { "input": "98979894985999", "output": "-49489947493000" } ]
1,698,346,210
2,147,483,647
PyPy 3-64
OK
TESTS
39
46
0
z=int(input()) f=0 if z&1==1: z+=1 z=-(z//2) else: z=z//2 print(z)
Title: Calculating Function Time Limit: None seconds Memory Limit: None megabytes Problem Description: For a positive integer *n* let's define a function *f*: *f*(*n*)<==<=<=-<=1<=+<=2<=-<=3<=+<=..<=+<=(<=-<=1)*n**n* Your task is to calculate *f*(*n*) for a given integer *n*. Input Specification: The single line contains the positive integer *n* (1<=≤<=*n*<=≤<=1015). Output Specification: Print *f*(*n*) in a single line. Demo Input: ['4\n', '5\n'] Demo Output: ['2\n', '-3\n'] Note: *f*(4) =  - 1 + 2 - 3 + 4 = 2 *f*(5) =  - 1 + 2 - 3 + 4 - 5 =  - 3
```python z=int(input()) f=0 if z&1==1: z+=1 z=-(z//2) else: z=z//2 print(z) ```
3
120
B
Quiz League
PROGRAMMING
1,100
[ "implementation" ]
null
null
A team quiz game called "What? Where? When?" is very popular in Berland. The game is centered on two teams competing. They are the team of six Experts versus the team of the Audience. A person from the audience asks a question and the experts are allowed a minute on brainstorming and finding the right answer to the question. All it takes to answer a typical question is general knowledge and common logic. The question sent be the audience are in envelops lain out in a circle on a round table. Each envelop is marked by the name of the asker's town. Each question is positioned in a separate sector. In the centre of the table is a spinning arrow. Thus, the table rather resembles a roulette table with no ball but with a spinning arrow instead. The host sets off the spinning arrow to choose a question for the experts: when the arrow stops spinning, the question it is pointing at is chosen. If the arrow points at the question that has already been asked, the host chooses the next unanswered question in the clockwise direction. Your task is to determine which will be the number of the next asked question if the arrow points at sector number *k*.
The first line contains two positive integers *n* and *k* (1<=≤<=*n*<=≤<=1000 and 1<=≤<=*k*<=≤<=*n*) — the numbers of sectors on the table and the number of the sector where the arrow is pointing. The second line contains *n* numbers: *a**i*<==<=0 if the question from sector *i* has already been asked and *a**i*<==<=1 if the question from sector *i* hasn't been asked yet (1<=≤<=*i*<=≤<=*n*). The sectors are given in the clockwise order, the first sector follows after the *n*-th one.
Print the single number — the number of the sector containing the question the experts will be asked. It is guaranteed that the answer exists, that is that not all the questions have already been asked.
[ "5 5\n0 1 0 1 0\n", "2 1\n1 1\n" ]
[ "2\n", "1\n" ]
none
0
[ { "input": "5 5\n0 1 0 1 0", "output": "2" }, { "input": "2 1\n1 1", "output": "1" }, { "input": "3 2\n1 0 0", "output": "1" }, { "input": "3 3\n0 1 0", "output": "2" }, { "input": "1 1\n1", "output": "1" }, { "input": "6 3\n0 0 1 1 0 1", "output": "3" }, { "input": "3 1\n0 1 0", "output": "2" }, { "input": "3 3\n1 0 1", "output": "3" }, { "input": "4 4\n1 0 1 0", "output": "1" }, { "input": "5 3\n0 1 0 1 1", "output": "4" }, { "input": "6 4\n1 0 0 0 0 1", "output": "6" }, { "input": "7 5\n1 0 0 0 0 0 1", "output": "7" }, { "input": "101 81\n1 0 1 1 1 1 0 0 1 1 1 1 1 0 0 1 0 1 0 1 1 1 1 1 1 1 0 1 1 0 1 1 1 0 1 0 0 1 0 1 0 1 1 0 1 0 0 1 0 0 0 1 0 0 1 0 0 0 1 1 0 1 1 0 0 1 0 0 1 0 0 0 0 0 0 1 1 0 1 1 0 1 0 0 0 0 1 0 0 1 1 0 0 1 0 1 0 0 0 1 0", "output": "82" }, { "input": "200 31\n1 0 0 1 1 1 0 0 0 0 0 1 1 1 0 1 1 0 0 1 0 0 0 1 1 1 0 1 1 0 0 0 1 1 1 1 0 1 1 1 1 1 0 1 0 1 0 1 0 0 1 1 1 0 0 0 1 0 0 0 1 1 0 0 0 0 1 1 0 1 1 1 1 1 0 0 1 1 1 0 0 0 0 1 0 1 1 1 0 1 1 0 0 1 1 1 1 1 0 1 0 1 1 0 1 0 1 1 0 0 1 1 0 0 0 1 1 1 1 1 1 1 0 0 1 1 0 1 1 1 0 1 0 0 1 1 1 0 0 0 0 0 0 1 0 1 0 0 1 1 1 1 1 0 1 0 0 0 0 1 1 0 1 0 1 1 1 0 1 0 1 0 0 0 1 0 0 0 0 0 0 0 0 1 0 0 0 1 1 0 1 0 0 1 1 1 0 0 1 0", "output": "33" }, { "input": "17 13\n0 0 1 1 1 0 1 1 0 0 0 1 1 1 1 1 1", "output": "13" }, { "input": "102 9\n0 0 0 0 1 1 0 1 0 1 1 1 1 0 1 0 1 0 1 0 0 0 1 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 0 1 0 0 1 1 0 0 0 1 0 0 1 1 0 1 0 1 1 0 1 0 0 1 0 0 0 0 1 1 1 1 0 0 1 1 1 0 0 0 1 1 0 0 1 0 1 1 0 1 0 0 0 0 0 0 0 1 1 0 0 1 1", "output": "10" } ]
1,604,430,666
2,147,483,647
PyPy 3
OK
TESTS
30
140
0
import sys sys.stdin = open(r'input.txt', 'r') sys.stdout = open(r'output.txt', 'w') n, k = map(int, input().split()) a = list(map(int, input().split())) i = k-1; while (True): if i == n: i = 0 continue if a[i] == 1: print(i+1) break i += 1
Title: Quiz League Time Limit: None seconds Memory Limit: None megabytes Problem Description: A team quiz game called "What? Where? When?" is very popular in Berland. The game is centered on two teams competing. They are the team of six Experts versus the team of the Audience. A person from the audience asks a question and the experts are allowed a minute on brainstorming and finding the right answer to the question. All it takes to answer a typical question is general knowledge and common logic. The question sent be the audience are in envelops lain out in a circle on a round table. Each envelop is marked by the name of the asker's town. Each question is positioned in a separate sector. In the centre of the table is a spinning arrow. Thus, the table rather resembles a roulette table with no ball but with a spinning arrow instead. The host sets off the spinning arrow to choose a question for the experts: when the arrow stops spinning, the question it is pointing at is chosen. If the arrow points at the question that has already been asked, the host chooses the next unanswered question in the clockwise direction. Your task is to determine which will be the number of the next asked question if the arrow points at sector number *k*. Input Specification: The first line contains two positive integers *n* and *k* (1<=≤<=*n*<=≤<=1000 and 1<=≤<=*k*<=≤<=*n*) — the numbers of sectors on the table and the number of the sector where the arrow is pointing. The second line contains *n* numbers: *a**i*<==<=0 if the question from sector *i* has already been asked and *a**i*<==<=1 if the question from sector *i* hasn't been asked yet (1<=≤<=*i*<=≤<=*n*). The sectors are given in the clockwise order, the first sector follows after the *n*-th one. Output Specification: Print the single number — the number of the sector containing the question the experts will be asked. It is guaranteed that the answer exists, that is that not all the questions have already been asked. Demo Input: ['5 5\n0 1 0 1 0\n', '2 1\n1 1\n'] Demo Output: ['2\n', '1\n'] Note: none
```python import sys sys.stdin = open(r'input.txt', 'r') sys.stdout = open(r'output.txt', 'w') n, k = map(int, input().split()) a = list(map(int, input().split())) i = k-1; while (True): if i == n: i = 0 continue if a[i] == 1: print(i+1) break i += 1 ```
3
109
A
Lucky Sum of Digits
PROGRAMMING
1,000
[ "brute force", "implementation" ]
A. Lucky Sum of Digits
2
256
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. Petya wonders eagerly what minimum lucky number has the sum of digits equal to *n*. Help him cope with the task.
The single line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the sum of digits of the required lucky number.
Print on the single line the result — the minimum lucky number, whose sum of digits equals *n*. If such number does not exist, print -1.
[ "11\n", "10\n" ]
[ "47\n", "-1\n" ]
none
500
[ { "input": "11", "output": "47" }, { "input": "10", "output": "-1" }, { "input": "64", "output": "4477777777" }, { "input": "1", "output": "-1" }, { "input": "4", "output": "4" }, { "input": "7", "output": "7" }, { "input": "12", "output": "444" }, { "input": "1000000", "output": "4477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "47", "output": "44477777" }, { "input": "100", "output": "4444777777777777" }, { "input": "700", "output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" }, { "input": "485", "output": "44447777777777777777777777777777777777777777777777777777777777777777777" }, { "input": "111", "output": "444447777777777777" }, { "input": "85", "output": "4477777777777" }, { "input": "114", "output": "444477777777777777" }, { "input": "474", "output": "444777777777777777777777777777777777777777777777777777777777777777777" }, { "input": "74", "output": "47777777777" }, { "input": "1000", "output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" }, { "input": "1024", "output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" }, { "input": "4444", "output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "45784", "output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "10000", "output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "9854", "output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "186", "output": "477777777777777777777777777" }, { "input": "10416", "output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "10417", "output": "4477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "3840", "output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "100000", "output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "9876", "output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "99999", "output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "777777", "output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "854759", "output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "11000", "output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "18951", "output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "999999", "output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "888887", "output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "999998", "output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "40008", "output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "10691", "output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "5", "output": "-1" }, { "input": "6", "output": "-1" }, { "input": "9", "output": "-1" }, { "input": "8", "output": "44" }, { "input": "2", "output": "-1" }, { "input": "3", "output": "-1" }, { "input": "999997", "output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "999996", "output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "999990", "output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "999980", "output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "800000", "output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." }, { "input": "980000", "output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..." } ]
1,600,514,142
2,147,483,647
PyPy 3
OK
TESTS
51
310
614,400
n=int(input()) a=n%7 x=n//7 while (a%4): a=a+7 x=x-1 y=a//4 if max(0,x)*7+max(y,0)*4!=n: print (-1) else: print (('4'*y)+('7'*x))
Title: Lucky Sum of Digits Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. Petya wonders eagerly what minimum lucky number has the sum of digits equal to *n*. Help him cope with the task. Input Specification: The single line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the sum of digits of the required lucky number. Output Specification: Print on the single line the result — the minimum lucky number, whose sum of digits equals *n*. If such number does not exist, print -1. Demo Input: ['11\n', '10\n'] Demo Output: ['47\n', '-1\n'] Note: none
```python n=int(input()) a=n%7 x=n//7 while (a%4): a=a+7 x=x-1 y=a//4 if max(0,x)*7+max(y,0)*4!=n: print (-1) else: print (('4'*y)+('7'*x)) ```
3.921356
769
A
Year of University Entrance
PROGRAMMING
800
[ "*special", "implementation", "sortings" ]
null
null
There is the faculty of Computer Science in Berland. In the social net "TheContact!" for each course of this faculty there is the special group whose name equals the year of university entrance of corresponding course of students at the university. Each of students joins the group of his course and joins all groups for which the year of student's university entrance differs by no more than *x* from the year of university entrance of this student, where *x* — some non-negative integer. A value *x* is not given, but it can be uniquely determined from the available data. Note that students don't join other groups. You are given the list of groups which the student Igor joined. According to this information you need to determine the year of Igor's university entrance.
The first line contains the positive odd integer *n* (1<=≤<=*n*<=≤<=5) — the number of groups which Igor joined. The next line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (2010<=≤<=*a**i*<=≤<=2100) — years of student's university entrance for each group in which Igor is the member. It is guaranteed that the input data is correct and the answer always exists. Groups are given randomly.
Print the year of Igor's university entrance.
[ "3\n2014 2016 2015\n", "1\n2050\n" ]
[ "2015\n", "2050\n" ]
In the first test the value *x* = 1. Igor entered the university in 2015. So he joined groups members of which are students who entered the university in 2014, 2015 and 2016. In the second test the value *x* = 0. Igor entered only the group which corresponds to the year of his university entrance.
500
[ { "input": "3\n2014 2016 2015", "output": "2015" }, { "input": "1\n2050", "output": "2050" }, { "input": "1\n2010", "output": "2010" }, { "input": "1\n2011", "output": "2011" }, { "input": "3\n2010 2011 2012", "output": "2011" }, { "input": "3\n2049 2047 2048", "output": "2048" }, { "input": "5\n2043 2042 2041 2044 2040", "output": "2042" }, { "input": "5\n2012 2013 2014 2015 2016", "output": "2014" }, { "input": "1\n2045", "output": "2045" }, { "input": "1\n2046", "output": "2046" }, { "input": "1\n2099", "output": "2099" }, { "input": "1\n2100", "output": "2100" }, { "input": "3\n2011 2010 2012", "output": "2011" }, { "input": "3\n2011 2012 2010", "output": "2011" }, { "input": "3\n2012 2011 2010", "output": "2011" }, { "input": "3\n2010 2012 2011", "output": "2011" }, { "input": "3\n2012 2010 2011", "output": "2011" }, { "input": "3\n2047 2048 2049", "output": "2048" }, { "input": "3\n2047 2049 2048", "output": "2048" }, { "input": "3\n2048 2047 2049", "output": "2048" }, { "input": "3\n2048 2049 2047", "output": "2048" }, { "input": "3\n2049 2048 2047", "output": "2048" }, { "input": "5\n2011 2014 2012 2013 2010", "output": "2012" }, { "input": "5\n2014 2013 2011 2012 2015", "output": "2013" }, { "input": "5\n2021 2023 2024 2020 2022", "output": "2022" }, { "input": "5\n2081 2079 2078 2080 2077", "output": "2079" }, { "input": "5\n2095 2099 2097 2096 2098", "output": "2097" }, { "input": "5\n2097 2099 2100 2098 2096", "output": "2098" }, { "input": "5\n2012 2010 2014 2011 2013", "output": "2012" }, { "input": "5\n2012 2011 2013 2015 2014", "output": "2013" }, { "input": "5\n2023 2024 2022 2021 2020", "output": "2022" }, { "input": "5\n2077 2078 2080 2079 2081", "output": "2079" }, { "input": "5\n2099 2096 2095 2097 2098", "output": "2097" }, { "input": "5\n2097 2100 2098 2096 2099", "output": "2098" }, { "input": "5\n2011 2014 2013 2010 2012", "output": "2012" }, { "input": "5\n2013 2011 2015 2012 2014", "output": "2013" }, { "input": "5\n2024 2020 2021 2023 2022", "output": "2022" }, { "input": "5\n2079 2080 2077 2081 2078", "output": "2079" }, { "input": "5\n2095 2097 2096 2098 2099", "output": "2097" }, { "input": "5\n2099 2096 2100 2097 2098", "output": "2098" }, { "input": "5\n2034 2033 2036 2032 2035", "output": "2034" }, { "input": "5\n2030 2031 2033 2032 2029", "output": "2031" }, { "input": "5\n2093 2092 2094 2096 2095", "output": "2094" }, { "input": "5\n2012 2015 2014 2013 2011", "output": "2013" }, { "input": "5\n2056 2057 2058 2059 2060", "output": "2058" } ]
1,593,340,849
2,147,483,647
PyPy 3
OK
TESTS
45
155
20,172,800
n = int(input()) l = [int(x) for x in input().split()] l.sort() print(l[n//2])
Title: Year of University Entrance Time Limit: None seconds Memory Limit: None megabytes Problem Description: There is the faculty of Computer Science in Berland. In the social net "TheContact!" for each course of this faculty there is the special group whose name equals the year of university entrance of corresponding course of students at the university. Each of students joins the group of his course and joins all groups for which the year of student's university entrance differs by no more than *x* from the year of university entrance of this student, where *x* — some non-negative integer. A value *x* is not given, but it can be uniquely determined from the available data. Note that students don't join other groups. You are given the list of groups which the student Igor joined. According to this information you need to determine the year of Igor's university entrance. Input Specification: The first line contains the positive odd integer *n* (1<=≤<=*n*<=≤<=5) — the number of groups which Igor joined. The next line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (2010<=≤<=*a**i*<=≤<=2100) — years of student's university entrance for each group in which Igor is the member. It is guaranteed that the input data is correct and the answer always exists. Groups are given randomly. Output Specification: Print the year of Igor's university entrance. Demo Input: ['3\n2014 2016 2015\n', '1\n2050\n'] Demo Output: ['2015\n', '2050\n'] Note: In the first test the value *x* = 1. Igor entered the university in 2015. So he joined groups members of which are students who entered the university in 2014, 2015 and 2016. In the second test the value *x* = 0. Igor entered only the group which corresponds to the year of his university entrance.
```python n = int(input()) l = [int(x) for x in input().split()] l.sort() print(l[n//2]) ```
3
551
A
GukiZ and Contest
PROGRAMMING
800
[ "brute force", "implementation", "sortings" ]
null
null
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest. In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings. He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position. GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students. The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
[ "3\n1 3 3\n", "1\n1\n", "5\n3 5 3 4 5\n" ]
[ "3 1 1\n", "1\n", "4 1 4 3 1\n" ]
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating. In the second sample, first student is the only one on the contest. In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
500
[ { "input": "3\n1 3 3", "output": "3 1 1" }, { "input": "1\n1", "output": "1" }, { "input": "5\n3 5 3 4 5", "output": "4 1 4 3 1" }, { "input": "7\n1 3 5 4 2 2 1", "output": "6 3 1 2 4 4 6" }, { "input": "11\n5 6 4 2 9 7 6 6 6 6 7", "output": "9 4 10 11 1 2 4 4 4 4 2" }, { "input": "1\n2000", "output": "1" }, { "input": "2\n2000 2000", "output": "1 1" }, { "input": "3\n500 501 502", "output": "3 2 1" }, { "input": "10\n105 106 1 1 1 11 1000 999 1000 999", "output": "6 5 8 8 8 7 1 3 1 3" }, { "input": "6\n1 2 3 4 5 6", "output": "6 5 4 3 2 1" }, { "input": "7\n6 5 4 3 2 1 1", "output": "1 2 3 4 5 6 6" }, { "input": "8\n153 100 87 14 10 8 6 5", "output": "1 2 3 4 5 6 7 8" }, { "input": "70\n11 54 37 62 1 46 13 17 38 47 28 15 63 5 61 34 49 66 32 59 3 41 58 28 23 62 41 64 20 5 14 41 10 37 51 32 65 46 61 8 15 19 16 44 31 42 19 46 66 25 26 58 60 5 19 18 69 53 20 40 45 27 24 41 32 23 57 56 62 10", "output": "62 18 35 7 70 23 61 56 34 22 42 58 6 66 10 37 21 2 38 13 69 29 14 42 48 7 29 5 50 66 60 29 63 35 20 38 4 23 10 65 58 52 57 27 41 28 52 23 2 46 45 14 12 66 52 55 1 19 50 33 26 44 47 29 38 48 16 17 7 63" }, { "input": "5\n1 2000 1 1 2000", "output": "3 1 3 3 1" } ]
1,476,351,266
2,147,483,647
Python 3
OK
TESTS
36
93
4,915,200
import sys n = int(input()) alist = list(map(int, sys.stdin.readline().split())) blist = sorted(alist)[::-1] clist = [str(blist.index(a)+1) for a in alist] print(' '.join(clist))
Title: GukiZ and Contest Time Limit: None seconds Memory Limit: None megabytes Problem Description: Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest. In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings. He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position. GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students. The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*). Output Specification: In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input. Demo Input: ['3\n1 3 3\n', '1\n1\n', '5\n3 5 3 4 5\n'] Demo Output: ['3 1 1\n', '1\n', '4 1 4 3 1\n'] Note: In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating. In the second sample, first student is the only one on the contest. In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
```python import sys n = int(input()) alist = list(map(int, sys.stdin.readline().split())) blist = sorted(alist)[::-1] clist = [str(blist.index(a)+1) for a in alist] print(' '.join(clist)) ```
3
263
A
Beautiful Matrix
PROGRAMMING
800
[ "implementation" ]
null
null
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix: 1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=&lt;<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=&lt;<=5). You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
[ "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n", "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n" ]
[ "3\n", "1\n" ]
none
500
[ { "input": "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "0" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1", "output": "4" }, { "input": "0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "4" }, { "input": "0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "4" }, { "input": "0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0", "output": "4" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0", "output": "3" } ]
1,695,645,621
2,147,483,647
Python 3
OK
TESTS
25
92
0
#263a #2300011863 张骏逸 for i in range(5): l=list(map(str,input().split())) if '1' in l:#双重循环也可以找1,但是不如in x=i;y=l.index('1') dis=abs(x-2)+abs(y-2) print(dis)
Title: Beautiful Matrix Time Limit: None seconds Memory Limit: None megabytes Problem Description: You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix: 1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=&lt;<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=&lt;<=5). You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful. Input Specification: The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one. Output Specification: Print a single integer — the minimum number of moves needed to make the matrix beautiful. Demo Input: ['0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n', '0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n'] Demo Output: ['3\n', '1\n'] Note: none
```python #263a #2300011863 张骏逸 for i in range(5): l=list(map(str,input().split())) if '1' in l:#双重循环也可以找1,但是不如in x=i;y=l.index('1') dis=abs(x-2)+abs(y-2) print(dis) ```
3
988
A
Diverse Team
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
There are $n$ students in a school class, the rating of the $i$-th student on Codehorses is $a_i$. You have to form a team consisting of $k$ students ($1 \le k \le n$) such that the ratings of all team members are distinct. If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct numbers which should be the indices of students in the team you form. If there are multiple answers, print any of them.
The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) — the number of students and the size of the team you have to form. The second line contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the rating of $i$-th student.
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct integers from $1$ to $n$ which should be the indices of students in the team you form. All the ratings of the students in the team should be distinct. You may print the indices in any order. If there are multiple answers, print any of them. Assume that the students are numbered from $1$ to $n$.
[ "5 3\n15 13 15 15 12\n", "5 4\n15 13 15 15 12\n", "4 4\n20 10 40 30\n" ]
[ "YES\n1 2 5 \n", "NO\n", "YES\n1 2 3 4 \n" ]
All possible answers for the first example: - {1 2 5} - {2 3 5} - {2 4 5} Note that the order does not matter.
0
[ { "input": "5 3\n15 13 15 15 12", "output": "YES\n1 2 5 " }, { "input": "5 4\n15 13 15 15 12", "output": "NO" }, { "input": "4 4\n20 10 40 30", "output": "YES\n1 2 3 4 " }, { "input": "1 1\n1", "output": "YES\n1 " }, { "input": "100 53\n16 17 1 2 27 5 9 9 53 24 17 33 35 24 20 48 56 73 12 14 39 55 58 13 59 73 29 26 40 33 22 29 34 22 55 38 63 66 36 13 60 42 10 15 21 9 11 5 23 37 79 47 26 3 79 53 44 8 71 75 42 11 34 39 79 33 10 26 23 23 17 14 54 41 60 31 83 5 45 4 14 35 6 60 28 48 23 18 60 36 21 28 7 34 9 25 52 43 54 19", "output": "YES\n1 2 3 4 5 6 7 9 10 12 13 15 16 17 18 19 20 21 22 23 24 25 27 28 29 31 33 36 37 38 39 41 42 43 44 45 47 49 50 51 52 54 57 58 59 60 73 74 76 77 79 80 83 " }, { "input": "2 2\n100 100", "output": "NO" }, { "input": "2 2\n100 99", "output": "YES\n1 2 " }, { "input": "100 100\n63 100 75 32 53 24 73 98 76 15 70 48 8 81 88 58 95 78 27 92 14 16 72 43 46 39 66 38 64 42 59 9 22 51 4 6 10 94 28 99 68 80 35 50 45 20 47 7 30 26 49 91 77 19 96 57 65 1 11 13 31 12 82 87 93 34 62 3 21 79 56 41 89 18 44 23 74 86 2 33 69 36 61 67 25 83 5 84 90 37 40 29 97 60 52 55 54 71 17 85", "output": "YES\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 " }, { "input": "100 41\n54 16 42 3 45 6 9 72 100 13 24 57 35 5 89 13 97 27 43 9 73 89 48 16 48 55 18 15 55 28 30 6 18 41 100 61 9 42 35 54 57 25 73 15 42 54 49 5 72 48 30 55 4 43 94 5 60 92 93 23 89 75 53 92 74 93 89 28 69 6 3 49 15 28 49 57 54 55 30 57 69 18 89 6 25 23 93 74 30 13 87 53 6 42 4 54 60 30 4 35", "output": "NO" }, { "input": "100 2\n70 64 70 32 70 64 32 70 64 32 32 64 70 64 64 32 64 64 64 70 70 64 64 64 64 70 32 64 70 64 32 70 70 70 64 70 64 70 64 32 70 32 70 64 64 64 32 70 64 70 70 32 70 32 32 32 70 32 70 32 64 64 70 32 32 64 70 64 32 32 64 64 32 32 70 70 32 70 32 64 32 70 64 64 32 64 32 64 70 32 70 32 70 64 64 64 70 70 64 70", "output": "YES\n1 2 " } ]
1,678,511,896
256
Python 3
OK
TESTS
10
31
0
n,k = list(map(int,input().split())) arr = list(map(int,input().split())) ln = len(set(arr)) st = list(set(arr)) if ln<k: print("NO") else: ans =[] for i in range(k): ans.append(arr.index(st[i])+1) print('YES') print(*ans)
Title: Diverse Team Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are $n$ students in a school class, the rating of the $i$-th student on Codehorses is $a_i$. You have to form a team consisting of $k$ students ($1 \le k \le n$) such that the ratings of all team members are distinct. If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct numbers which should be the indices of students in the team you form. If there are multiple answers, print any of them. Input Specification: The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) — the number of students and the size of the team you have to form. The second line contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the rating of $i$-th student. Output Specification: If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct integers from $1$ to $n$ which should be the indices of students in the team you form. All the ratings of the students in the team should be distinct. You may print the indices in any order. If there are multiple answers, print any of them. Assume that the students are numbered from $1$ to $n$. Demo Input: ['5 3\n15 13 15 15 12\n', '5 4\n15 13 15 15 12\n', '4 4\n20 10 40 30\n'] Demo Output: ['YES\n1 2 5 \n', 'NO\n', 'YES\n1 2 3 4 \n'] Note: All possible answers for the first example: - {1 2 5} - {2 3 5} - {2 4 5} Note that the order does not matter.
```python n,k = list(map(int,input().split())) arr = list(map(int,input().split())) ln = len(set(arr)) st = list(set(arr)) if ln<k: print("NO") else: ans =[] for i in range(k): ans.append(arr.index(st[i])+1) print('YES') print(*ans) ```
3
442
A
Borya and Hanabi
PROGRAMMING
1,700
[ "bitmasks", "brute force", "implementation" ]
null
null
Have you ever played Hanabi? If not, then you've got to try it out! This problem deals with a simplified version of the game. Overall, the game has 25 types of cards (5 distinct colors and 5 distinct values). Borya is holding *n* cards. The game is somewhat complicated by the fact that everybody sees Borya's cards except for Borya himself. Borya knows which cards he has but he knows nothing about the order they lie in. Note that Borya can have multiple identical cards (and for each of the 25 types of cards he knows exactly how many cards of this type he has). The aim of the other players is to achieve the state when Borya knows the color and number value of each of his cards. For that, other players can give him hints. The hints can be of two types: color hints and value hints. A color hint goes like that: a player names some color and points at all the cards of this color. Similarly goes the value hint. A player names some value and points at all the cards that contain the value. Determine what minimum number of hints the other players should make for Borya to be certain about each card's color and value.
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Borya's cards. The next line contains the descriptions of *n* cards. The description of each card consists of exactly two characters. The first character shows the color (overall this position can contain five distinct letters — R, G, B, Y, W). The second character shows the card's value (a digit from 1 to 5). Borya doesn't know exact order of the cards they lie in.
Print a single integer — the minimum number of hints that the other players should make.
[ "2\nG3 G3\n", "4\nG4 R4 R3 B3\n", "5\nB1 Y1 W1 G1 R1\n" ]
[ "0\n", "2\n", "4\n" ]
In the first sample Borya already knows for each card that it is a green three. In the second sample we can show all fours and all red cards. In the third sample you need to make hints about any four colors.
500
[ { "input": "2\nG3 G3", "output": "0" }, { "input": "4\nG4 R4 R3 B3", "output": "2" }, { "input": "5\nB1 Y1 W1 G1 R1", "output": "4" }, { "input": "10\nY4 B1 R3 G5 R5 W3 W5 W2 R1 Y1", "output": "6" }, { "input": "3\nG4 G3 B4", "output": "2" }, { "input": "2\nW3 Y5", "output": "1" }, { "input": "2\nW5 Y5", "output": "1" }, { "input": "100\nW4 Y1 W5 R4 W3 Y1 R4 W2 G3 G1 B5 Y5 Y2 Y3 G4 B5 W1 G5 Y5 Y3 G2 Y5 Y5 G5 R2 B3 B1 W5 Y1 W5 B4 W4 R4 B1 R1 W3 R5 R4 G2 W3 W3 R2 W5 Y2 B2 R3 R3 Y1 G5 G2 Y1 R4 Y5 W5 G5 B3 W2 R1 B2 W2 W2 Y5 W3 G1 B1 G2 Y3 W3 G1 W5 W1 G5 G2 Y1 W5 B5 W4 Y5 G2 R3 B4 R5 B1 R1 B4 Y4 Y4 Y3 R5 Y3 B3 W5 R5 Y5 G2 G5 W5 B4 G4 W5", "output": "8" }, { "input": "100\nB5 G3 Y2 W3 W1 G1 Y4 G3 G4 B5 W4 B5 Y3 R5 B4 G4 G4 B1 G1 R5 G4 B4 G1 G2 W1 Y4 R5 Y3 W5 W4 Y5 W1 B4 G3 R2 R3 W1 B4 Y4 G2 G2 R1 Y5 W1 Y3 B3 G5 Y3 G3 W2 W5 Y4 B2 Y5 R4 B2 Y3 W4 G2 G3 R2 W1 B4 B2 B1 Y2 Y2 Y3 W3 Y5 W1 R1 R1 R4 R4 R4 Y1 Y3 B2 Y3 Y1 R3 G4 G4 Y5 B5 W2 G1 G5 B3 G1 Y1 R2 G5 R2 Y5 R5 Y4 R4 W2", "output": "8" }, { "input": "100\nY3 Y3 Y5 Y2 Y4 Y1 Y2 Y3 Y1 Y5 Y3 Y1 Y4 Y5 Y5 Y3 Y1 Y5 Y2 Y3 Y1 Y4 Y4 Y1 Y2 Y2 Y4 Y2 Y4 Y5 Y5 Y2 Y3 Y1 Y3 Y5 Y3 Y1 Y5 Y3 Y3 Y2 Y5 Y1 Y5 Y5 Y4 Y2 Y2 Y1 Y2 Y4 Y3 Y2 Y5 Y3 Y4 Y3 Y1 Y4 Y2 Y4 Y4 Y3 Y3 Y1 Y1 Y4 Y2 Y5 Y3 Y4 Y4 Y4 Y3 Y2 Y2 Y2 Y3 Y4 Y4 Y2 Y1 Y2 Y2 Y4 Y3 Y5 Y4 Y2 Y5 Y3 Y1 Y5 Y2 Y5 Y4 Y1 Y2 Y1", "output": "4" }, { "input": "100\nG3 B3 G3 Y3 R3 G3 R3 G3 W3 B3 B3 B3 R3 Y3 Y3 W3 R3 B3 G3 W3 G3 W3 Y3 R3 Y3 W3 W3 G3 W3 G3 W3 Y3 G3 R3 Y3 W3 W3 Y3 Y3 Y3 R3 W3 R3 G3 W3 W3 G3 Y3 B3 W3 B3 Y3 G3 Y3 B3 Y3 W3 Y3 R3 Y3 R3 W3 W3 W3 G3 Y3 G3 R3 B3 R3 Y3 R3 Y3 R3 Y3 R3 Y3 R3 W3 Y3 R3 W3 W3 W3 G3 G3 Y3 B3 Y3 R3 G3 G3 B3 B3 Y3 R3 G3 R3 W3 G3", "output": "4" }, { "input": "100\nW5 Y5 Y3 W3 Y5 Y5 W5 W5 Y3 W5 Y5 Y3 W5 Y5 W5 W3 Y3 Y5 W3 W5 Y5 W3 Y5 Y3 W3 W3 Y3 Y5 W3 W3 Y3 Y5 W3 Y5 Y5 Y5 W5 Y5 W5 Y5 W5 W5 W3 W5 W3 Y3 W5 W3 W3 W5 Y3 Y5 W5 W5 W3 W5 W5 Y5 W5 W3 W3 W3 Y3 Y5 Y5 Y3 Y5 W5 W5 Y5 W3 W3 W5 Y5 Y5 Y3 W5 W5 W3 Y5 W3 W5 Y3 Y5 W5 Y3 Y3 W3 Y3 Y5 Y3 Y3 W5 Y5 Y3 Y5 Y3 W3 Y3 W5", "output": "2" }, { "input": "100\nY5 Y5 Y3 Y5 Y3 Y5 Y5 Y5 Y3 Y3 Y5 Y3 Y3 Y5 Y3 Y3 Y5 Y3 Y3 Y5 Y3 Y5 Y5 Y3 Y3 Y5 Y3 Y5 Y3 Y3 Y3 Y5 Y3 Y3 Y3 Y3 Y3 Y3 Y3 Y5 Y5 Y5 Y5 Y3 Y5 Y5 Y5 Y5 Y3 Y3 Y3 Y5 Y5 Y3 Y3 Y3 Y5 Y3 Y3 Y5 Y3 Y3 Y3 Y5 Y3 Y5 Y5 Y5 Y5 Y3 Y3 Y5 Y5 Y5 Y5 Y5 Y5 Y5 Y5 Y3 Y5 Y5 Y5 Y5 Y5 Y5 Y3 Y5 Y3 Y5 Y5 Y5 Y5 Y5 Y5 Y3 Y3 Y3 Y5 Y5", "output": "1" }, { "input": "100\nY3 Y3 Y3 W3 W3 Y3 Y3 W3 Y3 Y3 W3 Y3 Y3 Y3 W3 Y3 Y3 W3 Y3 Y3 Y3 W3 Y3 W3 W3 W3 W3 W3 Y3 Y3 W3 Y3 Y3 W3 W3 Y3 Y3 W3 Y3 Y3 W3 W3 W3 W3 W3 Y3 Y3 Y3 Y3 W3 Y3 Y3 W3 W3 W3 Y3 W3 W3 W3 Y3 Y3 Y3 Y3 W3 W3 W3 W3 W3 Y3 Y3 W3 Y3 W3 Y3 Y3 Y3 Y3 Y3 Y3 Y3 W3 W3 W3 W3 Y3 W3 Y3 Y3 Y3 Y3 Y3 Y3 Y3 Y3 W3 Y3 Y3 W3 W3 Y3", "output": "1" }, { "input": "10\nW1 Y4 Y3 W3 Y2 W2 W1 Y2 Y3 W3", "output": "3" }, { "input": "10\nW2 R2 B5 W5 W2 B3 B2 R5 Y5 R2", "output": "5" }, { "input": "5\nW3 Y5 W2 G3 Y3", "output": "3" }, { "input": "5\nW5 G5 W2 Y5 G2", "output": "3" }, { "input": "5\nW5 W3 Y3 Y5 W2", "output": "3" }, { "input": "5\nY5 W3 W2 G5 W3", "output": "3" }, { "input": "5\nG5 G3 G5 G5 W2", "output": "2" }, { "input": "5\nW2 Y2 G3 G3 G3", "output": "2" }, { "input": "5\nG3 Y5 Y2 Y5 W3", "output": "3" }, { "input": "5\nW3 W5 Y3 W2 G5", "output": "3" }, { "input": "5\nY3 Y2 Y3 Y5 Y5", "output": "2" }, { "input": "5\nW5 Y3 W5 W5 Y5", "output": "2" }, { "input": "5\nG3 Y3 G3 Y3 G3", "output": "1" }, { "input": "5\nG4 W5 Y4 Y4 R5", "output": "3" }, { "input": "5\nG3 R2 R5 B3 W4", "output": "4" }, { "input": "5\nW2 G5 W3 R4 R4", "output": "3" }, { "input": "5\nY3 Y3 G3 Y3 W3", "output": "2" }, { "input": "5\nW5 W5 W3 Y3 Y5", "output": "2" }, { "input": "35\nG5 G5 G3 G2 G3 Y3 W3 Y3 G5 W5 G2 G2 W5 G5 G5 W3 G3 G2 Y3 W5 W3 G5 W5 G2 Y2 Y3 W5 G3 W3 W2 G2 W3 Y2 G3 G3", "output": "4" }, { "input": "35\nG3 G2 G5 G2 W2 G3 W2 W5 Y5 G5 W2 W2 W2 G5 Y2 G5 W5 W3 W2 Y2 G5 W5 W3 W5 Y2 Y5 W2 W2 W3 Y3 G2 W3 G5 G3 W2", "output": "4" }, { "input": "35\nW2 W3 Y2 G5 G2 W3 G5 Y2 W5 Y5 W3 G2 G3 W5 W2 W3 Y2 Y5 Y2 Y5 Y2 Y2 G2 Y5 W3 Y5 G3 Y2 G3 Y2 Y5 W5 G3 W5 W5", "output": "4" }, { "input": "35\nY2 Y3 Y2 Y3 Y5 Y5 Y3 Y5 Y5 Y2 Y2 Y5 Y2 Y2 Y5 Y3 Y2 Y5 Y5 Y3 Y3 Y2 Y2 Y2 Y3 Y5 Y2 Y5 Y5 Y3 Y5 Y2 Y3 Y3 Y2", "output": "2" }, { "input": "35\nY5 Y5 W5 Y5 W3 Y3 W5 W3 W5 W3 W5 Y5 Y3 W3 W5 W5 W5 W3 Y5 Y3 Y5 W5 W5 Y3 Y5 Y5 Y3 W5 W3 W3 W3 W5 Y5 W3 W5", "output": "2" }, { "input": "35\nG3 G3 W3 W3 G3 G3 Y3 G3 Y3 Y3 G3 W3 Y3 G3 W3 Y3 W3 Y3 Y3 Y3 Y3 G3 G3 Y3 Y3 G3 G3 G3 G3 G3 Y3 W3 W3 W3 G3", "output": "2" }, { "input": "35\nR2 R2 R2 R2 G3 G2 Y3 G2 R3 W5 G4 Y3 Y3 G2 Y5 W5 G4 G2 W4 Y2 W3 R5 W5 G4 G4 Y2 G2 Y5 G2 Y4 W3 G5 G2 R3 G4", "output": "6" }, { "input": "35\nG2 Y1 Y1 R4 G5 B5 R2 G4 G2 G3 W4 W1 B3 W5 R2 Y5 R4 R4 B5 Y2 B4 B1 R3 G4 Y3 G2 R4 G3 B2 G2 R3 B2 R1 W2 B4", "output": "8" }, { "input": "35\nW4 Y5 Y3 Y3 R5 W3 R5 W2 R5 Y2 R2 Y2 G2 G3 Y4 Y4 R4 Y3 G2 W2 R2 R3 Y3 W5 W2 G4 R3 R3 W2 W5 Y4 R3 W2 R4 R2", "output": "6" }, { "input": "35\nY3 Y3 Y3 Y3 Y3 Y3 W3 G3 G3 G3 W3 G3 G3 Y3 Y3 W3 G3 G3 Y3 W3 W3 Y3 Y3 G3 W3 W3 G3 Y3 Y3 W3 G3 W3 G3 W3 G3", "output": "2" }, { "input": "35\nW3 Y3 W3 W5 Y5 W3 W3 Y5 W3 W3 W3 W5 W3 Y3 Y5 Y3 Y5 Y3 W3 W3 W5 W5 W3 Y5 W3 W3 Y3 W3 W5 W3 Y3 Y3 Y5 Y5 Y3", "output": "2" }, { "input": "25\nY3 R2 R2 Y2 Y5 Y4 B3 B3 Y4 W3 R1 W3 W5 B5 R1 Y4 B4 B5 B3 G3 B1 R2 R4 G5 Y5", "output": "7" }, { "input": "25\nW5 R1 Y3 G5 G3 G5 W2 Y1 R3 R4 B3 G5 G2 Y2 W1 G2 Y1 B4 Y2 G3 G3 Y4 W3 W5 Y2", "output": "7" }, { "input": "25\nY1 W2 G3 W1 G1 G3 G4 W1 B2 W3 R4 B1 G2 Y4 G1 R2 R3 Y4 B2 G4 W2 Y2 R2 Y5 R4", "output": "7" }, { "input": "25\nB3 Y1 R3 Y3 R5 B4 B3 G1 R1 B4 B5 W3 R4 W1 B3 Y3 B3 Y4 B2 G5 Y1 G5 R4 B5 Y1", "output": "7" }, { "input": "25\nG4 R4 Y1 Y4 R3 B5 W2 G4 B5 B2 G1 B4 R4 G2 Y3 Y4 G5 Y3 R1 G2 Y5 G3 Y3 Y4 W3", "output": "8" }, { "input": "25\nR1 R3 G1 B5 Y5 W3 R4 R4 R1 G3 R2 W1 B1 G2 W2 G4 R2 W3 B1 W3 B5 Y5 R2 B4 B5", "output": "7" }, { "input": "5\nW3 B1 Y1 R3 Y5", "output": "3" }, { "input": "4\nR1 R2 G1 Y5", "output": "2" }, { "input": "4\nR1 R2 G1 B3", "output": "2" }, { "input": "15\nY3 R4 G1 W1 R3 R2 W4 W1 R5 Y4 G3 R5 Y2 W1 Y1", "output": "6" }, { "input": "4\nG5 W5 W4 R3", "output": "2" } ]
1,525,611,664
2,147,483,647
Python 3
OK
TESTS
54
171
7,475,200
from itertools import chain, combinations from copy import deepcopy def powerset(iterable): s = list(iterable) return chain.from_iterable(combinations(s, r) for r in range(len(s)+1)) n = int(input()) locations = input().split() matrixG = [[0]*5 for i in range(5)] for i in locations: if i[0] == "R": matrixG[0][int(i[1])-1] += 1 elif i[0] == "G": matrixG[1][int(i[1])-1] += 1 elif i[0] == "B": matrixG[2][int(i[1])-1] += 1 elif i[0] == "Y": matrixG[3][int(i[1])-1] += 1 elif i[0] == "W": matrixG[4][int(i[1])-1] += 1 for i in list(powerset(range(10))): matrix = deepcopy(matrixG) color = [] value = [] for j in i: if j <= 4: color.append(j) else: value.append(j) for v in value: for c in color: matrix[c][v-5] = 0 ctr = 0 for r in range(5): if matrix[r][v-5] == 0: ctr += 1 if ctr == 4: for r in range(5): matrix[r][v-5] = 0 for c in color: if matrix[c].count(0) == 4: matrix[c] = [0]*5 ctr = 0 for k in range(5): for j in range(5): if matrix[k][j] == 0: ctr += 1 if ctr == 24: print(len(i)) break
Title: Borya and Hanabi Time Limit: None seconds Memory Limit: None megabytes Problem Description: Have you ever played Hanabi? If not, then you've got to try it out! This problem deals with a simplified version of the game. Overall, the game has 25 types of cards (5 distinct colors and 5 distinct values). Borya is holding *n* cards. The game is somewhat complicated by the fact that everybody sees Borya's cards except for Borya himself. Borya knows which cards he has but he knows nothing about the order they lie in. Note that Borya can have multiple identical cards (and for each of the 25 types of cards he knows exactly how many cards of this type he has). The aim of the other players is to achieve the state when Borya knows the color and number value of each of his cards. For that, other players can give him hints. The hints can be of two types: color hints and value hints. A color hint goes like that: a player names some color and points at all the cards of this color. Similarly goes the value hint. A player names some value and points at all the cards that contain the value. Determine what minimum number of hints the other players should make for Borya to be certain about each card's color and value. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Borya's cards. The next line contains the descriptions of *n* cards. The description of each card consists of exactly two characters. The first character shows the color (overall this position can contain five distinct letters — R, G, B, Y, W). The second character shows the card's value (a digit from 1 to 5). Borya doesn't know exact order of the cards they lie in. Output Specification: Print a single integer — the minimum number of hints that the other players should make. Demo Input: ['2\nG3 G3\n', '4\nG4 R4 R3 B3\n', '5\nB1 Y1 W1 G1 R1\n'] Demo Output: ['0\n', '2\n', '4\n'] Note: In the first sample Borya already knows for each card that it is a green three. In the second sample we can show all fours and all red cards. In the third sample you need to make hints about any four colors.
```python from itertools import chain, combinations from copy import deepcopy def powerset(iterable): s = list(iterable) return chain.from_iterable(combinations(s, r) for r in range(len(s)+1)) n = int(input()) locations = input().split() matrixG = [[0]*5 for i in range(5)] for i in locations: if i[0] == "R": matrixG[0][int(i[1])-1] += 1 elif i[0] == "G": matrixG[1][int(i[1])-1] += 1 elif i[0] == "B": matrixG[2][int(i[1])-1] += 1 elif i[0] == "Y": matrixG[3][int(i[1])-1] += 1 elif i[0] == "W": matrixG[4][int(i[1])-1] += 1 for i in list(powerset(range(10))): matrix = deepcopy(matrixG) color = [] value = [] for j in i: if j <= 4: color.append(j) else: value.append(j) for v in value: for c in color: matrix[c][v-5] = 0 ctr = 0 for r in range(5): if matrix[r][v-5] == 0: ctr += 1 if ctr == 4: for r in range(5): matrix[r][v-5] = 0 for c in color: if matrix[c].count(0) == 4: matrix[c] = [0]*5 ctr = 0 for k in range(5): for j in range(5): if matrix[k][j] == 0: ctr += 1 if ctr == 24: print(len(i)) break ```
3
106
B
Choosing Laptop
PROGRAMMING
1,000
[ "brute force", "implementation" ]
B. Choosing Laptop
2
256
Vasya is choosing a laptop. The shop has *n* laptops to all tastes. Vasya is interested in the following properties: processor speed, ram and hdd. Vasya is a programmer and not a gamer which is why he is not interested in all other properties. If all three properties of a laptop are strictly less than those properties of some other laptop, then the first laptop is considered outdated by Vasya. Among all laptops Vasya does not consider outdated, he chooses the cheapest one. There are very many laptops, which is why Vasya decided to write a program that chooses the suitable laptop. However, Vasya doesn't have his own laptop yet and he asks you to help him.
The first line contains number *n* (1<=≤<=*n*<=≤<=100). Then follow *n* lines. Each describes a laptop as *speed* *ram* *hdd* *cost*. Besides, - *speed*, *ram*, *hdd* and *cost* are integers - 1000<=≤<=*speed*<=≤<=4200 is the processor's speed in megahertz - 256<=≤<=*ram*<=≤<=4096 the RAM volume in megabytes - 1<=≤<=*hdd*<=≤<=500 is the HDD in gigabytes - 100<=≤<=*cost*<=≤<=1000 is price in tugriks All laptops have different prices.
Print a single number — the number of a laptop Vasya will choose. The laptops are numbered with positive integers from 1 to *n* in the order in which they are given in the input data.
[ "5\n2100 512 150 200\n2000 2048 240 350\n2300 1024 200 320\n2500 2048 80 300\n2000 512 180 150\n" ]
[ "4" ]
In the third sample Vasya considers the first and fifth laptops outdated as all of their properties cannot match those of the third laptop. The fourth one is the cheapest among the laptops that are left. Thus, Vasya chooses the fourth laptop.
1,000
[ { "input": "5\n2100 512 150 200\n2000 2048 240 350\n2300 1024 200 320\n2500 2048 80 300\n2000 512 180 150", "output": "4" }, { "input": "2\n1500 500 50 755\n1600 600 80 700", "output": "2" }, { "input": "2\n1500 512 50 567\n1600 400 70 789", "output": "1" }, { "input": "4\n1000 300 5 700\n1100 400 10 600\n1200 500 15 500\n1300 600 20 400", "output": "4" }, { "input": "10\n2123 389 397 747\n2705 3497 413 241\n3640 984 470 250\n3013 2004 276 905\n3658 3213 353 602\n1428 626 188 523\n2435 1140 459 824\n2927 2586 237 860\n2361 4004 386 719\n2863 2429 476 310", "output": "2" }, { "input": "25\n2123 389 397 747\n2705 3497 413 241\n3640 984 470 250\n3013 2004 276 905\n3658 3213 353 602\n1428 626 188 523\n2435 1140 459 824\n2927 2586 237 860\n2361 4004 386 719\n2863 2429 476 310\n3447 3875 1 306\n3950 1901 31 526\n4130 1886 152 535\n1951 1840 122 814\n1798 3722 474 106\n2305 3979 82 971\n3656 3148 349 992\n1062 1648 320 491\n3113 3706 302 542\n3545 1317 184 853\n1277 2153 95 492\n2189 3495 427 655\n4014 3030 22 963\n1455 3840 155 485\n2760 717 309 891", "output": "15" }, { "input": "1\n1200 512 300 700", "output": "1" }, { "input": "1\n4200 4096 500 1000", "output": "1" }, { "input": "1\n1000 256 1 100", "output": "1" }, { "input": "2\n2000 500 200 100\n3000 600 100 200", "output": "1" }, { "input": "2\n2000 500 200 200\n3000 600 100 100", "output": "2" }, { "input": "2\n2000 600 100 100\n3000 500 200 200", "output": "1" }, { "input": "2\n2000 700 100 200\n3000 500 200 100", "output": "2" }, { "input": "2\n3000 500 100 100\n1500 600 200 200", "output": "1" }, { "input": "2\n3000 500 100 300\n1500 600 200 200", "output": "2" }, { "input": "3\n3467 1566 191 888\n3047 3917 3 849\n1795 1251 97 281", "output": "2" }, { "input": "4\n3835 1035 5 848\n2222 3172 190 370\n2634 2698 437 742\n1748 3112 159 546", "output": "2" }, { "input": "5\n3511 981 276 808\n3317 2320 354 878\n3089 702 20 732\n1088 2913 327 756\n3837 691 173 933", "output": "4" }, { "input": "6\n1185 894 287 455\n2465 3317 102 240\n2390 2353 81 615\n2884 603 170 826\n3202 2070 320 184\n3074 3776 497 466", "output": "5" }, { "input": "7\n3987 1611 470 720\n1254 4048 226 626\n1747 630 25 996\n2336 2170 402 123\n1902 3952 337 663\n1416 271 77 499\n1802 1399 419 929", "output": "4" }, { "input": "10\n3888 1084 420 278\n2033 277 304 447\n1774 514 61 663\n2055 3437 67 144\n1237 1590 145 599\n3648 663 244 525\n3691 2276 332 504\n1496 2655 324 313\n2462 1930 13 644\n1811 331 390 284", "output": "4" }, { "input": "13\n3684 543 70 227\n3953 1650 151 681\n2452 655 102 946\n3003 990 121 411\n2896 1936 158 155\n1972 717 366 754\n3989 2237 32 521\n2738 2140 445 965\n2884 1772 251 369\n2240 741 465 209\n4073 2812 494 414\n3392 955 425 133\n4028 717 90 123", "output": "11" }, { "input": "17\n3868 2323 290 182\n1253 3599 38 217\n2372 354 332 897\n1286 649 332 495\n1642 1643 301 216\n1578 792 140 299\n3329 3039 359 525\n1362 2006 172 183\n1058 3961 423 591\n3196 914 484 675\n3032 3752 217 954\n2391 2853 171 579\n4102 3170 349 516\n1218 1661 451 354\n3375 1997 196 404\n1030 918 198 893\n2546 2029 399 647", "output": "14" }, { "input": "22\n1601 1091 249 107\n2918 3830 312 767\n4140 409 393 202\n3485 2409 446 291\n2787 530 272 147\n2303 3400 265 206\n2164 1088 143 667\n1575 2439 278 863\n2874 699 369 568\n4017 1625 368 641\n3446 916 53 509\n3627 3229 328 256\n1004 2525 109 670\n2369 3299 57 351\n4147 3038 73 309\n3510 3391 390 470\n3308 3139 268 736\n3733 1054 98 809\n3967 2992 408 873\n2104 3191 83 687\n2223 2910 209 563\n1406 2428 147 673", "output": "3" }, { "input": "27\n1689 1927 40 270\n3833 2570 167 134\n2580 3589 390 300\n1898 2587 407 316\n1841 2772 411 187\n1296 288 407 506\n1215 263 236 307\n2737 1427 84 992\n1107 1879 284 866\n3311 2507 475 147\n2951 2214 209 375\n1352 2582 110 324\n2082 747 289 521\n2226 1617 209 108\n2253 1993 109 835\n2866 2360 29 206\n1431 3581 185 918\n3800 1167 463 943\n4136 1156 266 490\n3511 1396 478 169\n3498 1419 493 792\n2660 2165 204 172\n3509 2358 178 469\n1568 3564 276 319\n3871 2660 472 366\n3569 2829 146 761\n1365 2943 460 611", "output": "10" }, { "input": "2\n1000 2000 300 120\n1000 2000 300 130", "output": "1" }, { "input": "10\n2883 1110 230 501\n2662 821 163 215\n2776 1131 276 870\n2776 1131 276 596\n2776 1131 276 981\n2662 821 163 892\n2662 821 163 997\n2883 1110 230 132\n2776 1131 276 317\n2883 1110 230 481", "output": "8" }, { "input": "23\n1578 3681 380 163\n2640 3990 180 576\n3278 2311 131 386\n3900 513 443 873\n1230 1143 267 313\n2640 3990 180 501\n1230 1143 267 428\n1578 3681 380 199\n1578 3681 380 490\n3900 513 443 980\n3900 513 443 882\n3278 2311 131 951\n3278 2311 131 863\n2640 3990 180 916\n3278 2311 131 406\n3278 2311 131 455\n3278 2311 131 239\n1230 1143 267 439\n3900 513 443 438\n3900 513 443 514\n3278 2311 131 526\n1578 3681 380 123\n1578 3681 380 263", "output": "22" }, { "input": "6\n2100 512 150 200\n2000 2048 240 350\n2300 1024 200 320\n2500 2048 80 300\n2000 512 180 150\n1000 256 1 100", "output": "4" }, { "input": "2\n1000 256 1 100\n1000 256 1 101", "output": "1" }, { "input": "2\n1500 500 300 1000\n1500 500 300 900", "output": "2" }, { "input": "4\n1000 256 1 500\n1000 256 1 400\n1000 256 1 300\n1000 256 1 200", "output": "4" }, { "input": "3\n1500 1024 300 150\n1200 512 150 100\n1000 256 50 200", "output": "1" } ]
1,595,958,796
2,147,483,647
Python 3
OK
TESTS
55
218
6,963,200
n = int(input().rstrip()) l = [] for i in range(n): c, m, h, p = map(int, input().rstrip().split()) l.append([c, m, h, p]) mn = 0 for i in range(n): o = False for j in range(n): if i == j: continue if (l[i][0] < l[j][0] and l[i][1] < l[j][1] and l[i][2] < l[j][2]): o = True break if not o: if mn is 0 or l[i][3] < mn: mn = l[i][3] a = i print(a + 1)
Title: Choosing Laptop Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is choosing a laptop. The shop has *n* laptops to all tastes. Vasya is interested in the following properties: processor speed, ram and hdd. Vasya is a programmer and not a gamer which is why he is not interested in all other properties. If all three properties of a laptop are strictly less than those properties of some other laptop, then the first laptop is considered outdated by Vasya. Among all laptops Vasya does not consider outdated, he chooses the cheapest one. There are very many laptops, which is why Vasya decided to write a program that chooses the suitable laptop. However, Vasya doesn't have his own laptop yet and he asks you to help him. Input Specification: The first line contains number *n* (1<=≤<=*n*<=≤<=100). Then follow *n* lines. Each describes a laptop as *speed* *ram* *hdd* *cost*. Besides, - *speed*, *ram*, *hdd* and *cost* are integers - 1000<=≤<=*speed*<=≤<=4200 is the processor's speed in megahertz - 256<=≤<=*ram*<=≤<=4096 the RAM volume in megabytes - 1<=≤<=*hdd*<=≤<=500 is the HDD in gigabytes - 100<=≤<=*cost*<=≤<=1000 is price in tugriks All laptops have different prices. Output Specification: Print a single number — the number of a laptop Vasya will choose. The laptops are numbered with positive integers from 1 to *n* in the order in which they are given in the input data. Demo Input: ['5\n2100 512 150 200\n2000 2048 240 350\n2300 1024 200 320\n2500 2048 80 300\n2000 512 180 150\n'] Demo Output: ['4'] Note: In the third sample Vasya considers the first and fifth laptops outdated as all of their properties cannot match those of the third laptop. The fourth one is the cheapest among the laptops that are left. Thus, Vasya chooses the fourth laptop.
```python n = int(input().rstrip()) l = [] for i in range(n): c, m, h, p = map(int, input().rstrip().split()) l.append([c, m, h, p]) mn = 0 for i in range(n): o = False for j in range(n): if i == j: continue if (l[i][0] < l[j][0] and l[i][1] < l[j][1] and l[i][2] < l[j][2]): o = True break if not o: if mn is 0 or l[i][3] < mn: mn = l[i][3] a = i print(a + 1) ```
3.93253
69
A
Young Physicist
PROGRAMMING
1,000
[ "implementation", "math" ]
A. Young Physicist
2
256
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
[ "3\n4 1 7\n-2 4 -1\n1 -5 -3\n", "3\n3 -1 7\n-5 2 -4\n2 -1 -3\n" ]
[ "NO", "YES" ]
none
500
[ { "input": "3\n4 1 7\n-2 4 -1\n1 -5 -3", "output": "NO" }, { "input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3", "output": "YES" }, { "input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41", "output": "NO" }, { "input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33", "output": "NO" }, { "input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7", "output": "NO" }, { "input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38", "output": "NO" }, { "input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6", "output": "YES" }, { "input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0", "output": "YES" }, { "input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0", "output": "YES" }, { "input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0", "output": "YES" }, { "input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0", "output": "YES" }, { "input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0", "output": "YES" }, { "input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87", "output": "YES" }, { "input": "3\n1 2 3\n3 2 1\n0 0 0", "output": "NO" }, { "input": "2\n5 -23 12\n0 0 0", "output": "NO" }, { "input": "1\n0 0 0", "output": "YES" }, { "input": "1\n1 -2 0", "output": "NO" }, { "input": "2\n-23 77 -86\n23 -77 86", "output": "YES" }, { "input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82", "output": "YES" }, { "input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0", "output": "YES" }, { "input": "3\n96 49 -12\n2 -66 28\n-98 17 -16", "output": "YES" }, { "input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0", "output": "YES" }, { "input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53", "output": "YES" }, { "input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1", "output": "YES" }, { "input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0", "output": "YES" }, { "input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0", "output": "YES" }, { "input": "3\n0 2 -2\n1 -1 3\n-3 0 0", "output": "NO" } ]
1,611,025,571
2,147,483,647
PyPy 3
OK
TESTS
81
312
2,355,200
import string i=lambda:map(int,input().split()); n=int(input()); a1=0; b1=0; c1=0; for l in range(n): a,b,c=i(); a1+=a; b1+=b; c1+=c; if(a1==0&b1==0&c1==0): print("YES"); else: print("NO");
Title: Young Physicist Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. Input Specification: The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). Output Specification: Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. Demo Input: ['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n'] Demo Output: ['NO', 'YES'] Note: none
```python import string i=lambda:map(int,input().split()); n=int(input()); a1=0; b1=0; c1=0; for l in range(n): a,b,c=i(); a1+=a; b1+=b; c1+=c; if(a1==0&b1==0&c1==0): print("YES"); else: print("NO"); ```
3.917613
892
A
Greed
PROGRAMMING
900
[ "greedy", "implementation" ]
null
null
Jafar has *n* cans of cola. Each can is described by two integers: remaining volume of cola *a**i* and can's capacity *b**i* (*a**i* <=≤<= *b**i*). Jafar has decided to pour all remaining cola into just 2 cans, determine if he can do this or not!
The first line of the input contains one integer *n* (2<=≤<=*n*<=≤<=100<=000) — number of cola cans. The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — volume of remaining cola in cans. The third line contains *n* space-separated integers that *b*1,<=*b*2,<=...,<=*b**n* (*a**i*<=≤<=*b**i*<=≤<=109) — capacities of the cans.
Print "YES" (without quotes) if it is possible to pour all remaining cola in 2 cans. Otherwise print "NO" (without quotes). You can print each letter in any case (upper or lower).
[ "2\n3 5\n3 6\n", "3\n6 8 9\n6 10 12\n", "5\n0 0 5 0 0\n1 1 8 10 5\n", "4\n4 1 0 3\n5 2 2 3\n" ]
[ "YES\n", "NO\n", "YES\n", "YES\n" ]
In the first sample, there are already 2 cans, so the answer is "YES".
500
[ { "input": "2\n3 5\n3 6", "output": "YES" }, { "input": "3\n6 8 9\n6 10 12", "output": "NO" }, { "input": "5\n0 0 5 0 0\n1 1 8 10 5", "output": "YES" }, { "input": "4\n4 1 0 3\n5 2 2 3", "output": "YES" }, { "input": "10\n9 10 24 11 1 7 8 3 28 14\n86 20 34 11 22 94 8 16 73 85", "output": "YES" }, { "input": "4\n25 35 7 31\n70 37 43 35", "output": "YES" }, { "input": "10\n15 26 15 14 14 39 40 4 25 39\n27 72 16 44 69 48 53 17 63 42", "output": "NO" }, { "input": "5\n22 5 19 16 32\n26 10 43 38 37", "output": "NO" }, { "input": "5\n32 4 22 40 26\n39 20 36 98 44", "output": "YES" }, { "input": "6\n18 25 3 10 13 37\n38 73 19 35 24 37", "output": "YES" }, { "input": "2\n2 2\n2 2", "output": "YES" }, { "input": "2\n2 5\n2 5", "output": "YES" }, { "input": "2\n1000 1008\n10000 2352", "output": "YES" }, { "input": "5\n1 2 3 4 5\n1 2 3 4 11", "output": "YES" }, { "input": "4\n1 0 0 0\n2 0 0 0", "output": "YES" }, { "input": "2\n0 0\n1 2", "output": "YES" }, { "input": "3\n9 13 4\n10 14 5", "output": "NO" }, { "input": "2\n0 0\n1 1", "output": "YES" }, { "input": "5\n1 1 2 3 1\n1 1 2 3 4", "output": "NO" }, { "input": "2\n0 0\n0 0", "output": "YES" }, { "input": "3\n5 1 1\n5 5 5", "output": "YES" } ]
1,512,212,734
2,147,483,647
Python 3
OK
TESTS
39
155
19,660,800
N = int(input()) s = input() t = input() S = [int(m) for m in s.split() ] T = [int(m) for m in t.split() ] if N>1: x = [] x.append(max(T)) T.remove(max(T)) x.append(max(T)) T.remove(max(T)) if sum(x)>=sum(S): print("YES") else: print("NO") else: if sum(T)> sum(S): print("YES") else: print("NO")
Title: Greed Time Limit: None seconds Memory Limit: None megabytes Problem Description: Jafar has *n* cans of cola. Each can is described by two integers: remaining volume of cola *a**i* and can's capacity *b**i* (*a**i* <=≤<= *b**i*). Jafar has decided to pour all remaining cola into just 2 cans, determine if he can do this or not! Input Specification: The first line of the input contains one integer *n* (2<=≤<=*n*<=≤<=100<=000) — number of cola cans. The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — volume of remaining cola in cans. The third line contains *n* space-separated integers that *b*1,<=*b*2,<=...,<=*b**n* (*a**i*<=≤<=*b**i*<=≤<=109) — capacities of the cans. Output Specification: Print "YES" (without quotes) if it is possible to pour all remaining cola in 2 cans. Otherwise print "NO" (without quotes). You can print each letter in any case (upper or lower). Demo Input: ['2\n3 5\n3 6\n', '3\n6 8 9\n6 10 12\n', '5\n0 0 5 0 0\n1 1 8 10 5\n', '4\n4 1 0 3\n5 2 2 3\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n', 'YES\n'] Note: In the first sample, there are already 2 cans, so the answer is "YES".
```python N = int(input()) s = input() t = input() S = [int(m) for m in s.split() ] T = [int(m) for m in t.split() ] if N>1: x = [] x.append(max(T)) T.remove(max(T)) x.append(max(T)) T.remove(max(T)) if sum(x)>=sum(S): print("YES") else: print("NO") else: if sum(T)> sum(S): print("YES") else: print("NO") ```
3
605
A
Sorting Railway Cars
PROGRAMMING
1,600
[ "constructive algorithms", "greedy" ]
null
null
An infinitely long railway has a train consisting of *n* cars, numbered from 1 to *n* (the numbers of all the cars are distinct) and positioned in arbitrary order. David Blaine wants to sort the railway cars in the order of increasing numbers. In one move he can make one of the cars disappear from its place and teleport it either to the beginning of the train, or to the end of the train, at his desire. What is the minimum number of actions David Blaine needs to perform in order to sort the train?
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of cars in the train. The second line contains *n* integers *p**i* (1<=≤<=*p**i*<=≤<=*n*, *p**i*<=≠<=*p**j* if *i*<=≠<=*j*) — the sequence of the numbers of the cars in the train.
Print a single integer — the minimum number of actions needed to sort the railway cars.
[ "5\n4 1 2 5 3\n", "4\n4 1 3 2\n" ]
[ "2\n", "2\n" ]
In the first sample you need first to teleport the 4-th car, and then the 5-th car to the end of the train.
500
[ { "input": "5\n4 1 2 5 3", "output": "2" }, { "input": "4\n4 1 3 2", "output": "2" }, { "input": "1\n1", "output": "0" }, { "input": "2\n1 2", "output": "0" }, { "input": "2\n2 1", "output": "1" }, { "input": "6\n5 3 6 1 4 2", "output": "4" }, { "input": "7\n1 2 3 6 7 4 5", "output": "2" }, { "input": "8\n6 2 1 8 5 7 3 4", "output": "5" }, { "input": "3\n1 2 3", "output": "0" }, { "input": "3\n1 3 2", "output": "1" }, { "input": "3\n2 1 3", "output": "1" }, { "input": "3\n2 3 1", "output": "1" }, { "input": "3\n3 1 2", "output": "1" }, { "input": "3\n3 2 1", "output": "2" }, { "input": "7\n1 3 5 7 2 4 6", "output": "5" }, { "input": "7\n1 5 2 6 3 7 4", "output": "3" }, { "input": "5\n1 4 2 3 5", "output": "2" }, { "input": "9\n1 6 4 5 9 8 7 3 2", "output": "7" }, { "input": "10\n5 1 6 2 8 3 4 10 9 7", "output": "6" }, { "input": "50\n39 8 41 9 45 1 5 18 38 31 28 7 12 49 33 19 26 6 42 13 37 27 2 21 20 22 14 16 48 47 32 50 25 17 35 24 36 4 29 15 43 10 11 30 40 46 3 23 44 34", "output": "46" }, { "input": "50\n43 15 10 33 32 31 13 7 5 22 36 1 25 14 38 19 8 6 24 42 28 21 44 35 4 3 49 30 27 46 2 9 17 37 45 41 18 39 12 11 16 20 50 26 29 34 40 47 48 23", "output": "47" }, { "input": "50\n10 40 34 43 50 17 15 13 9 2 32 18 11 46 27 24 36 16 29 45 42 4 47 19 48 37 41 5 21 26 22 25 44 31 35 49 20 8 12 23 6 38 14 1 7 28 3 33 39 30", "output": "46" }, { "input": "50\n10 37 3 46 45 29 36 13 21 25 35 5 18 33 12 19 50 16 30 47 20 42 39 28 2 6 38 8 7 31 22 27 26 9 15 14 34 48 4 32 40 43 44 24 11 1 23 17 49 41", "output": "46" }, { "input": "50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 42 37 38 39 40 41 36 43 44 45 46 47 48 49 50", "output": "14" }, { "input": "50\n1 2 3 4 5 6 7 8 43 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 50 33 34 35 36 37 38 39 40 41 42 9 44 45 46 47 48 49 32", "output": "27" }, { "input": "50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 49 40 41 47 43 44 45 46 42 50 39 48", "output": "11" }, { "input": "50\n1 2 3 4 27 6 7 8 9 10 30 12 13 14 15 16 17 18 19 20 21 22 23 24 28 26 5 25 29 11 31 32 33 34 38 36 37 35 39 40 41 42 43 44 45 46 47 48 49 50", "output": "36" }, { "input": "50\n1 2 3 4 5 6 7 49 9 10 17 12 13 14 15 16 11 18 19 20 21 22 23 24 25 26 27 38 29 36 30 32 33 34 35 31 37 28 39 40 41 42 43 44 45 46 47 48 8 50", "output": "38" }, { "input": "50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 31 18 19 20 21 23 22 24 25 26 27 28 29 49 17 32 33 34 39 36 37 38 47 44 41 42 43 40 45 46 35 48 30 50", "output": "33" }, { "input": "50\n1 2 15 4 5 6 7 8 9 10 11 12 13 14 3 16 17 18 19 32 21 22 36 28 23 26 27 24 29 30 31 20 33 34 37 25 35 38 40 39 41 42 43 44 45 46 47 48 49 50", "output": "39" }, { "input": "5\n4 3 1 2 5", "output": "3" }, { "input": "6\n1 3 5 6 4 2", "output": "4" }, { "input": "10\n2 1 4 3 6 5 8 7 10 9", "output": "8" }, { "input": "5\n1 2 4 5 3", "output": "2" }, { "input": "7\n1 4 2 3 7 6 5", "output": "4" }, { "input": "4\n3 1 2 4", "output": "2" }, { "input": "6\n2 5 4 3 6 1", "output": "4" }, { "input": "5\n1 3 4 5 2", "output": "2" }, { "input": "6\n2 4 6 5 1 3", "output": "4" }, { "input": "6\n1 2 4 5 6 3", "output": "3" }, { "input": "9\n9 8 7 4 5 6 3 2 1", "output": "6" }, { "input": "7\n4 1 2 3 6 5 7", "output": "4" } ]
1,450,098,954
2,147,483,647
Python 3
OK
TESTS
66
140
6,963,200
def main(): n = int(input()) l = [n] * (n + 1) for a in map(int, input().split()): l[a] = l[a - 1] - 1 print(min(l)) if __name__ == '__main__': main()
Title: Sorting Railway Cars Time Limit: None seconds Memory Limit: None megabytes Problem Description: An infinitely long railway has a train consisting of *n* cars, numbered from 1 to *n* (the numbers of all the cars are distinct) and positioned in arbitrary order. David Blaine wants to sort the railway cars in the order of increasing numbers. In one move he can make one of the cars disappear from its place and teleport it either to the beginning of the train, or to the end of the train, at his desire. What is the minimum number of actions David Blaine needs to perform in order to sort the train? Input Specification: The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of cars in the train. The second line contains *n* integers *p**i* (1<=≤<=*p**i*<=≤<=*n*, *p**i*<=≠<=*p**j* if *i*<=≠<=*j*) — the sequence of the numbers of the cars in the train. Output Specification: Print a single integer — the minimum number of actions needed to sort the railway cars. Demo Input: ['5\n4 1 2 5 3\n', '4\n4 1 3 2\n'] Demo Output: ['2\n', '2\n'] Note: In the first sample you need first to teleport the 4-th car, and then the 5-th car to the end of the train.
```python def main(): n = int(input()) l = [n] * (n + 1) for a in map(int, input().split()): l[a] = l[a - 1] - 1 print(min(l)) if __name__ == '__main__': main() ```
3
999
A
Mishka and Contest
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
Mishka started participating in a programming contest. There are $n$ problems in the contest. Mishka's problem-solving skill is equal to $k$. Mishka arranges all problems from the contest into a list. Because of his weird principles, Mishka only solves problems from one of the ends of the list. Every time, he chooses which end (left or right) he will solve the next problem from. Thus, each problem Mishka solves is either the leftmost or the rightmost problem in the list. Mishka cannot solve a problem with difficulty greater than $k$. When Mishka solves the problem, it disappears from the list, so the length of the list decreases by $1$. Mishka stops when he is unable to solve any problem from any end of the list. How many problems can Mishka solve?
The first line of input contains two integers $n$ and $k$ ($1 \le n, k \le 100$) — the number of problems in the contest and Mishka's problem-solving skill. The second line of input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the difficulty of the $i$-th problem. The problems are given in order from the leftmost to the rightmost in the list.
Print one integer — the maximum number of problems Mishka can solve.
[ "8 4\n4 2 3 1 5 1 6 4\n", "5 2\n3 1 2 1 3\n", "5 100\n12 34 55 43 21\n" ]
[ "5\n", "0\n", "5\n" ]
In the first example, Mishka can solve problems in the following order: $[4, 2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6] \rightarrow [3, 1, 5, 1, 6] \rightarrow [1, 5, 1, 6] \rightarrow [5, 1, 6]$, so the number of solved problems will be equal to $5$. In the second example, Mishka can't solve any problem because the difficulties of problems from both ends are greater than $k$. In the third example, Mishka's solving skill is so amazing that he can solve all the problems.
0
[ { "input": "8 4\n4 2 3 1 5 1 6 4", "output": "5" }, { "input": "5 2\n3 1 2 1 3", "output": "0" }, { "input": "5 100\n12 34 55 43 21", "output": "5" }, { "input": "100 100\n44 47 36 83 76 94 86 69 31 2 22 77 37 51 10 19 25 78 53 25 1 29 48 95 35 53 22 72 49 86 60 38 13 91 89 18 54 19 71 2 25 33 65 49 53 5 95 90 100 68 25 5 87 48 45 72 34 14 100 44 94 75 80 26 25 7 57 82 49 73 55 43 42 60 34 8 51 11 71 41 81 23 20 89 12 72 68 26 96 92 32 63 13 47 19 9 35 56 79 62", "output": "100" }, { "input": "100 99\n84 82 43 4 71 3 30 92 15 47 76 43 2 17 76 4 1 33 24 96 44 98 75 99 59 11 73 27 67 17 8 88 69 41 44 22 91 48 4 46 42 21 21 67 85 51 57 84 11 100 100 59 39 72 89 82 74 19 98 14 37 97 20 78 38 52 44 83 19 83 69 32 56 6 93 13 98 80 80 2 33 71 11 15 55 51 98 58 16 91 39 32 83 58 77 79 88 81 17 98", "output": "98" }, { "input": "100 69\n80 31 12 89 16 35 8 28 39 12 32 51 42 67 64 53 17 88 63 97 29 41 57 28 51 33 82 75 93 79 57 86 32 100 83 82 99 33 1 27 86 22 65 15 60 100 42 37 38 85 26 43 90 62 91 13 1 92 16 20 100 19 28 30 23 6 5 69 24 22 9 1 10 14 28 14 25 9 32 8 67 4 39 7 10 57 15 7 8 35 62 6 53 59 62 13 24 7 53 2", "output": "39" }, { "input": "100 2\n2 2 2 2 1 1 1 2 1 2 2 2 1 2 2 2 2 1 2 1 2 1 1 1 2 1 2 1 2 1 1 2 2 2 2 2 1 2 1 2 1 1 2 1 2 1 1 2 1 2 1 2 2 1 2 1 2 1 1 2 1 2 2 1 1 2 2 2 1 1 2 1 1 2 2 2 1 1 1 2 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 1 1 2 2 16", "output": "99" }, { "input": "100 3\n86 53 82 40 2 20 59 2 46 63 75 49 24 81 70 22 9 9 93 72 47 23 29 77 78 51 17 59 19 71 35 3 20 60 70 9 11 96 71 94 91 19 88 93 50 49 72 19 53 30 38 67 62 71 81 86 5 26 5 32 63 98 1 97 22 32 87 65 96 55 43 85 56 37 56 67 12 100 98 58 77 54 18 20 33 53 21 66 24 64 42 71 59 32 51 69 49 79 10 1", "output": "1" }, { "input": "13 7\n1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "13" }, { "input": "1 5\n4", "output": "1" }, { "input": "3 2\n1 4 1", "output": "2" }, { "input": "1 2\n100", "output": "0" }, { "input": "7 4\n4 2 3 4 4 2 3", "output": "7" }, { "input": "1 2\n1", "output": "1" }, { "input": "1 2\n15", "output": "0" }, { "input": "2 1\n1 1", "output": "2" }, { "input": "5 3\n3 4 3 2 1", "output": "4" }, { "input": "1 1\n2", "output": "0" }, { "input": "1 5\n1", "output": "1" }, { "input": "6 6\n7 1 1 1 1 1", "output": "5" }, { "input": "5 5\n6 5 5 5 5", "output": "4" }, { "input": "1 4\n2", "output": "1" }, { "input": "9 4\n1 2 1 2 4 2 1 2 1", "output": "9" }, { "input": "1 1\n1", "output": "1" }, { "input": "1 10\n5", "output": "1" }, { "input": "5 5\n1 1 1 1 1", "output": "5" }, { "input": "100 10\n2 5 1 10 10 2 7 7 9 4 1 8 1 1 8 4 7 9 10 5 7 9 5 6 7 2 7 5 3 2 1 82 4 80 9 8 6 1 10 7 5 7 1 5 6 7 19 4 2 4 6 2 1 8 31 6 2 2 57 42 3 2 7 1 9 5 10 8 5 4 10 8 3 5 8 7 2 7 6 5 3 3 4 10 6 7 10 8 7 10 7 2 4 6 8 10 10 2 6 4", "output": "71" }, { "input": "100 90\n17 16 5 51 17 62 24 45 49 41 90 30 19 78 67 66 59 34 28 47 42 8 33 77 90 41 61 16 86 33 43 71 90 95 23 9 56 41 24 90 31 12 77 36 90 67 47 15 92 50 79 88 42 19 21 79 86 60 41 26 47 4 70 62 44 90 82 89 84 91 54 16 90 53 29 69 21 44 18 28 88 74 56 43 12 76 10 22 34 24 27 52 28 76 90 75 5 29 50 90", "output": "63" }, { "input": "100 10\n6 4 8 4 1 9 4 8 5 2 2 5 2 6 10 2 2 5 3 5 2 3 10 5 2 9 1 1 6 1 5 9 16 42 33 49 26 31 81 27 53 63 81 90 55 97 70 51 87 21 79 62 60 91 54 95 26 26 30 61 87 79 47 11 59 34 40 82 37 40 81 2 7 1 8 4 10 7 1 10 8 7 3 5 2 8 3 3 9 2 1 1 5 7 8 7 1 10 9 8", "output": "61" }, { "input": "100 90\n45 57 52 69 17 81 85 60 59 39 55 14 87 90 90 31 41 57 35 89 74 20 53 4 33 49 71 11 46 90 71 41 71 90 63 74 51 13 99 92 99 91 100 97 93 40 93 96 100 99 100 92 98 96 78 91 91 91 91 100 94 97 95 97 96 95 17 13 45 35 54 26 2 74 6 51 20 3 73 90 90 42 66 43 86 28 84 70 37 27 90 30 55 80 6 58 57 51 10 22", "output": "72" }, { "input": "100 10\n10 2 10 10 10 10 10 10 10 7 10 10 10 10 10 10 9 10 10 10 10 10 10 10 10 7 9 10 10 10 37 10 4 10 10 10 59 5 95 10 10 10 10 39 10 10 10 10 10 10 10 5 10 10 10 10 10 10 10 10 10 10 10 10 66 10 10 10 10 10 5 10 10 10 10 10 10 44 10 10 10 10 10 10 10 10 10 10 10 7 10 10 10 10 10 10 10 10 10 2", "output": "52" }, { "input": "100 90\n57 90 90 90 90 90 90 90 81 90 3 90 39 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 92 90 90 90 90 90 90 90 90 98 90 90 90 90 90 90 90 90 90 90 90 90 90 54 90 90 90 90 90 62 90 90 91 90 90 90 90 90 90 91 90 90 90 90 90 90 90 3 90 90 90 90 90 90 90 2 90 90 90 90 90 90 90 90 90 2 90 90 90 90 90", "output": "60" }, { "input": "100 10\n10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 6 10 10 10 10 10 10 78 90 61 40 87 39 91 50 64 30 10 24 10 55 28 11 28 35 26 26 10 57 45 67 14 99 96 51 67 79 59 11 21 55 70 33 10 16 92 70 38 50 66 52 5 10 10 10 2 4 10 10 10 10 10 10 10 10 10 6 10 10 10 10 10 10 10 10 10 10 8 10 10 10 10 10", "output": "56" }, { "input": "100 90\n90 90 90 90 90 90 55 21 90 90 90 90 90 90 90 90 90 90 69 83 90 90 90 90 90 90 90 90 93 95 92 98 92 97 91 92 92 91 91 95 94 95 100 100 96 97 94 93 90 90 95 95 97 99 90 95 98 91 94 96 99 99 94 95 95 97 99 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 12 90 3 90 90 90 90 90 90 90", "output": "61" }, { "input": "100 49\n71 25 14 36 36 48 36 49 28 40 49 49 49 38 40 49 33 22 49 49 14 46 8 44 49 11 37 49 40 49 2 49 3 49 37 49 49 11 25 49 49 32 49 11 49 30 16 21 49 49 23 24 30 49 49 49 49 49 49 27 49 42 49 49 20 32 30 29 35 49 30 49 9 49 27 25 5 49 49 42 49 20 49 35 49 22 15 49 49 49 19 49 29 28 13 49 22 7 6 24", "output": "99" }, { "input": "100 50\n38 68 9 6 50 18 19 50 50 20 33 34 43 50 24 50 50 2 50 50 50 50 50 21 30 50 41 40 50 50 50 50 50 7 50 21 19 23 1 50 24 50 50 50 25 50 50 50 50 50 50 50 7 24 28 18 50 5 43 50 20 50 13 50 50 16 50 3 2 24 50 50 18 5 50 4 50 50 38 50 33 49 12 33 11 14 50 50 50 33 50 50 50 50 50 50 7 4 50 50", "output": "99" }, { "input": "100 48\n8 6 23 47 29 48 48 48 48 48 48 26 24 48 48 48 3 48 27 28 41 45 9 29 48 48 48 48 48 48 48 48 48 48 47 23 48 48 48 5 48 22 40 48 48 48 20 48 48 57 48 32 19 48 33 2 4 19 48 48 39 48 16 48 48 44 48 48 48 48 29 14 25 43 46 7 48 19 30 48 18 8 39 48 30 47 35 18 48 45 48 48 30 13 48 48 48 17 9 48", "output": "99" }, { "input": "100 57\n57 9 57 4 43 57 57 57 57 26 57 18 57 57 57 57 57 57 57 47 33 57 57 43 57 57 55 57 14 57 57 4 1 57 57 57 57 57 46 26 57 57 57 57 57 57 57 39 57 57 57 5 57 12 11 57 57 57 25 37 34 57 54 18 29 57 39 57 5 57 56 34 57 24 7 57 57 57 2 57 57 57 57 1 55 39 19 57 57 57 57 21 3 40 13 3 57 57 62 57", "output": "99" }, { "input": "100 51\n51 51 38 51 51 45 51 51 51 18 51 36 51 19 51 26 37 51 11 51 45 34 51 21 51 51 33 51 6 51 51 51 21 47 51 13 51 51 30 29 50 51 51 51 51 51 51 45 14 51 2 51 51 23 9 51 50 23 51 29 34 51 40 32 1 36 31 51 11 51 51 47 51 51 51 51 51 51 51 50 39 51 14 4 4 12 3 11 51 51 51 51 41 51 51 51 49 37 5 93", "output": "99" }, { "input": "100 50\n87 91 95 73 50 50 16 97 39 24 58 50 33 89 42 37 50 50 12 71 3 55 50 50 80 10 76 50 52 36 88 44 66 69 86 71 77 50 72 50 21 55 50 50 78 61 75 89 65 2 50 69 62 47 11 92 97 77 41 31 55 29 35 51 36 48 50 91 92 86 50 36 50 94 51 74 4 27 55 63 50 36 87 50 67 7 65 75 20 96 88 50 41 73 35 51 66 21 29 33", "output": "3" }, { "input": "100 50\n50 37 28 92 7 76 50 50 50 76 100 57 50 50 50 32 76 50 8 72 14 8 50 91 67 50 55 82 50 50 24 97 88 50 59 61 68 86 44 15 61 67 88 50 40 50 36 99 1 23 63 50 88 59 76 82 99 76 68 50 50 30 31 68 57 98 71 12 15 60 35 79 90 6 67 50 50 50 50 68 13 6 50 50 16 87 84 50 67 67 50 64 50 58 50 50 77 51 50 51", "output": "3" }, { "input": "100 50\n43 50 50 91 97 67 6 50 86 50 76 60 50 59 4 56 11 38 49 50 37 50 50 20 60 47 33 54 95 58 22 50 77 77 72 9 57 40 81 57 95 50 81 63 62 76 13 87 50 39 74 69 50 99 63 1 11 62 84 31 97 99 56 73 70 36 45 100 28 91 93 9 19 52 73 50 83 58 84 52 86 12 50 44 64 52 97 50 12 71 97 52 87 66 83 66 86 50 9 49", "output": "6" }, { "input": "88 10\n10 8 1 10 10 1 3 7 10 5 8 8 10 2 7 10 10 10 10 10 1 10 10 10 10 1 2 9 10 9 10 10 10 64 100 25 10 12 9 52 13 8 10 56 10 4 10 7 10 3 10 79 74 8 73 10 10 10 9 10 3 5 10 10 10 5 1 10 10 4 3 10 10 10 4 10 6 4 10 10 10 10 3 3 8 5 6 8", "output": "66" }, { "input": "100 50\n80 39 33 69 75 50 23 88 50 50 67 90 87 50 29 15 55 32 60 50 50 50 38 95 62 50 50 88 8 97 45 50 42 12 22 93 49 50 24 50 50 71 60 4 50 72 57 57 50 50 50 83 69 17 1 31 72 55 50 11 50 80 93 41 91 94 20 60 50 50 51 48 53 56 76 73 50 72 19 98 50 50 50 50 50 28 48 45 62 11 16 67 93 88 63 50 50 66 48 95", "output": "0" }, { "input": "100 50\n70 50 38 50 38 50 32 30 50 31 26 42 50 33 34 50 50 50 28 21 50 44 50 47 50 50 9 40 50 50 50 50 50 42 50 50 16 50 50 3 24 50 50 50 4 26 50 2 50 50 33 1 27 50 50 50 8 29 50 23 33 50 6 29 50 50 15 50 50 50 32 50 43 50 50 50 31 50 4 50 50 31 50 50 31 16 50 17 50 17 31 13 25 16 50 10 50 47 50 66", "output": "0" }, { "input": "2 8\n8 8", "output": "2" }, { "input": "1 6\n3", "output": "1" }, { "input": "1 5\n5", "output": "1" } ]
1,663,000,952
2,147,483,647
Python 3
OK
TESTS
48
61
0
(a,b)=[int(x) for x in input().split()] l=[int(x) for x in input().split()] c=0 while(bool(l)and(l[0]<=b or l[-1]<=b)): if l[0]<=b: c+=1 l=l[1:] elif l[-1]<=b: c+=1 l.pop() print(c)
Title: Mishka and Contest Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mishka started participating in a programming contest. There are $n$ problems in the contest. Mishka's problem-solving skill is equal to $k$. Mishka arranges all problems from the contest into a list. Because of his weird principles, Mishka only solves problems from one of the ends of the list. Every time, he chooses which end (left or right) he will solve the next problem from. Thus, each problem Mishka solves is either the leftmost or the rightmost problem in the list. Mishka cannot solve a problem with difficulty greater than $k$. When Mishka solves the problem, it disappears from the list, so the length of the list decreases by $1$. Mishka stops when he is unable to solve any problem from any end of the list. How many problems can Mishka solve? Input Specification: The first line of input contains two integers $n$ and $k$ ($1 \le n, k \le 100$) — the number of problems in the contest and Mishka's problem-solving skill. The second line of input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the difficulty of the $i$-th problem. The problems are given in order from the leftmost to the rightmost in the list. Output Specification: Print one integer — the maximum number of problems Mishka can solve. Demo Input: ['8 4\n4 2 3 1 5 1 6 4\n', '5 2\n3 1 2 1 3\n', '5 100\n12 34 55 43 21\n'] Demo Output: ['5\n', '0\n', '5\n'] Note: In the first example, Mishka can solve problems in the following order: $[4, 2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6] \rightarrow [3, 1, 5, 1, 6] \rightarrow [1, 5, 1, 6] \rightarrow [5, 1, 6]$, so the number of solved problems will be equal to $5$. In the second example, Mishka can't solve any problem because the difficulties of problems from both ends are greater than $k$. In the third example, Mishka's solving skill is so amazing that he can solve all the problems.
```python (a,b)=[int(x) for x in input().split()] l=[int(x) for x in input().split()] c=0 while(bool(l)and(l[0]<=b or l[-1]<=b)): if l[0]<=b: c+=1 l=l[1:] elif l[-1]<=b: c+=1 l.pop() print(c) ```
3
731
A
Night at the Museum
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition. Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture: After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'. Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input.
[ "zeus\n", "map\n", "ares\n" ]
[ "18\n", "35\n", "34\n" ]
To print the string from the first sample it would be optimal to perform the following sequence of rotations: 1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
500
[ { "input": "zeus", "output": "18" }, { "input": "map", "output": "35" }, { "input": "ares", "output": "34" }, { "input": "l", "output": "11" }, { "input": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv", "output": "99" }, { "input": "gngvi", "output": "44" }, { "input": "aaaaa", "output": "0" }, { "input": "a", "output": "0" }, { "input": "z", "output": "1" }, { "input": "vyadeehhikklnoqrs", "output": "28" }, { "input": "jjiihhhhgggfedcccbazyxx", "output": "21" }, { "input": "fyyptqqxuciqvwdewyppjdzur", "output": "117" }, { "input": "fqcnzmzmbobmancqcoalzmanaobpdse", "output": "368" }, { "input": "zzzzzaaaaaaazzzzzzaaaaaaazzzzzzaaaazzzza", "output": "8" }, { "input": "aucnwhfixuruefkypvrvnvznwtjgwlghoqtisbkhuwxmgzuljvqhmnwzisnsgjhivnjmbknptxatdkelhzkhsuxzrmlcpeoyukiy", "output": "644" }, { "input": "sssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss", "output": "8" }, { "input": "nypjygrdtpzpigzyrisqeqfriwgwlengnezppgttgtndbrryjdl", "output": "421" }, { "input": "pnllnnmmmmoqqqqqrrtssssuuvtsrpopqoonllmonnnpppopnonoopooqpnopppqppqstuuuwwwwvxzxzzaa", "output": "84" }, { "input": "btaoahqgxnfsdmzsjxgvdwjukcvereqeskrdufqfqgzqfsftdqcthtkcnaipftcnco", "output": "666" }, { "input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeerrrrrrrrrrrrrrrrwwwwwwwwww", "output": "22" }, { "input": "uyknzcrwjyzmscqucclvacmorepdgmnyhmakmmnygqwglrxkxhkpansbmruwxdeoprxzmpsvwackopujxbbkpwyeggsvjykpxh", "output": "643" }, { "input": "gzwpooohffcxwtpjgfzwtooiccxsrrokezutoojdzwsrmmhecaxwrojcbyrqlfdwwrliiib", "output": "245" }, { "input": "dbvnkktasjdwqsrzfwwtmjgbcxggdxsoeilecihduypktkkbwfbruxzzhlttrssicgdwqruddwrlbtxgmhdbatzvdxbbro", "output": "468" }, { "input": "mdtvowlktxzzbuaeiuebfeorgbdczauxsovbucactkvyvemsknsjfhifqgycqredzchipmkvzbxdjkcbyukomjlzvxzoswumned", "output": "523" }, { "input": "kkkkkkkaaaaxxaaaaaaaxxxxxxxxaaaaaaxaaaaaaaaaakkkkkkkkkaaaaaaannnnnxxxxkkkkkkkkaannnnnnna", "output": "130" }, { "input": "dffiknqqrsvwzcdgjkmpqtuwxadfhkkkmpqrtwxyadfggjmpppsuuwyyzcdgghhknnpsvvvwwwyabccffiloqruwwyyzabeeehh", "output": "163" }, { "input": "qpppmmkjihgecbyvvsppnnnkjiffeebaaywutrrqpmkjhgddbzzzywtssssqnmmljheddbbaxvusrqonmlifedbbzyywwtqnkheb", "output": "155" }, { "input": "wvvwwwvvwxxxyyyxxwwvwwvuttttttuvvwxxwxxyxxwwwwwvvuttssrssstsssssrqpqqppqrssrsrrssrssssrrsrqqrrqpppqp", "output": "57" }, { "input": "dqcpcobpcobnznamznamzlykxkxlxlylzmaobnaobpbnanbpcoaobnboaoboanzlymzmykylymylzlylymanboanaocqdqesfrfs", "output": "1236" }, { "input": "nnnnnnnnnnnnnnnnnnnnaaaaaaaaaaaaaaaaaaaakkkkkkkkkkkkkkkkkkkkkkaaaaaaaaaaaaaaaaaaaaxxxxxxxxxxxxxxxxxx", "output": "49" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "0" }, { "input": "cgilqsuwzaffilptwwbgmnttyyejkorxzflqvzbddhmnrvxchijpuwaeiimosxyycejlpquuwbfkpvbgijkqvxybdjjjptxcfkqt", "output": "331" }, { "input": "ufsepwgtzgtgjssxaitgpailuvgqweoppszjwhoxdhhhpwwdorwfrdjwcdekxiktwziqwbkvbknrtvajpyeqbjvhiikxxaejjpte", "output": "692" }, { "input": "uhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuh", "output": "1293" }, { "input": "vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvgggggggggggggggggggggggggggggggggggggggggggggggggg", "output": "16" }, { "input": "lyidmjyzbszgiwkxhhpnnthfwcvvstueionspfrvqgkvngmwyhezlosrpdnbvtcjjxxsykixwnepbumaacdzadlqhnjlcejovple", "output": "616" }, { "input": "etzqqbaveffalkdguunfmyyrzkccnxmlluxeasqmopxzfvlkbhipqdwjgrttoemruohgwukfisdhznqyvhswbbypoxgtxyappcrl", "output": "605" }, { "input": "lizussgedcbdjhrbeskhgatyozvwwekanlggcstijrniivupmcoofbaxfqrxddyzzptwxcftlhajsmmkkriarrqtkoauhcqefyud", "output": "549" }, { "input": "dvjuvgfdogpknmbowlsfjzcimnygbtjiucyeeroqwhmzwpjqxlbjkqawrdtmvxbiqufllfuqibxvmtdrwaqkjblxqjpwzmhwqore", "output": "688" }, { "input": "eeycuijtbgynmiczjfslwobmnkpgodfgvujvduyfeqchuaoktqrrairkkmmsjahltfcxwtpzzyddxrqfxabfoocmpuviinrjitsc", "output": "604" }, { "input": "cgglnakewwvzoytaghksebrhjdbcdegssuzilrcppayxtgxopybbwshvyqnzhdsifkuwghourmeottrgjwdqpihbklvfzxpomqsa", "output": "572" }, { "input": "aexullmxncckzryymfnuugdklaffevabqqztelpvojecljnhqldazdcaamubpenwxikysxxjjctvbndprsolzehywmgnvkgqvrfp", "output": "609" }, { "input": "psnoieutsvvcwfhtnnphhxkwigzsbzyjmdiyl", "output": "223" }, { "input": "aa", "output": "0" } ]
1,649,111,000
2,147,483,647
Python 3
OK
TESTS
44
46
0
word = input() default = 'a' num_of_rotation = 0 for c in word: num_clockwise = abs(ord(default)-ord(c)) num_counterclockwise = 26-num_clockwise if num_clockwise >= num_counterclockwise: num_of_rotation += num_counterclockwise else: num_of_rotation += num_clockwise default = c print(num_of_rotation)
Title: Night at the Museum Time Limit: None seconds Memory Limit: None megabytes Problem Description: Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition. Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture: After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'. Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it. Input Specification: The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters. Output Specification: Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input. Demo Input: ['zeus\n', 'map\n', 'ares\n'] Demo Output: ['18\n', '35\n', '34\n'] Note: To print the string from the first sample it would be optimal to perform the following sequence of rotations: 1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
```python word = input() default = 'a' num_of_rotation = 0 for c in word: num_clockwise = abs(ord(default)-ord(c)) num_counterclockwise = 26-num_clockwise if num_clockwise >= num_counterclockwise: num_of_rotation += num_counterclockwise else: num_of_rotation += num_clockwise default = c print(num_of_rotation) ```
3
677
A
Vanya and Fence
PROGRAMMING
800
[ "implementation" ]
null
null
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*. Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
Print a single integer — the minimum possible valid width of the road.
[ "3 7\n4 5 14\n", "6 1\n1 1 1 1 1 1\n", "6 5\n7 6 8 9 10 5\n" ]
[ "4\n", "6\n", "11\n" ]
In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4. In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough. In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
500
[ { "input": "3 7\n4 5 14", "output": "4" }, { "input": "6 1\n1 1 1 1 1 1", "output": "6" }, { "input": "6 5\n7 6 8 9 10 5", "output": "11" }, { "input": "10 420\n214 614 297 675 82 740 174 23 255 15", "output": "13" }, { "input": "10 561\n657 23 1096 487 785 66 481 554 1000 821", "output": "15" }, { "input": "100 342\n478 143 359 336 162 333 385 515 117 496 310 538 469 539 258 676 466 677 1 296 150 560 26 213 627 221 255 126 617 174 279 178 24 435 70 145 619 46 669 566 300 67 576 251 58 176 441 564 569 194 24 669 73 262 457 259 619 78 400 579 222 626 269 47 80 315 160 194 455 186 315 424 197 246 683 220 68 682 83 233 290 664 273 598 362 305 674 614 321 575 362 120 14 534 62 436 294 351 485 396", "output": "144" }, { "input": "100 290\n244 49 276 77 449 261 468 458 201 424 9 131 300 88 432 394 104 77 13 289 435 259 111 453 168 394 156 412 351 576 178 530 81 271 228 564 125 328 42 372 205 61 180 471 33 360 567 331 222 318 241 117 529 169 188 484 202 202 299 268 246 343 44 364 333 494 59 236 84 485 50 8 428 8 571 227 205 310 210 9 324 472 368 490 114 84 296 305 411 351 569 393 283 120 510 171 232 151 134 366", "output": "145" }, { "input": "1 1\n1", "output": "1" }, { "input": "1 1\n2", "output": "2" }, { "input": "46 71\n30 26 56 138 123 77 60 122 73 45 79 10 130 3 14 1 38 46 128 50 82 16 32 68 28 98 62 106 2 49 131 11 114 39 139 70 40 50 45 137 33 30 35 136 135 19", "output": "63" }, { "input": "20 723\n212 602 293 591 754 91 1135 640 80 495 845 928 1399 498 926 1431 1226 869 814 1386", "output": "31" }, { "input": "48 864\n843 1020 751 1694 18 1429 1395 1174 272 1158 1628 1233 1710 441 765 561 778 748 1501 1200 563 1263 1398 1687 1518 1640 1591 839 500 466 1603 1587 1201 1209 432 868 1159 639 649 628 9 91 1036 147 896 1557 941 518", "output": "75" }, { "input": "26 708\n549 241 821 734 945 1161 566 1268 216 30 1142 730 529 1014 255 168 796 1148 89 113 1328 286 743 871 1259 1397", "output": "41" }, { "input": "75 940\n1620 1745 1599 441 64 1466 1496 1239 1716 1475 778 106 1136 1212 1261 444 781 257 1071 747 626 232 609 1544 682 1326 469 1361 1460 1450 1207 1319 922 625 1737 1057 1698 592 692 80 1016 541 1254 201 682 1007 847 206 1066 809 259 109 240 1611 219 1455 1326 1377 1827 786 42 1002 1382 1592 543 1866 1198 334 1524 1760 340 1566 955 257 1118", "output": "116" } ]
1,690,292,305
2,147,483,647
PyPy 3-64
OK
TESTS
29
62
0
n, h = map(int, input().split()) a = list(map(int, input().split())) stnd = 0 bnd = 0 for i in range(n): if a[i] > h: bnd += 1 else: stnd += 1 print(2 * bnd + stnd)
Title: Vanya and Fence Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*. Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard? Input Specification: The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person. Output Specification: Print a single integer — the minimum possible valid width of the road. Demo Input: ['3 7\n4 5 14\n', '6 1\n1 1 1 1 1 1\n', '6 5\n7 6 8 9 10 5\n'] Demo Output: ['4\n', '6\n', '11\n'] Note: In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4. In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough. In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
```python n, h = map(int, input().split()) a = list(map(int, input().split())) stnd = 0 bnd = 0 for i in range(n): if a[i] > h: bnd += 1 else: stnd += 1 print(2 * bnd + stnd) ```
3
807
B
T-Shirt Hunt
PROGRAMMING
1,300
[ "brute force", "implementation" ]
null
null
Not so long ago the Codecraft-17 contest was held on Codeforces. The top 25 participants, and additionally random 25 participants out of those who got into top 500, will receive a Codeforces T-shirt. Unfortunately, you didn't manage to get into top 25, but you got into top 500, taking place *p*. Now the elimination round of 8VC Venture Cup 2017 is being held. It has been announced that the Codecraft-17 T-shirt winners will be chosen as follows. Let *s* be the number of points of the winner of the elimination round of 8VC Venture Cup 2017. Then the following pseudocode will be executed: Here "div" is the integer division operator, "mod" is the modulo (the remainder of division) operator. As the result of pseudocode execution, 25 integers between 26 and 500, inclusive, will be printed. These will be the numbers of places of the participants who get the Codecraft-17 T-shirts. It is guaranteed that the 25 printed integers will be pairwise distinct for any value of *s*. You're in the lead of the elimination round of 8VC Venture Cup 2017, having *x* points. You believe that having at least *y* points in the current round will be enough for victory. To change your final score, you can make any number of successful and unsuccessful hacks. A successful hack brings you 100 points, an unsuccessful one takes 50 points from you. It's difficult to do successful hacks, though. You want to win the current round and, at the same time, ensure getting a Codecraft-17 T-shirt. What is the smallest number of successful hacks you have to do to achieve that?
The only line contains three integers *p*, *x* and *y* (26<=≤<=*p*<=≤<=500; 1<=≤<=*y*<=≤<=*x*<=≤<=20000) — your place in Codecraft-17, your current score in the elimination round of 8VC Venture Cup 2017, and the smallest number of points you consider sufficient for winning the current round.
Output a single integer — the smallest number of successful hacks you have to do in order to both win the elimination round of 8VC Venture Cup 2017 and ensure getting a Codecraft-17 T-shirt. It's guaranteed that your goal is achievable for any valid input data.
[ "239 10880 9889\n", "26 7258 6123\n", "493 8000 8000\n", "101 6800 6500\n", "329 19913 19900\n" ]
[ "0\n", "2\n", "24\n", "0\n", "8\n" ]
In the first example, there is no need to do any hacks since 10880 points already bring the T-shirt to the 239-th place of Codecraft-17 (that is, you). In this case, according to the pseudocode, the T-shirts will be given to the participants at the following places: In the second example, you have to do two successful and one unsuccessful hack to make your score equal to 7408. In the third example, you need to do as many as 24 successful hacks to make your score equal to 10400. In the fourth example, it's sufficient to do 6 unsuccessful hacks (and no successful ones) to make your score equal to 6500, which is just enough for winning the current round and also getting the T-shirt.
1,000
[ { "input": "239 10880 9889", "output": "0" }, { "input": "26 7258 6123", "output": "2" }, { "input": "493 8000 8000", "output": "24" }, { "input": "101 6800 6500", "output": "0" }, { "input": "329 19913 19900", "output": "8" }, { "input": "264 19252 10888", "output": "0" }, { "input": "176 9670 9174", "output": "6" }, { "input": "42 11 6", "output": "27" }, { "input": "412 17647 15917", "output": "8" }, { "input": "91 4883 4302", "output": "12" }, { "input": "200 16031 15842", "output": "24" }, { "input": "186 18666 18329", "output": "23" }, { "input": "486 9748 9598", "output": "25" }, { "input": "180 4213 4207", "output": "27" }, { "input": "329 19989 1", "output": "0" }, { "input": "390 11676 2570", "output": "0" }, { "input": "173 7017 4512", "output": "0" }, { "input": "38 6404 5034", "output": "0" }, { "input": "364 17243 16625", "output": "0" }, { "input": "57 11066 9738", "output": "1" }, { "input": "419 9142 8622", "output": "1" }, { "input": "31 12956 10515", "output": "2" }, { "input": "412 5027 4975", "output": "2" }, { "input": "94 1231 986", "output": "3" }, { "input": "173 7783 7674", "output": "3" }, { "input": "338 8291 8008", "output": "7" }, { "input": "424 10906 10346", "output": "13" }, { "input": "168 2953 2292", "output": "17" }, { "input": "406 16527 16314", "output": "22" }, { "input": "368 1597 1506", "output": "26" }, { "input": "111 14627 14479", "output": "26" }, { "input": "400 15224 15212", "output": "27" }, { "input": "427 19269 19231", "output": "27" }, { "input": "26 10232 10220", "output": "27" }, { "input": "500 7030 7023", "output": "27" }, { "input": "26 13819 13682", "output": "0" }, { "input": "500 18737 18069", "output": "0" }, { "input": "26 20000 20000", "output": "7" }, { "input": "26 1 1", "output": "6" }, { "input": "26 20000 1", "output": "0" }, { "input": "68 51 1", "output": "0" }, { "input": "198 6550 6549", "output": "5" }, { "input": "68 50 49", "output": "5" }, { "input": "239 10927 10880", "output": "11" }, { "input": "239 10830 9889", "output": "1" }, { "input": "329 2150 1900", "output": "0" }, { "input": "164 49 48", "output": "1" }, { "input": "329 2150 2101", "output": "6" } ]
1,564,389,006
2,147,483,647
PyPy 3
OK
TESTS
48
155
1,228,800
import math def get_tshirts(S): winners = [] i = (S // 50) % 475 for x in range(25): i = (i * 96 + 42) % 475 winners.append(26 + i) return winners class CodeforcesTask807BSolution: def __init__(self): self.result = '' self.p_x_y = [] def read_input(self): self.p_x_y = [int(x) for x in input().split(" ")] def process_task(self): hacks = 0.0 if self.p_x_y[1] < self.p_x_y[2]: hacks += (self.p_x_y[2] - self.p_x_y[1]) // 100 + math.ceil((self.p_x_y[2] - self.p_x_y[1]) % 100 / 100) self.p_x_y[1] += ((self.p_x_y[2] - self.p_x_y[1]) // 100) * 100 + \ math.ceil((self.p_x_y[2] - self.p_x_y[1]) % 100 / 100) * 100 started = self.p_x_y[1] if self.p_x_y[1] > self.p_x_y[2]: self.p_x_y[1] = self.p_x_y[1] - ((self.p_x_y[1] - self.p_x_y[2]) // 50) * 50 while self.p_x_y[0] not in get_tshirts(self.p_x_y[1]): if self.p_x_y[1] >= started: hacks += 0.5 self.p_x_y[1] += 50 hacks += 0.5 self.result = str(int((hacks * 2) // 2)) def get_result(self): return self.result if __name__ == "__main__": Solution = CodeforcesTask807BSolution() Solution.read_input() Solution.process_task() print(Solution.get_result())
Title: T-Shirt Hunt Time Limit: None seconds Memory Limit: None megabytes Problem Description: Not so long ago the Codecraft-17 contest was held on Codeforces. The top 25 participants, and additionally random 25 participants out of those who got into top 500, will receive a Codeforces T-shirt. Unfortunately, you didn't manage to get into top 25, but you got into top 500, taking place *p*. Now the elimination round of 8VC Venture Cup 2017 is being held. It has been announced that the Codecraft-17 T-shirt winners will be chosen as follows. Let *s* be the number of points of the winner of the elimination round of 8VC Venture Cup 2017. Then the following pseudocode will be executed: Here "div" is the integer division operator, "mod" is the modulo (the remainder of division) operator. As the result of pseudocode execution, 25 integers between 26 and 500, inclusive, will be printed. These will be the numbers of places of the participants who get the Codecraft-17 T-shirts. It is guaranteed that the 25 printed integers will be pairwise distinct for any value of *s*. You're in the lead of the elimination round of 8VC Venture Cup 2017, having *x* points. You believe that having at least *y* points in the current round will be enough for victory. To change your final score, you can make any number of successful and unsuccessful hacks. A successful hack brings you 100 points, an unsuccessful one takes 50 points from you. It's difficult to do successful hacks, though. You want to win the current round and, at the same time, ensure getting a Codecraft-17 T-shirt. What is the smallest number of successful hacks you have to do to achieve that? Input Specification: The only line contains three integers *p*, *x* and *y* (26<=≤<=*p*<=≤<=500; 1<=≤<=*y*<=≤<=*x*<=≤<=20000) — your place in Codecraft-17, your current score in the elimination round of 8VC Venture Cup 2017, and the smallest number of points you consider sufficient for winning the current round. Output Specification: Output a single integer — the smallest number of successful hacks you have to do in order to both win the elimination round of 8VC Venture Cup 2017 and ensure getting a Codecraft-17 T-shirt. It's guaranteed that your goal is achievable for any valid input data. Demo Input: ['239 10880 9889\n', '26 7258 6123\n', '493 8000 8000\n', '101 6800 6500\n', '329 19913 19900\n'] Demo Output: ['0\n', '2\n', '24\n', '0\n', '8\n'] Note: In the first example, there is no need to do any hacks since 10880 points already bring the T-shirt to the 239-th place of Codecraft-17 (that is, you). In this case, according to the pseudocode, the T-shirts will be given to the participants at the following places: In the second example, you have to do two successful and one unsuccessful hack to make your score equal to 7408. In the third example, you need to do as many as 24 successful hacks to make your score equal to 10400. In the fourth example, it's sufficient to do 6 unsuccessful hacks (and no successful ones) to make your score equal to 6500, which is just enough for winning the current round and also getting the T-shirt.
```python import math def get_tshirts(S): winners = [] i = (S // 50) % 475 for x in range(25): i = (i * 96 + 42) % 475 winners.append(26 + i) return winners class CodeforcesTask807BSolution: def __init__(self): self.result = '' self.p_x_y = [] def read_input(self): self.p_x_y = [int(x) for x in input().split(" ")] def process_task(self): hacks = 0.0 if self.p_x_y[1] < self.p_x_y[2]: hacks += (self.p_x_y[2] - self.p_x_y[1]) // 100 + math.ceil((self.p_x_y[2] - self.p_x_y[1]) % 100 / 100) self.p_x_y[1] += ((self.p_x_y[2] - self.p_x_y[1]) // 100) * 100 + \ math.ceil((self.p_x_y[2] - self.p_x_y[1]) % 100 / 100) * 100 started = self.p_x_y[1] if self.p_x_y[1] > self.p_x_y[2]: self.p_x_y[1] = self.p_x_y[1] - ((self.p_x_y[1] - self.p_x_y[2]) // 50) * 50 while self.p_x_y[0] not in get_tshirts(self.p_x_y[1]): if self.p_x_y[1] >= started: hacks += 0.5 self.p_x_y[1] += 50 hacks += 0.5 self.result = str(int((hacks * 2) // 2)) def get_result(self): return self.result if __name__ == "__main__": Solution = CodeforcesTask807BSolution() Solution.read_input() Solution.process_task() print(Solution.get_result()) ```
3
991
B
Getting an A
PROGRAMMING
900
[ "greedy", "sortings" ]
null
null
Translator's note: in Russia's most widespread grading system, there are four grades: 5, 4, 3, 2, the higher the better, roughly corresponding to A, B, C and F respectively in American grading system. The term is coming to an end and students start thinking about their grades. Today, a professor told his students that the grades for his course would be given out automatically  — he would calculate the simple average (arithmetic mean) of all grades given out for lab works this term and round to the nearest integer. The rounding would be done in favour of the student — $4.5$ would be rounded up to $5$ (as in example 3), but $4.4$ would be rounded down to $4$. This does not bode well for Vasya who didn't think those lab works would influence anything, so he may receive a grade worse than $5$ (maybe even the dreaded $2$). However, the professor allowed him to redo some of his works of Vasya's choosing to increase his average grade. Vasya wants to redo as as few lab works as possible in order to get $5$ for the course. Of course, Vasya will get $5$ for the lab works he chooses to redo. Help Vasya — calculate the minimum amount of lab works Vasya has to redo.
The first line contains a single integer $n$ — the number of Vasya's grades ($1 \leq n \leq 100$). The second line contains $n$ integers from $2$ to $5$ — Vasya's grades for his lab works.
Output a single integer — the minimum amount of lab works that Vasya has to redo. It can be shown that Vasya can always redo enough lab works to get a $5$.
[ "3\n4 4 4\n", "4\n5 4 5 5\n", "4\n5 3 3 5\n" ]
[ "2\n", "0\n", "1\n" ]
In the first sample, it is enough to redo two lab works to make two $4$s into $5$s. In the second sample, Vasya's average is already $4.75$ so he doesn't have to redo anything to get a $5$. In the second sample Vasya has to redo one lab work to get rid of one of the $3$s, that will make the average exactly $4.5$ so the final grade would be $5$.
1,000
[ { "input": "3\n4 4 4", "output": "2" }, { "input": "4\n5 4 5 5", "output": "0" }, { "input": "4\n5 3 3 5", "output": "1" }, { "input": "1\n5", "output": "0" }, { "input": "4\n3 2 5 4", "output": "2" }, { "input": "5\n5 4 3 2 5", "output": "2" }, { "input": "8\n5 4 2 5 5 2 5 5", "output": "1" }, { "input": "5\n5 5 2 5 5", "output": "1" }, { "input": "6\n5 5 5 5 5 2", "output": "0" }, { "input": "6\n2 2 2 2 2 2", "output": "5" }, { "input": "100\n3 2 4 3 3 3 4 2 3 5 5 2 5 2 3 2 4 4 4 5 5 4 2 5 4 3 2 5 3 4 3 4 2 4 5 4 2 4 3 4 5 2 5 3 3 4 2 2 4 4 4 5 4 3 3 3 2 5 2 2 2 3 5 4 3 2 4 5 5 5 2 2 4 2 3 3 3 5 3 2 2 4 5 5 4 5 5 4 2 3 2 2 2 2 5 3 5 2 3 4", "output": "40" }, { "input": "1\n2", "output": "1" }, { "input": "1\n3", "output": "1" }, { "input": "1\n4", "output": "1" }, { "input": "4\n3 2 5 5", "output": "1" }, { "input": "6\n4 3 3 3 3 4", "output": "4" }, { "input": "8\n3 3 5 3 3 3 5 5", "output": "3" }, { "input": "10\n2 4 5 5 5 5 2 3 3 2", "output": "3" }, { "input": "20\n5 2 5 2 2 2 2 2 5 2 2 5 2 5 5 2 2 5 2 2", "output": "10" }, { "input": "25\n4 4 4 4 3 4 3 3 3 3 3 4 4 3 4 4 4 4 4 3 3 3 4 3 4", "output": "13" }, { "input": "30\n4 2 4 2 4 2 2 4 4 4 4 2 4 4 4 2 2 2 2 4 2 4 4 4 2 4 2 4 2 2", "output": "15" }, { "input": "52\n5 3 4 4 4 3 5 3 4 5 3 4 4 3 5 5 4 3 3 3 4 5 4 4 5 3 5 3 5 4 5 5 4 3 4 5 3 4 3 3 4 4 4 3 5 3 4 5 3 5 4 5", "output": "14" }, { "input": "77\n5 3 2 3 2 3 2 3 5 2 2 3 3 3 3 5 3 3 2 2 2 5 5 5 5 3 2 2 5 2 3 2 2 5 2 5 3 3 2 2 5 5 2 3 3 2 3 3 3 2 5 5 2 2 3 3 5 5 2 2 5 5 3 3 5 5 2 2 5 2 2 5 5 5 2 5 2", "output": "33" }, { "input": "55\n3 4 2 3 3 2 4 4 3 3 4 2 4 4 3 3 2 3 2 2 3 3 2 3 2 3 2 4 4 3 2 3 2 3 3 2 2 4 2 4 4 3 4 3 2 4 3 2 4 2 2 3 2 3 4", "output": "34" }, { "input": "66\n5 4 5 5 4 4 4 4 4 2 5 5 2 4 2 2 2 5 4 4 4 4 5 2 2 5 5 2 2 4 4 2 4 2 2 5 2 5 4 5 4 5 4 4 2 5 2 4 4 4 2 2 5 5 5 5 4 4 4 4 4 2 4 5 5 5", "output": "16" }, { "input": "99\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2", "output": "83" }, { "input": "100\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2", "output": "84" }, { "input": "99\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3", "output": "75" }, { "input": "100\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3", "output": "75" }, { "input": "99\n2 2 3 3 3 3 3 2 2 3 2 3 2 3 2 2 3 2 3 2 3 3 3 3 2 2 2 2 3 2 3 3 3 3 3 2 3 3 3 3 2 3 2 3 3 3 2 3 2 3 3 3 3 2 2 3 2 3 2 3 2 3 2 2 2 3 3 2 3 2 2 2 2 2 2 2 2 3 3 3 3 2 3 2 3 3 2 3 2 3 2 3 3 2 2 2 3 2 3", "output": "75" }, { "input": "100\n3 2 3 3 2 2 3 2 2 3 3 2 3 2 2 2 2 2 3 2 2 2 3 2 3 3 2 2 3 2 2 2 2 3 2 3 3 2 2 3 2 2 3 2 3 2 2 3 2 3 2 2 3 2 2 3 3 3 3 3 2 2 3 2 3 3 2 2 3 2 2 2 3 2 2 3 3 2 2 3 3 3 3 2 3 2 2 2 3 3 2 2 3 2 2 2 2 3 2 2", "output": "75" }, { "input": "99\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "50" }, { "input": "100\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "50" }, { "input": "99\n2 2 2 2 4 2 2 2 2 4 4 4 4 2 4 4 2 2 4 4 2 2 2 4 4 2 4 4 2 4 4 2 2 2 4 4 2 2 2 2 4 4 4 2 2 2 4 4 2 4 2 4 2 2 4 2 4 4 4 4 4 2 2 4 4 4 2 2 2 2 4 2 4 2 2 2 2 2 2 4 4 2 4 2 2 4 2 2 2 2 2 4 2 4 2 2 4 4 4", "output": "54" }, { "input": "100\n4 2 4 4 2 4 2 2 4 4 4 4 4 4 4 4 4 2 4 4 2 2 4 4 2 2 4 4 2 2 2 4 4 2 4 4 2 4 2 2 4 4 2 4 2 4 4 4 2 2 2 2 2 2 2 4 2 2 2 4 4 4 2 2 2 2 4 2 2 2 2 2 2 2 4 4 4 4 4 4 4 4 4 2 2 2 2 2 2 2 2 4 4 4 4 2 4 2 2 4", "output": "50" }, { "input": "99\n4 3 4 4 4 4 4 3 4 3 3 4 3 3 4 4 3 3 3 4 3 4 3 3 4 3 3 3 3 4 3 4 4 3 4 4 3 3 4 4 4 3 3 3 4 4 3 3 4 3 4 3 4 3 4 3 3 3 3 4 3 4 4 4 4 4 4 3 4 4 3 3 3 3 3 3 3 3 4 3 3 3 4 4 4 4 4 4 3 3 3 3 4 4 4 3 3 4 3", "output": "51" }, { "input": "100\n3 3 4 4 4 4 4 3 4 4 3 3 3 3 4 4 4 4 4 4 3 3 3 4 3 4 3 4 3 3 4 3 3 3 3 3 3 3 3 4 3 4 3 3 4 3 3 3 4 4 3 4 4 3 3 4 4 4 4 4 4 3 4 4 3 4 3 3 3 4 4 3 3 4 4 3 4 4 4 3 3 4 3 3 4 3 4 3 4 3 3 4 4 4 3 3 4 3 3 4", "output": "51" }, { "input": "99\n3 3 4 4 4 2 4 4 3 2 3 4 4 4 2 2 2 3 2 4 4 2 4 3 2 2 2 4 2 3 4 3 4 2 3 3 4 2 3 3 2 3 4 4 3 2 4 3 4 3 3 3 3 3 4 4 3 3 4 4 2 4 3 4 3 2 3 3 3 4 4 2 4 4 2 3 4 2 3 3 3 4 2 2 3 2 4 3 2 3 3 2 3 4 2 3 3 2 3", "output": "58" }, { "input": "100\n2 2 4 2 2 3 2 3 4 4 3 3 4 4 4 2 3 2 2 3 4 2 3 2 4 3 4 2 3 3 3 2 4 3 3 2 2 3 2 4 4 2 4 3 4 4 3 3 3 2 4 2 2 2 2 2 2 3 2 3 2 3 4 4 4 2 2 3 4 4 3 4 3 3 2 3 3 3 4 3 2 3 3 2 4 2 3 3 4 4 3 3 4 3 4 3 3 4 3 3", "output": "61" }, { "input": "99\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5", "output": "0" }, { "input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5", "output": "0" }, { "input": "99\n2 2 2 2 2 5 2 2 5 2 5 2 5 2 2 2 2 2 5 2 2 2 5 2 2 5 2 2 2 5 5 2 5 2 2 5 2 5 2 2 5 5 2 2 2 2 5 5 2 2 2 5 2 2 5 2 2 2 2 2 5 5 5 5 2 2 5 2 5 2 2 2 2 2 5 2 2 5 5 2 2 2 2 2 5 5 2 2 5 5 2 2 2 2 5 5 5 2 5", "output": "48" }, { "input": "100\n5 5 2 2 2 2 2 2 5 5 2 5 2 2 2 2 5 2 5 2 5 5 2 5 5 2 2 2 2 2 2 5 2 2 2 5 2 2 5 2 2 5 5 5 2 5 5 5 5 5 5 2 2 5 2 2 5 5 5 5 5 2 5 2 5 2 2 2 5 2 5 2 5 5 2 5 5 2 2 5 2 5 5 2 5 2 2 5 2 2 2 5 2 2 2 2 5 5 2 5", "output": "38" }, { "input": "99\n5 3 3 3 5 3 3 3 3 3 3 3 3 5 3 3 3 3 3 3 3 3 5 3 3 3 5 5 3 5 5 3 3 5 5 5 3 5 3 3 3 3 5 3 3 5 5 3 5 5 5 3 5 3 5 3 5 5 5 5 3 3 3 5 3 5 3 3 3 5 5 5 5 5 3 5 5 3 3 5 5 3 5 5 3 5 5 3 3 5 5 5 3 3 3 5 3 3 3", "output": "32" }, { "input": "100\n3 3 3 5 3 3 3 3 3 3 5 5 5 5 3 3 3 3 5 3 3 3 3 3 5 3 5 3 3 5 5 5 5 5 5 3 3 5 3 3 5 3 5 5 5 3 5 3 3 3 3 3 3 3 3 3 3 3 5 5 3 5 3 5 5 3 5 3 3 5 3 5 5 5 5 3 5 3 3 3 5 5 5 3 3 3 5 3 5 5 5 3 3 3 5 3 5 5 3 5", "output": "32" }, { "input": "99\n5 3 5 5 3 3 3 2 2 5 2 5 3 2 5 2 5 2 3 5 3 2 3 2 5 5 2 2 3 3 5 5 3 5 5 2 3 3 5 2 2 5 3 2 5 2 3 5 5 2 5 2 2 5 3 3 5 3 3 5 3 2 3 5 3 2 3 2 3 2 2 2 2 5 2 2 3 2 5 5 5 3 3 2 5 3 5 5 5 2 3 2 5 5 2 5 2 5 3", "output": "39" }, { "input": "100\n3 5 3 3 5 5 3 3 2 5 5 3 3 3 2 2 3 2 5 3 2 2 3 3 3 3 2 5 3 2 3 3 5 2 2 2 3 2 3 5 5 3 2 5 2 2 5 5 3 5 5 5 2 2 5 5 3 3 2 2 2 5 3 3 2 2 3 5 3 2 3 5 5 3 2 3 5 5 3 3 2 3 5 2 5 5 5 5 5 5 3 5 3 2 3 3 2 5 2 2", "output": "42" }, { "input": "99\n4 4 4 5 4 4 5 5 4 4 5 5 5 4 5 4 5 5 5 4 4 5 5 5 5 4 5 5 5 4 4 5 5 4 5 4 4 4 5 5 5 5 4 4 5 4 4 5 4 4 4 4 5 5 5 4 5 4 5 5 5 5 5 4 5 4 5 4 4 4 4 5 5 5 4 5 5 4 4 5 5 5 4 5 4 4 5 5 4 5 5 5 5 4 5 5 4 4 4", "output": "0" }, { "input": "100\n4 4 5 5 5 5 5 5 4 4 5 5 4 4 5 5 4 5 4 4 4 4 4 4 4 4 5 5 5 5 5 4 4 4 4 4 5 4 4 5 4 4 4 5 5 5 4 5 5 5 5 5 5 4 4 4 4 4 4 5 5 4 5 4 4 5 4 4 4 4 5 5 4 5 5 4 4 4 5 5 5 5 4 5 5 5 4 4 5 5 5 4 5 4 5 4 4 5 5 4", "output": "1" }, { "input": "99\n2 2 2 5 2 2 2 2 2 4 4 5 5 2 2 4 2 5 2 2 2 5 2 2 5 5 5 4 5 5 4 4 2 2 5 2 2 2 2 5 5 2 2 4 4 4 2 2 2 5 2 4 4 2 4 2 4 2 5 4 2 2 5 2 4 4 4 2 5 2 2 5 4 2 2 5 5 5 2 4 5 4 5 5 4 4 4 5 4 5 4 5 4 2 5 2 2 2 4", "output": "37" }, { "input": "100\n4 4 5 2 2 5 4 5 2 2 2 4 2 5 4 4 2 2 4 5 2 4 2 5 5 4 2 4 4 2 2 5 4 2 5 4 5 2 5 2 4 2 5 4 5 2 2 2 5 2 5 2 5 2 2 4 4 5 5 5 5 5 5 5 4 2 2 2 4 2 2 4 5 5 4 5 4 2 2 2 2 4 2 2 5 5 4 2 2 5 4 5 5 5 4 5 5 5 2 2", "output": "31" }, { "input": "99\n5 3 4 4 5 4 4 4 3 5 4 3 3 4 3 5 5 5 5 4 3 3 5 3 4 5 3 5 4 4 3 5 5 4 4 4 4 3 5 3 3 5 5 5 5 5 4 3 4 4 3 5 5 3 3 4 4 4 5 4 4 5 4 4 4 4 5 5 4 3 3 4 3 5 3 3 3 3 4 4 4 4 3 4 5 4 4 5 5 5 3 4 5 3 4 5 4 3 3", "output": "24" }, { "input": "100\n5 4 4 4 5 5 5 4 5 4 4 3 3 4 4 4 5 4 5 5 3 5 5 4 5 5 5 4 4 5 3 5 3 5 3 3 5 4 4 5 5 4 5 5 3 4 5 4 4 3 4 4 3 3 5 4 5 4 5 3 4 5 3 4 5 4 3 5 4 5 4 4 4 3 4 5 3 4 3 5 3 4 4 4 3 4 4 5 3 3 4 4 5 5 4 3 4 4 3 5", "output": "19" }, { "input": "99\n2 2 5 2 5 3 4 2 3 5 4 3 4 2 5 3 2 2 4 2 4 4 5 4 4 5 2 5 5 3 2 3 2 2 3 4 5 3 5 2 5 4 4 5 4 2 2 3 2 3 3 3 4 4 3 2 2 4 4 2 5 3 5 3 5 4 4 4 5 4 5 2 2 5 4 4 4 3 3 2 5 2 5 2 3 2 5 2 2 5 5 3 4 5 3 4 4 4 4", "output": "37" }, { "input": "2\n5 2", "output": "1" }, { "input": "5\n2 2 2 2 2", "output": "5" }, { "input": "100\n2 3 2 2 2 3 2 3 3 3 3 3 2 3 3 2 2 3 3 2 3 2 3 2 3 4 4 4 3 3 3 3 3 4 4 3 3 4 3 2 3 4 3 3 3 3 2 3 4 3 4 3 3 2 4 4 2 4 4 3 3 3 3 4 3 2 3 4 3 4 4 4 4 4 3 2 2 3 4 2 4 4 4 2 2 4 2 2 3 2 2 4 4 3 4 2 3 3 2 2", "output": "61" }, { "input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "1" }, { "input": "100\n5 4 3 5 3 5 4 2 3 3 4 5 4 5 5 4 2 4 2 2 5 2 5 3 4 4 4 5 5 5 3 4 4 4 3 5 3 2 5 4 3 3 3 5 2 3 4 2 5 4 3 4 5 2 2 3 4 4 2 3 3 3 2 5 2 3 4 3 3 3 2 5 4 3 4 5 4 2 5 4 5 2 2 4 2 2 5 5 4 5 2 2 2 2 5 2 4 4 4 5", "output": "35" }, { "input": "2\n2 2", "output": "2" }, { "input": "20\n4 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 5 5 5", "output": "1" } ]
1,639,836,408
2,147,483,647
PyPy 3-64
OK
TESTS
61
93
0
import math n = int(input()) arr = [int(x) for x in input().split(' ')] tol = sum(arr) arr.sort() i = 0 while tol < int(math.ceil(4.5*n)): tol += (5 - arr[i]) i += 1 print(i)
Title: Getting an A Time Limit: None seconds Memory Limit: None megabytes Problem Description: Translator's note: in Russia's most widespread grading system, there are four grades: 5, 4, 3, 2, the higher the better, roughly corresponding to A, B, C and F respectively in American grading system. The term is coming to an end and students start thinking about their grades. Today, a professor told his students that the grades for his course would be given out automatically  — he would calculate the simple average (arithmetic mean) of all grades given out for lab works this term and round to the nearest integer. The rounding would be done in favour of the student — $4.5$ would be rounded up to $5$ (as in example 3), but $4.4$ would be rounded down to $4$. This does not bode well for Vasya who didn't think those lab works would influence anything, so he may receive a grade worse than $5$ (maybe even the dreaded $2$). However, the professor allowed him to redo some of his works of Vasya's choosing to increase his average grade. Vasya wants to redo as as few lab works as possible in order to get $5$ for the course. Of course, Vasya will get $5$ for the lab works he chooses to redo. Help Vasya — calculate the minimum amount of lab works Vasya has to redo. Input Specification: The first line contains a single integer $n$ — the number of Vasya's grades ($1 \leq n \leq 100$). The second line contains $n$ integers from $2$ to $5$ — Vasya's grades for his lab works. Output Specification: Output a single integer — the minimum amount of lab works that Vasya has to redo. It can be shown that Vasya can always redo enough lab works to get a $5$. Demo Input: ['3\n4 4 4\n', '4\n5 4 5 5\n', '4\n5 3 3 5\n'] Demo Output: ['2\n', '0\n', '1\n'] Note: In the first sample, it is enough to redo two lab works to make two $4$s into $5$s. In the second sample, Vasya's average is already $4.75$ so he doesn't have to redo anything to get a $5$. In the second sample Vasya has to redo one lab work to get rid of one of the $3$s, that will make the average exactly $4.5$ so the final grade would be $5$.
```python import math n = int(input()) arr = [int(x) for x in input().split(' ')] tol = sum(arr) arr.sort() i = 0 while tol < int(math.ceil(4.5*n)): tol += (5 - arr[i]) i += 1 print(i) ```
3
958
B1
Maximum Control (easy)
PROGRAMMING
1,000
[ "implementation" ]
null
null
The Resistance is trying to take control over all planets in a particular solar system. This solar system is shaped like a tree. More precisely, some planets are connected by bidirectional hyperspace tunnels in such a way that there is a path between every pair of the planets, but removing any tunnel would disconnect some of them. The Resistance already has measures in place that will, when the time is right, enable them to control every planet that is not remote. A planet is considered to be remote if it is connected to the rest of the planets only via a single hyperspace tunnel. How much work is there left to be done: that is, how many remote planets are there?
The first line of the input contains an integer *N* (2<=≤<=*N*<=≤<=1000) – the number of planets in the galaxy. The next *N*<=-<=1 lines describe the hyperspace tunnels between the planets. Each of the *N*<=-<=1 lines contains two space-separated integers *u* and *v* (1<=≤<=*u*,<=*v*<=≤<=*N*) indicating that there is a bidirectional hyperspace tunnel between the planets *u* and *v*. It is guaranteed that every two planets are connected by a path of tunnels, and that each tunnel connects a different pair of planets.
A single integer denoting the number of remote planets.
[ "5\n4 1\n4 2\n1 3\n1 5\n", "4\n1 2\n4 3\n1 4\n" ]
[ "3\n", "2\n" ]
In the first example, only planets 2, 3 and 5 are connected by a single tunnel. In the second example, the remote planets are 2 and 3. Note that this problem has only two versions – easy and medium.
0
[ { "input": "5\n4 1\n4 2\n1 3\n1 5", "output": "3" }, { "input": "4\n1 2\n4 3\n1 4", "output": "2" }, { "input": "10\n4 3\n2 6\n10 1\n5 7\n5 8\n10 6\n5 9\n9 3\n2 9", "output": "4" } ]
1,690,077,499
2,147,483,647
Python 3
OK
TESTS
9
46
307,200
from collections import Counter n = int(input()) cnt = Counter() for _ in range(n - 1): a, b = (int(i) for i in input().split()) cnt[a] += 1 cnt[b] += 1 res = sum(v == 1 for v in cnt.values()) print(res)
Title: Maximum Control (easy) Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Resistance is trying to take control over all planets in a particular solar system. This solar system is shaped like a tree. More precisely, some planets are connected by bidirectional hyperspace tunnels in such a way that there is a path between every pair of the planets, but removing any tunnel would disconnect some of them. The Resistance already has measures in place that will, when the time is right, enable them to control every planet that is not remote. A planet is considered to be remote if it is connected to the rest of the planets only via a single hyperspace tunnel. How much work is there left to be done: that is, how many remote planets are there? Input Specification: The first line of the input contains an integer *N* (2<=≤<=*N*<=≤<=1000) – the number of planets in the galaxy. The next *N*<=-<=1 lines describe the hyperspace tunnels between the planets. Each of the *N*<=-<=1 lines contains two space-separated integers *u* and *v* (1<=≤<=*u*,<=*v*<=≤<=*N*) indicating that there is a bidirectional hyperspace tunnel between the planets *u* and *v*. It is guaranteed that every two planets are connected by a path of tunnels, and that each tunnel connects a different pair of planets. Output Specification: A single integer denoting the number of remote planets. Demo Input: ['5\n4 1\n4 2\n1 3\n1 5\n', '4\n1 2\n4 3\n1 4\n'] Demo Output: ['3\n', '2\n'] Note: In the first example, only planets 2, 3 and 5 are connected by a single tunnel. In the second example, the remote planets are 2 and 3. Note that this problem has only two versions – easy and medium.
```python from collections import Counter n = int(input()) cnt = Counter() for _ in range(n - 1): a, b = (int(i) for i in input().split()) cnt[a] += 1 cnt[b] += 1 res = sum(v == 1 for v in cnt.values()) print(res) ```
3
818
A
Diplomas and Certificates
PROGRAMMING
800
[ "implementation", "math" ]
null
null
There are *n* students who have taken part in an olympiad. Now it's time to award the students. Some of them will receive diplomas, some wiil get certificates, and others won't receive anything. Students with diplomas and certificates are called winners. But there are some rules of counting the number of diplomas and certificates. The number of certificates must be exactly *k* times greater than the number of diplomas. The number of winners must not be greater than half of the number of all students (i.e. not be greater than half of *n*). It's possible that there are no winners. You have to identify the maximum possible number of winners, according to these rules. Also for this case you have to calculate the number of students with diplomas, the number of students with certificates and the number of students who are not winners.
The first (and the only) line of input contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1012), where *n* is the number of students and *k* is the ratio between the number of certificates and the number of diplomas.
Output three numbers: the number of students with diplomas, the number of students with certificates and the number of students who are not winners in case when the number of winners is maximum possible. It's possible that there are no winners.
[ "18 2\n", "9 10\n", "1000000000000 5\n", "1000000000000 499999999999\n" ]
[ "3 6 9\n", "0 0 9\n", "83333333333 416666666665 500000000002\n", "1 499999999999 500000000000\n" ]
none
0
[ { "input": "18 2", "output": "3 6 9" }, { "input": "9 10", "output": "0 0 9" }, { "input": "1000000000000 5", "output": "83333333333 416666666665 500000000002" }, { "input": "1000000000000 499999999999", "output": "1 499999999999 500000000000" }, { "input": "1 1", "output": "0 0 1" }, { "input": "5 3", "output": "0 0 5" }, { "input": "42 6", "output": "3 18 21" }, { "input": "1000000000000 1000", "output": "499500499 499500499000 500000000501" }, { "input": "999999999999 999999", "output": "499999 499998500001 500000999999" }, { "input": "732577309725 132613", "output": "2762066 366285858458 366288689201" }, { "input": "152326362626 15", "output": "4760198832 71402982480 76163181314" }, { "input": "2 1", "output": "0 0 2" }, { "input": "1000000000000 500000000000", "output": "0 0 1000000000000" }, { "input": "100000000000 50000000011", "output": "0 0 100000000000" }, { "input": "1000000000000 32416187567", "output": "15 486242813505 513757186480" }, { "input": "1000000000000 7777777777", "output": "64 497777777728 502222222208" }, { "input": "1000000000000 77777777777", "output": "6 466666666662 533333333332" }, { "input": "100000000000 578485652", "output": "86 49749766072 50250233842" }, { "input": "999999999999 10000000000", "output": "49 490000000000 509999999950" }, { "input": "7 2", "output": "1 2 4" }, { "input": "420506530901 752346673804", "output": "0 0 420506530901" }, { "input": "960375521135 321688347872", "output": "1 321688347872 638687173262" }, { "input": "1000000000000 1000000000000", "output": "0 0 1000000000000" }, { "input": "99999999999 15253636363", "output": "3 45760909089 54239090907" }, { "input": "19 2", "output": "3 6 10" }, { "input": "999999999999 1000000000000", "output": "0 0 999999999999" }, { "input": "1000000000000 5915587276", "output": "84 496909331184 503090668732" }, { "input": "1000000000000 1000000006", "output": "499 499000002994 500999996507" }, { "input": "549755813888 134217728", "output": "2047 274743689216 275012122625" }, { "input": "99999999999 3333333", "output": "14999 49996661667 50003323333" }, { "input": "9 1", "output": "2 2 5" }, { "input": "1000000000000 250000000001", "output": "1 250000000001 749999999998" }, { "input": "5 1", "output": "1 1 3" }, { "input": "3107038133 596040207", "output": "2 1192080414 1914957717" }, { "input": "1000000000000 73786977", "output": "6776 499980556152 500019437072" }, { "input": "1000000000000 73786976", "output": "6776 499980549376 500019443848" }, { "input": "1000000000000 25000000000", "output": "19 475000000000 524999999981" }, { "input": "216929598879 768233755932", "output": "0 0 216929598879" }, { "input": "1000000000000 250000000000", "output": "1 250000000000 749999999999" }, { "input": "1000000000000 100000000001", "output": "4 400000000004 599999999992" }, { "input": "100000000000 100000000001", "output": "0 0 100000000000" }, { "input": "900000000000 100281800001", "output": "4 401127200004 498872799992" }, { "input": "906028900004 109123020071", "output": "4 436492080284 469536819716" }, { "input": "1000000000000 1", "output": "250000000000 250000000000 500000000000" } ]
1,620,934,264
2,147,483,647
Python 3
OK
TESTS
44
62
6,758,400
s = input().split() n , k = int(s[0]), int(s[1]) d = int((n//2) / (k+1)) c = k*d nw = n - (c + d) print(d, c, nw)
Title: Diplomas and Certificates Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are *n* students who have taken part in an olympiad. Now it's time to award the students. Some of them will receive diplomas, some wiil get certificates, and others won't receive anything. Students with diplomas and certificates are called winners. But there are some rules of counting the number of diplomas and certificates. The number of certificates must be exactly *k* times greater than the number of diplomas. The number of winners must not be greater than half of the number of all students (i.e. not be greater than half of *n*). It's possible that there are no winners. You have to identify the maximum possible number of winners, according to these rules. Also for this case you have to calculate the number of students with diplomas, the number of students with certificates and the number of students who are not winners. Input Specification: The first (and the only) line of input contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1012), where *n* is the number of students and *k* is the ratio between the number of certificates and the number of diplomas. Output Specification: Output three numbers: the number of students with diplomas, the number of students with certificates and the number of students who are not winners in case when the number of winners is maximum possible. It's possible that there are no winners. Demo Input: ['18 2\n', '9 10\n', '1000000000000 5\n', '1000000000000 499999999999\n'] Demo Output: ['3 6 9\n', '0 0 9\n', '83333333333 416666666665 500000000002\n', '1 499999999999 500000000000\n'] Note: none
```python s = input().split() n , k = int(s[0]), int(s[1]) d = int((n//2) / (k+1)) c = k*d nw = n - (c + d) print(d, c, nw) ```
3
1
A
Theatre Square
PROGRAMMING
1,000
[ "math" ]
A. Theatre Square
1
256
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Write the needed number of flagstones.
[ "6 6 4\n" ]
[ "4\n" ]
none
0
[ { "input": "6 6 4", "output": "4" }, { "input": "1 1 1", "output": "1" }, { "input": "2 1 1", "output": "2" }, { "input": "1 2 1", "output": "2" }, { "input": "2 2 1", "output": "4" }, { "input": "2 1 2", "output": "1" }, { "input": "1 1 3", "output": "1" }, { "input": "2 3 4", "output": "1" }, { "input": "1000000000 1000000000 1", "output": "1000000000000000000" }, { "input": "12 13 4", "output": "12" }, { "input": "222 332 5", "output": "3015" }, { "input": "1000 1000 10", "output": "10000" }, { "input": "1001 1000 10", "output": "10100" }, { "input": "100 10001 1000000000", "output": "1" }, { "input": "1000000000 1000000000 1000000000", "output": "1" }, { "input": "1000000000 1000000000 999999999", "output": "4" }, { "input": "1000000000 1000000000 192", "output": "27126743055556" }, { "input": "1000000000 987654321 1", "output": "987654321000000000" }, { "input": "456784567 1000000000 51", "output": "175618850864484" }, { "input": "39916800 134217728 40320", "output": "3295710" } ]
1,686,050,919
2,147,483,647
PyPy 3-64
OK
TESTS
20
62
0
# -*- coding: utf-8 -*- def solve(): n, m, a = map(int, input().split()) print(((n + a - 1) // a) * ((m + a - 1) // a)) def main(): t = 1 # t = int(input()) for i in range(t): solve() if __name__ == "__main__": main()
Title: Theatre Square Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. Input Specification: The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). Output Specification: Write the needed number of flagstones. Demo Input: ['6 6 4\n'] Demo Output: ['4\n'] Note: none
```python # -*- coding: utf-8 -*- def solve(): n, m, a = map(int, input().split()) print(((n + a - 1) // a) * ((m + a - 1) // a)) def main(): t = 1 # t = int(input()) for i in range(t): solve() if __name__ == "__main__": main() ```
3.969
148
A
Insomnia cure
PROGRAMMING
800
[ "constructive algorithms", "implementation", "math" ]
null
null
«One dragon. Two dragon. Three dragon», — the princess was counting. She had trouble falling asleep, and she got bored of counting lambs when she was nine. However, just counting dragons was boring as well, so she entertained herself at best she could. Tonight she imagined that all dragons were here to steal her, and she was fighting them off. Every *k*-th dragon got punched in the face with a frying pan. Every *l*-th dragon got his tail shut into the balcony door. Every *m*-th dragon got his paws trampled with sharp heels. Finally, she threatened every *n*-th dragon to call her mom, and he withdrew in panic. How many imaginary dragons suffered moral or physical damage tonight, if the princess counted a total of *d* dragons?
Input data contains integer numbers *k*,<=*l*,<=*m*,<=*n* and *d*, each number in a separate line (1<=≤<=*k*,<=*l*,<=*m*,<=*n*<=≤<=10, 1<=≤<=*d*<=≤<=105).
Output the number of damaged dragons.
[ "1\n2\n3\n4\n12\n", "2\n3\n4\n5\n24\n" ]
[ "12\n", "17\n" ]
In the first case every first dragon got punched with a frying pan. Some of the dragons suffered from other reasons as well, but the pan alone would be enough. In the second case dragons 1, 7, 11, 13, 17, 19 and 23 escaped unharmed.
1,000
[ { "input": "1\n2\n3\n4\n12", "output": "12" }, { "input": "2\n3\n4\n5\n24", "output": "17" }, { "input": "1\n1\n1\n1\n100000", "output": "100000" }, { "input": "10\n9\n8\n7\n6", "output": "0" }, { "input": "8\n4\n4\n3\n65437", "output": "32718" }, { "input": "8\n4\n1\n10\n59392", "output": "59392" }, { "input": "4\n1\n8\n7\n44835", "output": "44835" }, { "input": "6\n1\n7\n2\n62982", "output": "62982" }, { "input": "2\n7\n4\n9\n56937", "output": "35246" }, { "input": "2\n9\n8\n1\n75083", "output": "75083" }, { "input": "8\n7\n7\n6\n69038", "output": "24656" }, { "input": "4\n4\n2\n3\n54481", "output": "36320" }, { "input": "6\n4\n9\n8\n72628", "output": "28244" }, { "input": "9\n7\n8\n10\n42357", "output": "16540" }, { "input": "5\n6\n4\n3\n60504", "output": "36302" }, { "input": "7\n2\n3\n8\n21754", "output": "15539" }, { "input": "1\n2\n10\n4\n39901", "output": "39901" }, { "input": "3\n4\n7\n1\n58048", "output": "58048" }, { "input": "9\n10\n4\n6\n52003", "output": "21956" }, { "input": "5\n10\n9\n3\n70149", "output": "32736" }, { "input": "5\n5\n5\n10\n55592", "output": "11118" }, { "input": "1\n5\n2\n6\n49547", "output": "49547" }, { "input": "3\n7\n7\n7\n84046", "output": "36019" }, { "input": "10\n2\n1\n8\n63537", "output": "63537" }, { "input": "7\n2\n10\n5\n81684", "output": "53678" }, { "input": "7\n1\n6\n8\n99831", "output": "99831" }, { "input": "3\n9\n3\n3\n61082", "output": "20360" }, { "input": "5\n5\n8\n9\n79228", "output": "29931" }, { "input": "1\n5\n5\n6\n89535", "output": "89535" }, { "input": "5\n5\n2\n1\n7682", "output": "7682" }, { "input": "7\n4\n8\n8\n25829", "output": "9224" }, { "input": "3\n4\n3\n3\n87079", "output": "43539" }, { "input": "5\n8\n4\n9\n5226", "output": "2438" }, { "input": "4\n9\n6\n6\n1070", "output": "415" }, { "input": "10\n10\n10\n10\n100000", "output": "10000" }, { "input": "1\n1\n1\n1\n1", "output": "1" }, { "input": "10\n10\n10\n10\n1", "output": "0" }, { "input": "10\n10\n1\n10\n10", "output": "10" }, { "input": "10\n10\n1\n10\n100", "output": "100" }, { "input": "2\n2\n2\n2\n1", "output": "0" } ]
1,696,440,203
2,147,483,647
Python 3
OK
TESTS
40
122
4,505,600
k = int(input()) l = int(input()) m = int(input()) n = int(input()) d = int(input()) mas = [] for i in range(d): if (i+1)%k==0 or (i+1)%l==0 or (i+1)%m==0 or (i+1)%n==0: mas.append(i) print(len(mas))
Title: Insomnia cure Time Limit: None seconds Memory Limit: None megabytes Problem Description: «One dragon. Two dragon. Three dragon», — the princess was counting. She had trouble falling asleep, and she got bored of counting lambs when she was nine. However, just counting dragons was boring as well, so she entertained herself at best she could. Tonight she imagined that all dragons were here to steal her, and she was fighting them off. Every *k*-th dragon got punched in the face with a frying pan. Every *l*-th dragon got his tail shut into the balcony door. Every *m*-th dragon got his paws trampled with sharp heels. Finally, she threatened every *n*-th dragon to call her mom, and he withdrew in panic. How many imaginary dragons suffered moral or physical damage tonight, if the princess counted a total of *d* dragons? Input Specification: Input data contains integer numbers *k*,<=*l*,<=*m*,<=*n* and *d*, each number in a separate line (1<=≤<=*k*,<=*l*,<=*m*,<=*n*<=≤<=10, 1<=≤<=*d*<=≤<=105). Output Specification: Output the number of damaged dragons. Demo Input: ['1\n2\n3\n4\n12\n', '2\n3\n4\n5\n24\n'] Demo Output: ['12\n', '17\n'] Note: In the first case every first dragon got punched with a frying pan. Some of the dragons suffered from other reasons as well, but the pan alone would be enough. In the second case dragons 1, 7, 11, 13, 17, 19 and 23 escaped unharmed.
```python k = int(input()) l = int(input()) m = int(input()) n = int(input()) d = int(input()) mas = [] for i in range(d): if (i+1)%k==0 or (i+1)%l==0 or (i+1)%m==0 or (i+1)%n==0: mas.append(i) print(len(mas)) ```
3
675
A
Infinite Sequence
PROGRAMMING
1,100
[ "math" ]
null
null
Vasya likes everything infinite. Now he is studying the properties of a sequence *s*, such that its first element is equal to *a* (*s*1<==<=*a*), and the difference between any two neighbouring elements is equal to *c* (*s**i*<=-<=*s**i*<=-<=1<==<=*c*). In particular, Vasya wonders if his favourite integer *b* appears in this sequence, that is, there exists a positive integer *i*, such that *s**i*<==<=*b*. Of course, you are the person he asks for a help.
The first line of the input contain three integers *a*, *b* and *c* (<=-<=109<=≤<=*a*,<=*b*,<=*c*<=≤<=109) — the first element of the sequence, Vasya's favorite number and the difference between any two neighbouring elements of the sequence, respectively.
If *b* appears in the sequence *s* print "YES" (without quotes), otherwise print "NO" (without quotes).
[ "1 7 3\n", "10 10 0\n", "1 -4 5\n", "0 60 50\n" ]
[ "YES\n", "YES\n", "NO\n", "NO\n" ]
In the first sample, the sequence starts from integers 1, 4, 7, so 7 is its element. In the second sample, the favorite integer of Vasya is equal to the first element of the sequence. In the third sample all elements of the sequence are greater than Vasya's favorite integer. In the fourth sample, the sequence starts from 0, 50, 100, and all the following elements are greater than Vasya's favorite integer.
500
[ { "input": "1 7 3", "output": "YES" }, { "input": "10 10 0", "output": "YES" }, { "input": "1 -4 5", "output": "NO" }, { "input": "0 60 50", "output": "NO" }, { "input": "1 -4 -5", "output": "YES" }, { "input": "0 1 0", "output": "NO" }, { "input": "10 10 42", "output": "YES" }, { "input": "-1000000000 1000000000 -1", "output": "NO" }, { "input": "10 16 4", "output": "NO" }, { "input": "-1000000000 1000000000 5", "output": "YES" }, { "input": "1000000000 -1000000000 5", "output": "NO" }, { "input": "1000000000 -1000000000 0", "output": "NO" }, { "input": "1000000000 1000000000 0", "output": "YES" }, { "input": "115078364 -899474523 -1", "output": "YES" }, { "input": "-245436499 416383245 992", "output": "YES" }, { "input": "-719636354 536952440 2", "output": "YES" }, { "input": "-198350539 963391024 68337739", "output": "YES" }, { "input": "-652811055 875986516 1091", "output": "YES" }, { "input": "119057893 -516914539 -39748277", "output": "YES" }, { "input": "989140430 731276607 -36837689", "output": "YES" }, { "input": "677168390 494583489 -985071853", "output": "NO" }, { "input": "58090193 777423708 395693923", "output": "NO" }, { "input": "479823846 -403424770 -653472589", "output": "NO" }, { "input": "-52536829 -132023273 -736287999", "output": "NO" }, { "input": "-198893776 740026818 -547885271", "output": "NO" }, { "input": "-2 -2 -2", "output": "YES" }, { "input": "-2 -2 -1", "output": "YES" }, { "input": "-2 -2 0", "output": "YES" }, { "input": "-2 -2 1", "output": "YES" }, { "input": "-2 -2 2", "output": "YES" }, { "input": "-2 -1 -2", "output": "NO" }, { "input": "-2 -1 -1", "output": "NO" }, { "input": "-2 -1 0", "output": "NO" }, { "input": "-2 -1 1", "output": "YES" }, { "input": "-2 -1 2", "output": "NO" }, { "input": "-2 0 -2", "output": "NO" }, { "input": "-2 0 -1", "output": "NO" }, { "input": "-2 0 0", "output": "NO" }, { "input": "-2 0 1", "output": "YES" }, { "input": "-2 0 2", "output": "YES" }, { "input": "-2 1 -2", "output": "NO" }, { "input": "-2 1 -1", "output": "NO" }, { "input": "-2 1 0", "output": "NO" }, { "input": "-2 1 1", "output": "YES" }, { "input": "-2 1 2", "output": "NO" }, { "input": "-2 2 -2", "output": "NO" }, { "input": "-2 2 -1", "output": "NO" }, { "input": "-2 2 0", "output": "NO" }, { "input": "-2 2 1", "output": "YES" }, { "input": "-2 2 2", "output": "YES" }, { "input": "-1 -2 -2", "output": "NO" }, { "input": "-1 -2 -1", "output": "YES" }, { "input": "-1 -2 0", "output": "NO" }, { "input": "-1 -2 1", "output": "NO" }, { "input": "-1 -2 2", "output": "NO" }, { "input": "-1 -1 -2", "output": "YES" }, { "input": "-1 -1 -1", "output": "YES" }, { "input": "-1 -1 0", "output": "YES" }, { "input": "-1 -1 1", "output": "YES" }, { "input": "-1 -1 2", "output": "YES" }, { "input": "-1 0 -2", "output": "NO" }, { "input": "-1 0 -1", "output": "NO" }, { "input": "-1 0 0", "output": "NO" }, { "input": "-1 0 1", "output": "YES" }, { "input": "-1 0 2", "output": "NO" }, { "input": "-1 1 -2", "output": "NO" }, { "input": "-1 1 -1", "output": "NO" }, { "input": "-1 1 0", "output": "NO" }, { "input": "-1 1 1", "output": "YES" }, { "input": "-1 1 2", "output": "YES" }, { "input": "-1 2 -2", "output": "NO" }, { "input": "-1 2 -1", "output": "NO" }, { "input": "-1 2 0", "output": "NO" }, { "input": "-1 2 1", "output": "YES" }, { "input": "-1 2 2", "output": "NO" }, { "input": "0 -2 -2", "output": "YES" }, { "input": "0 -2 -1", "output": "YES" }, { "input": "0 -2 0", "output": "NO" }, { "input": "0 -2 1", "output": "NO" }, { "input": "0 -2 2", "output": "NO" }, { "input": "0 -1 -2", "output": "NO" }, { "input": "0 -1 -1", "output": "YES" }, { "input": "0 -1 0", "output": "NO" }, { "input": "0 -1 1", "output": "NO" }, { "input": "0 -1 2", "output": "NO" }, { "input": "0 0 -2", "output": "YES" }, { "input": "0 0 -1", "output": "YES" }, { "input": "0 0 0", "output": "YES" }, { "input": "0 0 1", "output": "YES" }, { "input": "0 0 2", "output": "YES" }, { "input": "0 1 -2", "output": "NO" }, { "input": "0 1 -1", "output": "NO" }, { "input": "0 1 0", "output": "NO" }, { "input": "0 1 1", "output": "YES" }, { "input": "0 1 2", "output": "NO" }, { "input": "0 2 -2", "output": "NO" }, { "input": "0 2 -1", "output": "NO" }, { "input": "0 2 0", "output": "NO" }, { "input": "0 2 1", "output": "YES" }, { "input": "0 2 2", "output": "YES" }, { "input": "1 -2 -2", "output": "NO" }, { "input": "1 -2 -1", "output": "YES" }, { "input": "1 -2 0", "output": "NO" }, { "input": "1 -2 1", "output": "NO" }, { "input": "1 -2 2", "output": "NO" }, { "input": "1 -1 -2", "output": "YES" }, { "input": "1 -1 -1", "output": "YES" }, { "input": "1 -1 0", "output": "NO" }, { "input": "1 -1 1", "output": "NO" }, { "input": "1 -1 2", "output": "NO" }, { "input": "1 0 -2", "output": "NO" }, { "input": "1 0 -1", "output": "YES" }, { "input": "1 0 0", "output": "NO" }, { "input": "1 0 1", "output": "NO" }, { "input": "1 0 2", "output": "NO" }, { "input": "1 1 -2", "output": "YES" }, { "input": "1 1 -1", "output": "YES" }, { "input": "1 1 0", "output": "YES" }, { "input": "1 1 1", "output": "YES" }, { "input": "1 1 2", "output": "YES" }, { "input": "1 2 -2", "output": "NO" }, { "input": "1 2 -1", "output": "NO" }, { "input": "1 2 0", "output": "NO" }, { "input": "1 2 1", "output": "YES" }, { "input": "1 2 2", "output": "NO" }, { "input": "2 -2 -2", "output": "YES" }, { "input": "2 -2 -1", "output": "YES" }, { "input": "2 -2 0", "output": "NO" }, { "input": "2 -2 1", "output": "NO" }, { "input": "2 -2 2", "output": "NO" }, { "input": "2 -1 -2", "output": "NO" }, { "input": "2 -1 -1", "output": "YES" }, { "input": "2 -1 0", "output": "NO" }, { "input": "2 -1 1", "output": "NO" }, { "input": "2 -1 2", "output": "NO" }, { "input": "2 0 -2", "output": "YES" }, { "input": "2 0 -1", "output": "YES" }, { "input": "2 0 0", "output": "NO" }, { "input": "2 0 1", "output": "NO" }, { "input": "2 0 2", "output": "NO" }, { "input": "2 1 -2", "output": "NO" }, { "input": "2 1 -1", "output": "YES" }, { "input": "2 1 0", "output": "NO" }, { "input": "2 1 1", "output": "NO" }, { "input": "2 1 2", "output": "NO" }, { "input": "2 2 -2", "output": "YES" }, { "input": "2 2 -1", "output": "YES" }, { "input": "2 2 0", "output": "YES" }, { "input": "2 2 1", "output": "YES" }, { "input": "2 2 2", "output": "YES" }, { "input": "-1000000000 1000000000 1", "output": "YES" }, { "input": "-1000000000 1000000000 2", "output": "YES" }, { "input": "1000000000 -1000000000 -1", "output": "YES" }, { "input": "5 2 3", "output": "NO" }, { "input": "2 1 -1", "output": "YES" }, { "input": "3 2 1", "output": "NO" }, { "input": "0 -5 -3", "output": "NO" }, { "input": "2 5 5", "output": "NO" }, { "input": "0 10 1", "output": "YES" }, { "input": "15 5 -5", "output": "YES" }, { "input": "2 1 1", "output": "NO" }, { "input": "20 10 0", "output": "NO" }, { "input": "20 15 5", "output": "NO" }, { "input": "1 6 1", "output": "YES" }, { "input": "1000000000 0 -1000000000", "output": "YES" }, { "input": "1 1 -5", "output": "YES" }, { "input": "4 6 1", "output": "YES" }, { "input": "-5 -10 -5", "output": "YES" }, { "input": "2 0 0", "output": "NO" }, { "input": "10 9 -1", "output": "YES" }, { "input": "-2 -1 -1", "output": "NO" }, { "input": "1 13 3", "output": "YES" }, { "input": "2 3 0", "output": "NO" }, { "input": "1 1 -1", "output": "YES" }, { "input": "5 -10 -5", "output": "YES" }, { "input": "5 3 1", "output": "NO" }, { "input": "1 1000000000 1", "output": "YES" }, { "input": "-1000000000 1000000000 1000000000", "output": "YES" } ]
1,530,100,142
2,147,483,647
Python 3
OK
TESTS
178
93
0
a, b, c = map(int, input().split()) if c: div, mod = divmod(b - a, c) print('NO' if mod or div < 0 else 'YES') else: print('YES' if a == b else 'NO')
Title: Infinite Sequence Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya likes everything infinite. Now he is studying the properties of a sequence *s*, such that its first element is equal to *a* (*s*1<==<=*a*), and the difference between any two neighbouring elements is equal to *c* (*s**i*<=-<=*s**i*<=-<=1<==<=*c*). In particular, Vasya wonders if his favourite integer *b* appears in this sequence, that is, there exists a positive integer *i*, such that *s**i*<==<=*b*. Of course, you are the person he asks for a help. Input Specification: The first line of the input contain three integers *a*, *b* and *c* (<=-<=109<=≤<=*a*,<=*b*,<=*c*<=≤<=109) — the first element of the sequence, Vasya's favorite number and the difference between any two neighbouring elements of the sequence, respectively. Output Specification: If *b* appears in the sequence *s* print "YES" (without quotes), otherwise print "NO" (without quotes). Demo Input: ['1 7 3\n', '10 10 0\n', '1 -4 5\n', '0 60 50\n'] Demo Output: ['YES\n', 'YES\n', 'NO\n', 'NO\n'] Note: In the first sample, the sequence starts from integers 1, 4, 7, so 7 is its element. In the second sample, the favorite integer of Vasya is equal to the first element of the sequence. In the third sample all elements of the sequence are greater than Vasya's favorite integer. In the fourth sample, the sequence starts from 0, 50, 100, and all the following elements are greater than Vasya's favorite integer.
```python a, b, c = map(int, input().split()) if c: div, mod = divmod(b - a, c) print('NO' if mod or div < 0 else 'YES') else: print('YES' if a == b else 'NO') ```
3
350
A
TL
PROGRAMMING
1,200
[ "brute force", "greedy", "implementation" ]
null
null
Valera wanted to prepare a Codesecrof round. He's already got one problem and he wants to set a time limit (TL) on it. Valera has written *n* correct solutions. For each correct solution, he knows its running time (in seconds). Valera has also wrote *m* wrong solutions and for each wrong solution he knows its running time (in seconds). Let's suppose that Valera will set *v* seconds TL in the problem. Then we can say that a solution passes the system testing if its running time is at most *v* seconds. We can also say that a solution passes the system testing with some "extra" time if for its running time, *a* seconds, an inequality 2*a*<=≤<=*v* holds. As a result, Valera decided to set *v* seconds TL, that the following conditions are met: 1. *v* is a positive integer; 1. all correct solutions pass the system testing; 1. at least one correct solution passes the system testing with some "extra" time; 1. all wrong solutions do not pass the system testing; 1. value *v* is minimum among all TLs, for which points 1, 2, 3, 4 hold. Help Valera and find the most suitable TL or else state that such TL doesn't exist.
The first line contains two integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100). The second line contains *n* space-separated positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) — the running time of each of the *n* correct solutions in seconds. The third line contains *m* space-separated positive integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=100) — the running time of each of *m* wrong solutions in seconds.
If there is a valid TL value, print it. Otherwise, print -1.
[ "3 6\n4 5 2\n8 9 6 10 7 11\n", "3 1\n3 4 5\n6\n" ]
[ "5", "-1\n" ]
none
500
[ { "input": "3 6\n4 5 2\n8 9 6 10 7 11", "output": "5" }, { "input": "3 1\n3 4 5\n6", "output": "-1" }, { "input": "2 5\n45 99\n49 41 77 83 45", "output": "-1" }, { "input": "50 50\n18 13 5 34 10 36 36 12 15 11 16 17 14 36 23 45 32 24 31 18 24 32 7 1 31 3 49 8 16 23 3 39 47 43 42 38 40 22 41 1 49 47 9 8 19 15 29 30 16 18\n91 58 86 51 94 94 73 84 98 69 74 56 52 80 88 61 53 99 88 50 55 95 65 84 87 79 51 52 69 60 74 73 93 61 73 59 64 56 95 78 86 72 79 70 93 78 54 61 71 50", "output": "49" }, { "input": "55 44\n93 17 74 15 34 16 41 80 26 54 94 94 86 93 20 44 63 72 39 43 67 4 37 49 76 94 5 51 64 74 11 47 77 97 57 30 42 72 71 26 8 14 67 64 49 57 30 23 40 4 76 78 87 78 79\n38 55 17 65 26 7 36 65 48 28 49 93 18 98 31 90 26 57 1 26 88 56 48 56 23 13 8 67 80 2 51 3 21 33 20 54 2 45 21 36 3 98 62 2", "output": "-1" }, { "input": "32 100\n30 8 4 35 18 41 18 12 33 39 39 18 39 19 33 46 45 33 34 27 14 39 40 21 38 9 42 35 27 10 14 14\n65 49 89 64 47 78 59 52 73 51 84 82 88 63 91 99 67 87 53 99 75 47 85 82 58 47 80 50 65 91 83 90 77 52 100 88 97 74 98 99 50 93 65 61 65 65 65 96 61 51 84 67 79 90 92 83 100 100 100 95 80 54 77 51 98 64 74 62 60 96 73 74 94 55 89 60 92 65 74 79 66 81 53 47 71 51 54 85 74 97 68 72 88 94 100 85 65 63 65 90", "output": "46" }, { "input": "1 50\n7\n65 52 99 78 71 19 96 72 80 15 50 94 20 35 79 95 44 41 45 53 77 50 74 66 59 96 26 84 27 48 56 84 36 78 89 81 67 34 79 74 99 47 93 92 90 96 72 28 78 66", "output": "14" }, { "input": "1 1\n4\n9", "output": "8" }, { "input": "1 1\n2\n4", "output": "-1" }, { "input": "22 56\n49 20 42 68 15 46 98 78 82 8 7 33 50 30 75 96 36 88 35 99 19 87\n15 18 81 24 35 89 25 32 23 3 48 24 52 69 18 32 23 61 48 98 50 38 5 17 70 20 38 32 49 54 68 11 51 81 46 22 19 59 29 38 45 83 18 13 91 17 84 62 25 60 97 32 23 13 83 58", "output": "-1" }, { "input": "1 1\n50\n100", "output": "-1" }, { "input": "1 1\n49\n100", "output": "98" }, { "input": "1 1\n100\n100", "output": "-1" }, { "input": "1 1\n99\n100", "output": "-1" }, { "input": "8 4\n1 2 49 99 99 95 78 98\n100 100 100 100", "output": "99" }, { "input": "68 85\n43 55 2 4 72 45 19 56 53 81 18 90 11 87 47 8 94 88 24 4 67 9 21 70 25 66 65 27 46 13 8 51 65 99 37 43 71 59 71 79 32 56 49 43 57 85 95 81 40 28 60 36 72 81 60 40 16 78 61 37 29 26 15 95 70 27 50 97\n6 6 48 72 54 31 1 50 29 64 93 9 29 93 66 63 25 90 52 1 66 13 70 30 24 87 32 90 84 72 44 13 25 45 31 16 92 60 87 40 62 7 20 63 86 78 73 88 5 36 74 100 64 34 9 5 62 29 58 48 81 46 84 56 27 1 60 14 54 88 31 93 62 7 9 69 27 48 10 5 33 10 53 66 2", "output": "-1" }, { "input": "5 100\n1 1 1 1 1\n77 53 38 29 97 33 64 17 78 100 27 12 42 44 20 24 44 68 58 57 65 90 8 24 4 6 74 68 61 43 25 69 8 62 36 85 67 48 69 30 35 41 42 12 87 66 50 92 53 76 38 67 85 7 80 78 53 76 94 8 37 50 4 100 4 71 10 48 34 47 83 42 25 81 64 72 25 51 53 75 43 98 53 77 94 38 81 15 89 91 72 76 7 36 27 41 88 18 19 75", "output": "2" }, { "input": "3 3\n2 3 4\n8 9 10", "output": "4" }, { "input": "2 1\n2 3\n15", "output": "4" }, { "input": "2 1\n2 4\n4", "output": "-1" }, { "input": "2 3\n4 5\n10 11 12", "output": "8" }, { "input": "3 1\n2 3 3\n5", "output": "4" }, { "input": "2 1\n9 10\n100", "output": "18" }, { "input": "3 3\n3 12 15\n7 8 9", "output": "-1" }, { "input": "2 2\n3 5\n7 8", "output": "6" }, { "input": "3 3\n4 5 6\n10 11 12", "output": "8" }, { "input": "3 5\n2 3 3\n6 6 6 6 2", "output": "-1" }, { "input": "3 6\n4 5 3\n8 9 7 10 7 11", "output": "6" }, { "input": "3 6\n4 5 2\n8 9 6 10 7 4", "output": "-1" }, { "input": "2 1\n4 6\n10", "output": "8" }, { "input": "1 2\n1\n3 1", "output": "-1" }, { "input": "2 1\n5 6\n20", "output": "10" }, { "input": "2 1\n1 5\n5", "output": "-1" }, { "input": "3 2\n10 20 30\n30 40", "output": "-1" }, { "input": "2 2\n5 6\n7 100", "output": "-1" }, { "input": "2 1\n2 5\n7", "output": "5" }, { "input": "1 1\n5\n20", "output": "10" }, { "input": "2 1\n10 11\n100", "output": "20" }, { "input": "1 1\n1\n10", "output": "2" }, { "input": "1 1\n10\n100", "output": "20" } ]
1,606,465,538
2,147,483,647
PyPy 3
OK
TESTS
45
310
0
n,m = map(int,input().split()) a = [int(x) for x in input().split()] b = [int(x) for x in input().split()] v = min(a) p = max(a) c= min(b) if(max(2*v,p)<c): print(max(2*v,p)) else: print(-1)
Title: TL Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera wanted to prepare a Codesecrof round. He's already got one problem and he wants to set a time limit (TL) on it. Valera has written *n* correct solutions. For each correct solution, he knows its running time (in seconds). Valera has also wrote *m* wrong solutions and for each wrong solution he knows its running time (in seconds). Let's suppose that Valera will set *v* seconds TL in the problem. Then we can say that a solution passes the system testing if its running time is at most *v* seconds. We can also say that a solution passes the system testing with some "extra" time if for its running time, *a* seconds, an inequality 2*a*<=≤<=*v* holds. As a result, Valera decided to set *v* seconds TL, that the following conditions are met: 1. *v* is a positive integer; 1. all correct solutions pass the system testing; 1. at least one correct solution passes the system testing with some "extra" time; 1. all wrong solutions do not pass the system testing; 1. value *v* is minimum among all TLs, for which points 1, 2, 3, 4 hold. Help Valera and find the most suitable TL or else state that such TL doesn't exist. Input Specification: The first line contains two integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100). The second line contains *n* space-separated positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) — the running time of each of the *n* correct solutions in seconds. The third line contains *m* space-separated positive integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=100) — the running time of each of *m* wrong solutions in seconds. Output Specification: If there is a valid TL value, print it. Otherwise, print -1. Demo Input: ['3 6\n4 5 2\n8 9 6 10 7 11\n', '3 1\n3 4 5\n6\n'] Demo Output: ['5', '-1\n'] Note: none
```python n,m = map(int,input().split()) a = [int(x) for x in input().split()] b = [int(x) for x in input().split()] v = min(a) p = max(a) c= min(b) if(max(2*v,p)<c): print(max(2*v,p)) else: print(-1) ```
3