source
stringlengths 32
209
| text
stringlengths 18
1.5k
|
|---|---|
https://en.wikipedia.org/wiki/Aspartylglucosaminidase
|
N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase is an enzyme that in humans is encoded by the AGA gene.
Aspartylglucosaminidase is an amidohydrolase enzyme involved in the catabolism of N-linked oligosaccharides of glycoproteins. It cleaves asparagine from N-acetylglucosamines as one of the final steps in the lysosomal breakdown of glycoproteins. The lysosomal storage disease aspartylglycosaminuria is caused by a deficiency in the AGA enzyme.
References
External links
Further reading
External links
|
https://en.wikipedia.org/wiki/FC%20Swarovski%20Tirol
|
FC Swarovski Tirol was an Austrian association football club from 1986 to 1992, based in Innsbruck, Tyrol, Austria.
History
It was created by crystal manufacturer Swarovski as a split-off of FC Wacker Innsbruck, whose Bundesliga license it adopted at the end of the 1985–86 season. With manager Ernst Happel it won the Austrian football championship of 1989 and 1990 as well as the Austrian Cup in 1989. It nevertheless was dissolved in 1992 and the license fell back to FC Wacker, only to change over again to the newly established FC Tirol Innsbruck one year later.
Honours
Austrian Championship (2): 1988–89, 1989–90
Austrian Championship Runners-up (1): 1990–91
Austrian Cup (1): 1988–89
Austrian Cup Runners-up (2): 1986–87, 1987–88
Austrian Supercup Runners-up (3): 1987, 1989, 1990
European Cup history
Q = Qualifying QF = Quarterfinal SF = Semifinal
Manager history
Felix Latzke (1 July 1985 – 30 June 1987)
Ernst Happel (1 July 1987 – 1 Dec 1991)
Horst Hrubesch (1 Jan 1992 – 31 May 1992)
External links
Association football clubs established in 1986
Association football clubs disestablished in 1986
Defunct football clubs in Austria
Sport in Innsbruck
1986 establishments in Austria
1992 disestablishments in Austria
|
https://en.wikipedia.org/wiki/Emopamil%20binding%20protein
|
Emopamil binding protein is a protein that in humans is encoded by the EBP gene, located on the X chromosome. The protein is shown to have a high-affinity reception for anti-ischemic drugs, such as Emopamil, resulting in its discovery and given name. EBP has a mass of 27.3 kDa and resembles a σ-receptor that resides in the endoplasmic reticulum of various tissues as an integral membrane protein.
Clinical significance
Mutations in EBP cause Conradi–Hünermann syndrome and impairs cholesterol biosynthesis. Unborn males affected with EBP mutations are not expected to be liveborn, (with up to only 5% male births). Individuals, mostly female, that are liveborn with EBP mutations experience stunted growth, limb reduction and back problems. Later in life, the individual may develop cataracts along with coarse hair and hair loss.
Cloning
Isolation, replication and characterization of the EBP and EBP-like protein have been performed in yeast/E. Coli strains (which lack the EBP protein in nature) to study the high-affinity drug binding effects.
See also
Emopamil
Cholestenol Delta-isomerase
Sigma-1 receptor
Sigma-2 receptor
References
External links
GeneReviews/NCBI/NIH/UW entry on Chondrodysplasia Punctata 2, X-Linked, Conradi-Hünermann Syndrome, Happle Syndrome
Genetics
|
https://en.wikipedia.org/wiki/Wasserstein%20metric
|
In mathematics, the Wasserstein distance or Kantorovich–Rubinstein metric is a distance function defined between probability distributions on a given metric space . It is named after Leonid Vaseršteĭn.
Intuitively, if each distribution is viewed as a unit amount of earth (soil) piled on , the metric is the minimum "cost" of turning one pile into the other, which is assumed to be the amount of earth that needs to be moved times the mean distance it has to be moved. This problem was first formalised by Gaspard Monge in 1781. Because of this analogy, the metric is known in computer science as the earth mover's distance.
The name "Wasserstein distance" was coined by R. L. Dobrushin in 1970, after learning of it in the work of Leonid Vaseršteĭn on Markov processes describing large systems of automata (Russian, 1969). However the metric was first defined by Leonid Kantorovich in The Mathematical Method of Production Planning and Organization (Russian original 1939) in the context of optimal transport planning of goods and materials. Some scholars thus encourage use of the terms "Kantorovich metric" and "Kantorovich distance". Most English-language publications use the German spelling "Wasserstein" (attributed to the name "Vaseršteĭn" () being of German origin).
Definition
Let be a metric space that is a Radon space. For , the Wasserstein -distance between two probability measures and on with finite -moments is
where is the set of all couplings of and ; is defined to b
|
https://en.wikipedia.org/wiki/Tzachas
|
Tzachas (), also known as Chaka Bey () was an 11th-century Seljuk Turkish military commander who ruled an independent state based in Smyrna. Originally in Byzantine service, he rebelled and seized Smyrna, much of the Aegean coastlands of Asia Minor and the islands lying off shore in 1088–91. At the peak of his power, he even declared himself Byzantine emperor, and sought to assault Constantinople in conjunction with the Pechenegs. In 1092, a Byzantine naval expedition under John Doukas inflicted a heavy defeat on him and retook Lesbos, while in the next year he was treacherously slain by his son-in-law Kilij Arslan I. Smyrna and the rest of Tzachas' former domain were recovered by the Byzantines a few years later, in 1097.
Life
Very little is known about his life, and that mostly from only one source, the Alexiad of the Byzantine princess Anna Komnene, daughter of Emperor Alexios I Komnenos (). He is also mentioned in the 13th-century Danishmendname as Chavuldur Chaka (), but it is not a very reliable source due to the semi-legendary nature of its material.
According to the Alexiad, Tzachas was originally a raider, who was taken as a prisoner by the Byzantines during the reign of Nikephoros III Botaneiates (). Tzachas entered Byzantine service and advanced rapidly through imperial favour, receiving the title of protonobilissimus and rich gifts. However, when Alexios I Komnenos deposed Botaneiates in 1081, Tzachas lost his position and fled Byzantium.
From ca. 1088 on, he
|
https://en.wikipedia.org/wiki/Corna%20Imagna
|
Corna Imagna is a comune (municipality) in the Province of Bergamo in the Italian region of Lombardy, located about northeast of Milan and about northwest of Bergamo. As of 31 December 2004, it had a population of 968 and an area of .
Corna Imagna borders the following municipalities: Blello, Brembilla, Fuipiano Valle Imagna, Gerosa, Locatello, Rota d'Imagna, Sant'Omobono Imagna.
Demographic evolution
References
|
https://en.wikipedia.org/wiki/Claire%20M.%20Fraser
|
Claire M. Fraser (born 1955) is an American genome scientist and microbiologist who has worked in microbial genomics and genome medicine. Her research has contributed to the understanding of the diversity and evolution of microbial life. Fraser is the director of the Institute for Genome Sciences at the University of Maryland School of Medicine in Baltimore, MD, where she holds the Dean's Endowed Professorship in the School of Medicine. She has joint faculty appointments at the University of Maryland School of Medicine in the Departments of Medicine and Microbiology/Immunology. In 2019, she began serving a one-year term as President-Elect for the American Association for the Advancement of Science (AAAS), which will be followed by a one-year term as AAAS president starting in February 2020 and a one-year term as chair of the Board of Directors in February 2021.
Early life
Fraser was raised by a high school principal and an elementary school teacher in Saugus, MA a suburb of Boston, MA. She performed well at school and was always interested in learning. She became interested in science after being taught biology in high school. At Rensselaer Polytechnic Institute (RPI), during her senior year, she performed independent research in a research lab.
Education
Fraser received her B.S. degree in Biology from Rensselaer Polytechnic Institute in 1977 and her Ph.D. degree in Pharmacology at the State University of New York at Buffalo in 1981 with a thesis entitled "Autoantibodies a
|
https://en.wikipedia.org/wiki/Schramm%E2%80%93Loewner%20evolution
|
In probability theory, the Schramm–Loewner evolution with parameter κ, also known as stochastic Loewner evolution (SLEκ), is a family of random planar curves that have been proven to be the scaling limit of a variety of two-dimensional lattice models in statistical mechanics. Given a parameter κ and a domain in the complex plane U, it gives a family of random curves in U, with κ controlling how much the curve turns. There are two main variants of SLE, chordal SLE which gives a family of random curves from two fixed boundary points, and radial SLE, which gives a family of random curves from a fixed boundary point to a fixed interior point. These curves are defined to satisfy conformal invariance and a domain Markov property.
It was discovered by as a conjectured scaling limit of the planar uniform spanning tree (UST) and the planar loop-erased random walk (LERW) probabilistic processes, and developed by him together with Greg Lawler and Wendelin Werner in a series of joint papers.
Besides UST and LERW, the Schramm–Loewner evolution is conjectured or proven to describe the scaling limit of various stochastic processes in the plane, such as critical percolation, the critical Ising model, the double-dimer model, self-avoiding walks, and other critical statistical mechanics models that exhibit conformal invariance. The SLE curves are the scaling limits of interfaces and other non-self-intersecting random curves in these models. The main idea is that the conformal invariance and
|
https://en.wikipedia.org/wiki/Albatros%20W.4
|
The Albatros W.4 was a German floatplane derivative of the Albatros D.I fighter with new wing and tail surfaces of greater span than the D.I. One hundred eighteen examples (including three prototypes) were built between June 1916 and December 1917. The aircraft operated in the North Sea and Baltic theatres and later served as training aircraft.
The W.4 was powered by the same 120 kW (160 hp) Mercedes D.III engine fitted to the D.I and based on the same fuselage. The first production series W.4s were armed with one lMG08 7.92 mm (.312 in) machine gun. Later aircraft carried two guns.
Operators
Luftstreitkräfte - 118 aircraft
KuKLFT - 8 aircraft delivered in July 1918
Specifications (W.4)
References
Bibliography
Green, W. & Swanborough, G. (1994). The Complete Book of Fighters. London: Salamander Books.
luftfahrt-archiv.de
Grosz, Peter M. (1995). Albatros W4. Windsock Mini Datafile No. 1. Berkhamsted: Albatros Productions. .
Biplanes
Single-engined tractor aircraft
1910s German fighter aircraft
Floatplanes
W.4
Aircraft first flown in 1916
|
https://en.wikipedia.org/wiki/Albatros%20Dr.I
|
The Albatros Dr. I was a German fighter triplane derivative of the D.V fitted with three pairs of wings instead of two. Identical in most other respects to the D.V, in the summer of 1917 it was flown side by side with the existing biplane in comparison trials. There was no discernible performance advantage and development was halted at the prototype stage.
Specifications
Notes
References
Gray, P. and Thetford, O. German Aircraft of the First World War. London: Putnam, 1962
Green, W. & Swanborough, G. The Complete Book of Fighters. London: Salamander Books, 1994
Single-engined tractor aircraft
1910s German fighter aircraft
Military aircraft of World War I
Dr.I
Triplanes
Aircraft first flown in 1917
|
https://en.wikipedia.org/wiki/Pravica
|
Pravica () is a village and municipality in the Veľký Krtíš District of the Banská Bystrica Region of southern Slovakia.
External links
http://www.statistics.sk/mosmis/eng/run.html
Villages and municipalities in Veľký Krtíš District
|
https://en.wikipedia.org/wiki/Vinica%2C%20Ve%C4%BEk%C3%BD%20Krt%C3%AD%C5%A1%20District
|
Vinica () is a village and municipality in the Veľký Krtíš District of the Banská Bystrica Region of southern Slovakia.
External links
http://www.vinica.sk
http://www.statistics.sk/mosmis/eng/run.html
Villages and municipalities in Veľký Krtíš District
|
https://en.wikipedia.org/wiki/Vieska%2C%20Ve%C4%BEk%C3%BD%20Krt%C3%AD%C5%A1%20District
|
Vieska () is a village and municipality in the Veľký Krtíš District of the Banská Bystrica Region of southern Slovakia.
External links
http://www.statistics.sk/mosmis/eng/run.html
Villages and municipalities in Veľký Krtíš District
|
https://en.wikipedia.org/wiki/Crystallography%20and%20NMR%20system
|
CNS or Crystallography and NMR system, is a software library for computational structural biology. It is an offshoot of X-PLOR and uses much of the same syntax. It is used in the fields of X-ray crystallography and NMR spectroscopy of biological macromolecules.
References
External links
The program's webpage and reference manual
Science software
Computer libraries
|
https://en.wikipedia.org/wiki/Kawai%20XD-5
|
The Kawai XD-5 is a percussion synthesizer based on the Kawai K4 sample playback (but uses 16-bit 44.1 kHz sample rate as opposed to 32 kHz ) with filter and AM amplifier modulation synthesis architecture. It is essentially a Kawai K4r with percussion waveforms, plus faster envelopes, gate mode and amplifier to better suit percussion sounds. The XD-5 also features include 32 digital oscillators each capable of using one of 256 available 16-bit waveforms, a digital filter with self resonance and 8 individual outputs.
Expandability
The XD-5 uses expansion cards to allow an increased number of tones to be stored externally.. One card can hold 64 Patches, 16 kit Patches and 16 output patches.
Sounds
Kick, snare, rim, tom, hi hat, cymbals and other assorted percussion sounds as well as 41 Digital Cyclic waveforms.
Notable users
THD
Tim Conrardy
Klangwelt
Richie Hawtin
References
External links
Text from the original XD-5 sales brochure archived on Audio Playground
Kawai synthesizers
Drum machines
|
https://en.wikipedia.org/wiki/Kerguelen%20tern
|
The Kerguelen tern (Sterna virgata) is a tern of the southern hemisphere.
This seabird mainly breeds colonially in the Kerguelen Islands, as its common name implies. However, smaller colonies are also found in the Prince Edward Islands (i.e. Prince Edward and Marion) and Crozet Islands. The total number of individuals is from 3,500 to 6,500 birds, although there is no recent data from the main colony at Kerguelen. These birds do not inhabit Kerguelen proper, instead nesting on islets free of feral cats. During bad weather, they are known to abandon their colonies.
Kerguelen terns are among the least-ranging of all typical terns. They generally do not reach far into the seas near their breeding grounds.
These birds eat fish and marine invertebrates, especially those found in beds of the seaweed Macrocystis spp. They sometimes also hunt insects on land and catch fish from rivers on Kerguelen.
There are two subspecies:
S. v. mercuri (Voisin, 1971) – Crozet and Prince Edward Island’s
S. v. virgata (Cabanis, 1875) – Kerguelen Island
References
Sterna virgata at Birdlife International accessed August 26, 2006
Kerguelen tern
Birds of the Indian Ocean
Birds of subantarctic islands
Fauna of the Crozet Islands
Fauna of the Kerguelen Islands
Fauna of the Prince Edward Islands
Kerguelen tern
|
https://en.wikipedia.org/wiki/Random%20effects%20model
|
In statistics, a random effects model, also called a variance components model, is a statistical model where the model parameters are random variables. It is a kind of hierarchical linear model, which assumes that the data being analysed are drawn from a hierarchy of different populations whose differences relate to that hierarchy. A random effects model is a special case of a mixed model.
Contrast this to the biostatistics definitions, as biostatisticians use "fixed" and "random" effects to respectively refer to the population-average and subject-specific effects (and where the latter are generally assumed to be unknown, latent variables).
Qualitative description
Random effect models assist in controlling for unobserved heterogeneity when the heterogeneity is constant over time and not correlated with independent variables. This constant can be removed from longitudinal data through differencing, since taking a first difference will remove any time invariant components of the model.
Two common assumptions can be made about the individual specific effect: the random effects assumption and the fixed effects assumption. The random effects assumption is that the individual unobserved heterogeneity is uncorrelated with the independent variables. The fixed effect assumption is that the individual specific effect is correlated with the independent variables.
If the random effects assumption holds, the random effects estimator is more efficient than the fixed effects model.
Sim
|
https://en.wikipedia.org/wiki/Iduronate-2-sulfatase
|
Iduronate 2-sulfatase (EC 3.1.6.13; systematic name L-iduronate-2-sulfate 2-sulfohydrolase) is a sulfatase enzyme associated with Hunter syndrome. It catalyses hydrolysis of the 2-sulfate groups of the L-iduronate 2-sulfate units of dermatan sulfate, heparan sulfate and heparin.
Function
Iduronate 2-sulfatase is required for the lysosomal degradation of heparan sulfate and dermatan sulfate. Mutations in this X-chromosome gene that result in enzymatic deficiency lead to the sex-linked mucopolysaccharidosis type II, also known as Hunter syndrome. At least 174 disease-causing mutations in this gene have been discovered. Iduronate-2-sulfatase has a strong sequence homology with human arylsulfatases A, B, and C, and human glucosamine-6-sulfatase. A splice variant of this gene has been described.
See also
Idursulfase
References
Further reading
External links
GeneReviews/NIH/NCBI/UW entry on Mucopolysaccharidosis Type II
EC 3.1.6
|
https://en.wikipedia.org/wiki/N-acetylgalactosamine-4-sulfatase
|
N-acetylgalactosamine-4-sulfatase (EC 3.1.6.12, chondroitinsulfatase, chondroitinase, arylsulfatase B, acetylgalactosamine 4-sulfatase, N-acetylgalactosamine 4-sulfate sulfohydrolase) is an enzyme with systematic name N-acetyl-D-galactosamine-4-sulfate 4-sulfohydrolase. It catalyses the following reaction:
Hydrolysis of the 4-sulfate groups of the N-acetyl-D-galactosamine 4-sulfate units of chondroitin sulfate and dermatan sulfate.
It also acts on N-acetylglucosamine 4-sulfate.
See also
Arylsulfatase B
References
External links
EC 3.1.6
|
https://en.wikipedia.org/wiki/Picamar
|
Picamar is a colorless, hydrocarbon oil extracted from the creosote of beechwood tar with a peculiar odor and bitter taste. It consists of derivatives of pyrogallol. It was discovered by German chemist Carl Reichenbach in the 1830s. Picamar can be used to lubricate machinery.
Chemical and physical properties
The exact composition of picamar is unknown. According to Pastrovich, picamar is a monomethyl ether of propyl-pyrogallol (). However, Gustav Niederist, who obtained an original sample of the oil as prepared by von Reichenbach himself, assigned it a formula of . Picamar is colorless with a peculiar, peppermint-like odor and bitter taste. It is soluble in alcohol and sparingly soluble in water. It has a melting point of . Picamar reduces the red oxide of mercury to its metallic state. It reacts with nitric acid to become a reddish-brown, greasy substance and can also dissolve camphor, resin, and benzoic acids.
History
The name "picamar" is derived from the Latin phrase in pice amarum (meaning "bitter principle of tar"). It was discovered by German chemist Carl Reichenbach in the 1830s as one of the six principles of beechwood tar, along with other substances as capnomor and eupione that were "met with less notice".
Applications
Picamar is used for greasing machinery and preventing them from rusting.
References
Hydrocarbons
Phenols
|
https://en.wikipedia.org/wiki/Glyceronephosphate%20O-acyltransferase
|
Glyceronephosphate O-acyltransferase is an enzyme associated with Rhizomelic chondrodysplasia punctata type 2.
GNPAT is located on chromosome 1 on the plus strand. The gene C1orf131 is located directly upstream of it, and the closest downstream gene is EXOC8.
References
External links
EC 2.3.1
|
https://en.wikipedia.org/wiki/International%20Classification%20of%20Sleep%20Disorders
|
The International Classification of Sleep Disorders (ICSD) is "a primary diagnostic, epidemiological and coding resource for clinicians and researchers in the field of sleep and sleep medicine". The ICSD was produced by the American Academy of Sleep Medicine (AASM) in association with the European Sleep Research Society, the Japanese Society of Sleep Research, and the Latin American Sleep Society. The classification was developed as a revision and update of the Diagnostic Classification of Sleep and Arousal Disorders (DCSAD) that was produced by both the Association of Sleep Disorders Centers (ASDC) and the Association for the Psychophysiological Study of Sleep and was published in the journal Sleep in 1979. A second edition, called ICSD-2, was published by the AASM in 2005. The third edition, ICSD-3, was released by the AASM in 2014. A text revision of the third edition (ICSD-3-TR) was published in 2023 by the AASM.
Milestones of sleep disorder classifications
Introduction
In 1979, the first Diagnostic Classification of Sleep and Arousal Disorders (DCSAD) was developed by the Association of Sleep Disorders Centers (ASDC) and the Association for the Psychophysiological Study of Sleep. Disorders were divided into four main categories.
Disorders of initiating and maintaining sleep (DIMS) – Insomnias
Disorders of Excessive somnolence (DOES) – Hypersomnias
Disorders of the Sleep-Wake Schedule – Circadian Disorders
Dysfunctions Associated with Sleep, Sleep Stages, or Par
|
https://en.wikipedia.org/wiki/Mehdi%20Hasheminasab
|
Seyyed Mehdi Hasheminasab (; born January 27, 1974) is a retired Iranian footballer.
Club career
He served his golden days in Persepolis and Esteghlal.
Club career statistics
International career
After a number of very good seasons with Persepolis, Hasheminasab was called up to the national team, earning his first cap versus Kuwait on February 15, 1999. He was also a member of the national team during the World Cup 2002 qualification campaign. Some consider him and a number of other players to be responsible for the poor atmosphere in the national team camp, and its eventual failure to qualify. In his career he achieved 28 caps and 2 goals.
References
External links
Mehdi Hasheminasab at PersianLeague.com
Mehdi Hasheminasab at TeamMelli.com
Quds Daily
Tebyan
1973 births
Living people
Footballers from Abadan, Iran
Iranian men's footballers
Iran men's international footballers
Iranian expatriate men's footballers
Expatriate men's footballers in Turkmenistan
FK Köpetdag Aşgabat players
Esteghlal F.C. players
Persepolis F.C. players
Siah Jamegan F.C. players
PAS Tehran F.C. players
Sanat Naft Abadan F.C. players
Payam Khorasan F.C. players
F.C. Aboomoslem players
Azadegan League players
2000 AFC Asian Cup players
Men's association football defenders
|
https://en.wikipedia.org/wiki/Batting%20average%20on%20balls%20in%20play
|
In baseball statistics, batting average on balls in play (abbreviated BABIP) is a measurement of how often batted balls result in hits, excluding home runs. It can be expressed as, "when you hit the ball and it’s not a home run, what’s your batting average?" The statistic is typically used to evaluate individual batters and individual pitchers.
Calculation
BABIP is computed per the following equation, where H is hits, HR is home runs, AB is at bats, K is strikeouts, and SF is sacrifice flies.
Effect
As compared to batting average, which is simply hits divided by at bats, BABIP excludes home runs and strikeouts from consideration while treating sacrifice flies as hitless at bats.
In Major League Baseball (MLB), .300 is considered an average BABIP. Various factors can impact BABIP, such as a player's home ballpark; for batters, being speedy enough to reach base on infield hits; or, for pitchers, the quality of their team's defense.
Usage
BABIP is commonly used as a red flag in sabermetric analysis, as a consistently high or low BABIP is hard to maintain—much more so for pitchers than hitters. Therefore, BABIP can be used to spot outlying seasons by pitchers. As with other statistical measures, those pitchers whose BABIPs are extremely high (bad) can often be expected to improve in the following season, and those pitchers whose BABIPs are extremely low (good) can often be expected to worsen in the following season.
While a pitcher's BABIP may vary from season to season, th
|
https://en.wikipedia.org/wiki/Catcher%27s%20ERA
|
Catcher's ERA (CERA) in baseball statistics is the earned run average of the pitchers pitching when the catcher in question is catching. Its primary purpose is to measure a catcher's game-calling, rather than his effect on the opposing team's running game. Craig Wright first described the concept of CERA in his 1989 book The Diamond Appraised. With it, Wright developed a method of determining a catcher's effect on a team's pitching staff by comparing pitchers' performance when playing with different catchers.
Baseball Prospectus writer Keith Woolner has written that "catcher game-calling isn't a statistically significant skill" after doing statistical analysis of catcher performance. Sabermetrician Bill James also performed research into CERA, finding that while it is possible that catchers may have a significant effect on a pitching staff, there is too much yearly variation in CERA for it to be a reliable indicator of ability. James used simulations of catchers with assigned defensive values to directly compare CERAs, which influenced Woolner to perform similar simulations but instead using weighted events to calculate pitchers' runs per plate appearance. Through this, Woolner concluded that even if catchers do have an effect on pitchers' abilities to prevent runs, it is undetectable and thus has no practical usage. He also stated that "the hypothesis most consistent with the available facts appears to be that catchers do not have a significant effect on pitcher perfo
|
https://en.wikipedia.org/wiki/Reservoir%20simulation
|
Reservoir simulation is an area of reservoir engineering in which computer models are used to predict the flow of fluids (typically, oil, water, and gas) through porous media.
The creation of models of oil fields and the implementation of calculations of field development on their basis is one of the main areas of activity of engineers and oil researchers. On the basis of geological and physical information about the properties of an oil, gas or gas condensate field, consideration of the capabilities of the systems and technologies for its development create quantitative ideas about the development of the field as a whole. A system of interrelated quantitative ideas about the development of a field is a model of its development, which consists of a reservoir model and a model of a field development process. Layer models and processes for extracting oil and gas from them are always clothed in a mathematical form, i.e. characterized by certain mathematical relationships. The main task of the engineer engaged in the calculation of the development of an oil field is to draw up a calculation model based on individual concepts derived from a geological-geophysical study of the field, as well as hydrodynamic studies of wells. Generally speaking, any combination of reservoir models and development process can be used in an oil field development model, as long as this combination most accurately reflects reservoir properties and processes. At the same time, the choice of a particular
|
https://en.wikipedia.org/wiki/Sri%20Lanka%20montane%20rain%20forests
|
The Sri Lanka montane rain forests is an ecoregion found above 1,000 m in the central highlands of Sri Lanka. Owing to their rich biodiversity, this region is considered to be a super-hotspot within endemic hotspots of global importance. These forests are cooler than lowland forests and therefore they have ideal conditions for growth of cloud forests. These forests classifications tropical sub montane forest, tropical sub-montane and tropical upper montane. Half of Sri Lanka's endemic flowering plants and 51 percent of the endemic vertebrates are restricted to these forests. More than 34 percent of Sri Lanka's endemic trees, shrubs, and herbs can only be found in this ecoregion. Twisted, stunted trees are a common sight in these forests, together with many varieties of orchids, mosses and ferns. The trees of montane rain forests grow to a height 10–15 meters, shorter than the lowland rain forest trees. These high altitude forests are the catchment area for most of Sri Lanka's major rivers.
Forest cover
Sri Lanka's montane forests are located above 1,220 m. The montane rain forests cover 3,099.5 ha in total, or 0.05 percent of Sri Lanka's total area. These forests are found in the mountain tops, such as Pidurutalagala, Kikilimana, Meepilimana, Agrabopaththalawa, Adam's Peak and Hakgala. In lower elevations, at altitudes ranging 1,000–1,500 m, submontane forests occur; those forests account for 1.04 percent of the nation's area, totalling 65,793.3 ha.
Geological history
Sri L
|
https://en.wikipedia.org/wiki/Malvidin
|
Malvidin is an O-methylated anthocyanidin, the 3',5'-methoxy derivative of delphinidin. As a primary plant pigment, its glycosides are highly abundant in nature.
Natural occurrences
Malvidin is responsible for the blue color found in petals of the Primula plants of the polyanthus group. Blue flowers of the blue pimpernel (Anagallis monelli) have also a higher concentration of malvidin.
It is responsible primarily for the color of red wine, Vitis vinifera being one of its sources. It is also present in other berries, such as blueberries (Vaccinium corymbosum) or the saskatoon berries (Amelanchier alnifolia).
Chemistry
Slightly acidic and neutral solutions of malvidin are characteristically of a red color, while basic solutions of malvidin yield a blue color.
The breakdown of malvidin releases syringic acid.
Use as a marker in archaeology
The breakdown of malvidin releases syringic acid as revealed in the examination of jars containing shedeh, a drink of Ancient Egypt. Malvidin is also present in the site of the Areni-1 winery, a 6,100-year-old winery discovered in 2007 in the Areni-1 cave complex in the village of Areni in the Vayots Dzor province of Armenia.
Glycosides
Malvin is a malvidin diglucoside.
Oenin is the malvidin-3-glucoside.
Primulin is the 3-O-galactoside of malvidin.
Malvidin 3-rutinoside is a pigment responsible for bract color in Curcuma alismatifolia (the Siam tulip). Acylated malvidin 3-rutinosides are responsible for the violet color of Petuni
|
https://en.wikipedia.org/wiki/Transistor%20Blast%3A%20The%20Best%20of%20the%20BBC%20Sessions
|
Transistor Blast: The Best of the BBC Sessions is a 4-disc boxed set by the English rock band XTC, released by Cooking Vinyl in November 1998, just three months prior to the studio album Apple Venus Volume 1.
Tracks on the first two discs are culled from various BBC radio sessions the group performed on over the years, notably for John Peel and David Jensen. Discs three and four are live recordings, the latter of which was previously released as BBC Radio 1 Live in Concert and is now titled Live in Concert 1980 on streaming services such as Spotify and Apple Music.
"Opening Speech" from the first disc is Andy Partridge imitating John Peel.
Track listing
UK CD: COOKCD152
All songs written by Andy Partridge, except where noted.
Disc one
Studio sessions
"Opening Speech" – 0:49 [John Peel Show: Recorded 8 October 1979; Aired 15 October 1979]
"Life Begins at the Hop" (Colin Moulding) – 4:19 [David "Kid" Jensen Show: Recorded 21 May 1979; Aired 31 May 1979]
"Scarecrow People" – 4:13 [Richard Skinner Show: Recorded 16 March 1989; Aired 5 April 1989]
"Seagulls Screaming Kiss Her, Kiss Her" – 4:21 [Bruno Brookes Show: Recorded 11 October 1984; Aired 20 November 1984]
"Ten Feet Tall" (Moulding) – 2:53 [John Peel Show: Recorded 8 October 1979; Aired 15 October 1979]
"Garden of Earthly Delights" – 5:33 [Andy Kershaw Show: Recorded 16 March 1989; Aired 11 June 1989]
"Runaways" (Moulding) – 4:41 [David "Kid" Jensen Show: Recorded 14 January 1982; Aired 25 January 1982]
"When You're Ne
|
https://en.wikipedia.org/wiki/Such%C3%A9%20Brezovo
|
Suché Brezovo () is a village and municipality in the Veľký Krtíš District of the Banská Bystrica Region of southern Slovakia.
External links
http://www.statistics.sk/mosmis/eng/run.html
Villages and municipalities in Veľký Krtíš District
|
https://en.wikipedia.org/wiki/Fluocinolone%20acetonide
|
Fluocinolone acetonide is a corticosteroid primarily used in dermatology to reduce skin inflammation and relieve itching. It is a synthetic hydrocortisone derivative. The fluorine substitution at position 9 in the steroid nucleus greatly enhances its activity. It was first synthesized in 1959 in the Research Department of Syntex Laboratories S.A. Mexico City. Preparations containing it were first marketed under the name Synalar. A typical dosage strength used in dermatology is 0.01–0.025%. One such cream is sold under the brand name Flucort-N and includes the antibiotic neomycin.
Fluocinolone acetonide was also found to strongly potentiate TGF-β-associated chondrogenesis of bone marrow mesenchymal stem/progenitor cells, by increasing the levels of collagen type II by more than 100 fold compared to the widely used dexamethasone.
Fluocinolone acetonide intravitreal implants have been used to treat non-infectious uveitis. A systematic review could not determine with any confidence whether fluocinolone acetonide implants are superior to standard of care treatment for uveitis. A fluocinolone acetonide intravitreal implant with the brand name Iluvien is sold by biopharmaceutical company Alimera Sciences to treat diabetic macular edema (DME).
It was approved for medical use in 1961.
Classification
Fluocinolone is a group V (0.025%) or group VI (0.01%) corticosteroid under US classification.
See also
Topical steroid
Fluocinonide
Ciprocinonide
Glucocorticoid
References
Ext
|
https://en.wikipedia.org/wiki/Meprednisone
|
Meprednisone is a glucocorticoid. It is a methylated derivative of prednisone.
See also
Glucocorticoid
Corticosteroid
References
Diols
Glucocorticoids
Pregnanes
Triketones
|
https://en.wikipedia.org/wiki/Slovensk%C3%A9%20%C4%8Earmoty
|
Slovenské Ďarmoty () is a village and municipality in the Veľký Krtíš District of the Banská Bystrica Region of southern Slovakia.
References
External links
http://www.statistics.sk/mosmis/eng/run.html
Villages and municipalities in Veľký Krtíš District
|
https://en.wikipedia.org/wiki/Mu%C4%BEa
|
Muľa () is a village and municipality in the Veľký Krtíš District of the Banská Bystrica Region of southern Slovakia.
External links
https://web.archive.org/web/20071217080336/http://www.statistics.sk/mosmis/eng/run.html
Villages and municipalities in Veľký Krtíš District
|
https://en.wikipedia.org/wiki/P%C3%B4tor
|
Pôtor () is a village and municipality in the Veľký Krtíš District of the Banská Bystrica Region of southern Slovakia.
External links
http://www.statistics.sk/mosmis/eng/run.html
Villages and municipalities in Veľký Krtíš District
|
https://en.wikipedia.org/wiki/Pr%C3%ADbelce
|
Príbelce () is a village and municipality in the Veľký Krtíš District of the Banská Bystrica Region of southern Slovakia.
External links
http://www.statistics.sk/mosmis/eng/run.html
Villages and municipalities in Veľký Krtíš District
|
https://en.wikipedia.org/wiki/Stredn%C3%A9%20Plachtince
|
Stredné Plachtince () is a village and municipality in the Veľký Krtíš District of the Banská Bystrica Region of southern Slovakia.
External links
http://www.statistics.sk/mosmis/eng/run.html
Villages and municipalities in Veľký Krtíš District
|
https://en.wikipedia.org/wiki/Slovensk%C3%A9%20K%C4%BEa%C4%8Dany
|
Slovenské Kľačany () is a village and municipality in the Veľký Krtíš District of the Banská Bystrica Region of southern Slovakia.
External links
http://www.statistics.sk/mosmis/eng/run.html
Villages and municipalities in Veľký Krtíš District
|
https://en.wikipedia.org/wiki/Se%C4%8Dianky
|
Sečianky () is a village and municipality in the Veľký Krtíš District of the Banská Bystrica Region of southern Slovakia.
External links
http://www.statistics.sk/mosmis/eng/run.html
Villages and municipalities in Veľký Krtíš District
|
https://en.wikipedia.org/wiki/Such%C3%A1%C5%88
|
Sucháň () is a village and municipality in the Veľký Krtíš District of the Banská Bystrica Region of southern Slovakia.
External links
http://www.statistics.sk/mosmis/eng/run.html
It is also the best name ever!
Villages and municipalities in Veľký Krtíš District
|
https://en.wikipedia.org/wiki/NS1
|
NS1, NS 1, NS-1, NS.1, or variation, may refer to:
Non-structural protein 1
NS1 influenza protein
NS1 dengue protein, used for NS1 antigen test
Human bocavirus NS1
Carnivore bocaparvovirus 1 NS1
Japanese encephalitis virus NS1
Minute virus of mice NS1
West Nile virus NS1
Yellow fever virus NS1
Places
Jurong East MRT station (station code: NS1), Jurong East, Singapore
Kawanishi-Noseguchi Station (station code: NS01), Kawanishi, Hyōgo Prefecture, Japan
Ōmiya Station (Saitama) (station code: NS01), Ōmiya-ku, Saitama, Japan
Annapolis (provincial electoral district), constituency N.S. 01; Nova Scotia, Canada
Aerospace
U.S.S. NS-1, a U.S. Navy airship; see British blimps operated by the USN
RAF N.S. 1, a British NS class airship
Spartan NS-1, U.S. military trainer biplane
Stearman NS-1, U.S. military trainer biplane
New Shepard 1, a Blue Origin reusable space launch vehicle booster rocket (booster #1)
Blue Origin NS-1, a 2015 April 29 Blue Origin suborbital spaceflight mission for the New Shepard
Other uses
Novelty seeking level 1, exploratory excitability
ns (simulator), version ns-1, computer network simulation software
Netscape Navigator 1.0/1.1; a webbrowser
See also
NSI (disambiguation)
NSL (disambiguation)
NS (disambiguation)
1 (disambiguation)
|
https://en.wikipedia.org/wiki/Ulobetasol
|
Ulobetasol (INN) or halobetasol (USAN) is a corticosteroid used to treat psoriasis. It is a class I corticosteroid under the US classification and a group III corticosteroid under international classification, the most potent group of such drugs.
Ulobetasol propionate is usually supplied as a 0.05% topical cream. Ulobetasol is the strongest topical steroid available. It is also sold with tazarotene with 0.01% halobetasol and 0.045% tazarotene as a lotion branded as Duobrii (Bausch Health).
It is available as a generic medication.
References
External links
Glucocorticoids
Organofluorides
Organochlorides
Alcohols
Ketones
Halohydrins
|
https://en.wikipedia.org/wiki/Biodiversity%20action%20plan
|
A biodiversity action plan (BAP) is an internationally recognized program addressing threatened species and habitats and is designed to protect and restore biological systems. The original impetus for these plans derives from the 1992 Convention on Biological Diversity (CBD). As of 2009, 191 countries have ratified the CBD, but only a fraction of these have developed substantive BAP documents.
The principal elements of a BAP typically include: (a) preparing inventories of biological information for selected species or habitats; (b) assessing the conservation status of species within specified ecosystems; (c) creation of targets for conservation and restoration; and (d) establishing budgets, timelines and institutional partnerships for implementing the BAP.
Species plans
A fundamental method of engagement to a BAP is thorough documentation regarding individual species, with emphasis upon the population distribution and conservation status. This task, while fundamental, is highly daunting, since only an estimated ten percent of the world’s species are believed to have been characterized as of 2006, most of these unknowns being fungi, invertebrate animals, micro-organisms and plants. For many bird, mammal and reptile species, information is often available in published literature; however, for fungi, invertebrate animals, micro-organisms and many plants, such information may require considerable local data collection. It is also useful to compile time trends of population est
|
https://en.wikipedia.org/wiki/Halcinonide
|
Halcinonide is a high potency corticosteroid, in group II (second most potent group) under US classification. It is used topically (in a 0.05% cream provided as Halog) in the treatment of certain skin conditions.
References
Acetonides
Secondary alcohols
Chloroarenes
Corticosteroid cyclic ketals
Corticosteroids
Diketones
Fluoroarenes
Glucocorticoids
|
https://en.wikipedia.org/wiki/Magnetic%20developer
|
Magnetic developer is a fluid which makes the magnetic information written on magnetic tape or the magnetic stripe of a credit card or ATM card visible to the naked eye.
Magnetic developer can be found in liquid or aerosol form. When applied to a magnetic stripe, suspended metal particles will be attracted to the magnetically charged regions of the stripe as the liquid evaporates. The particles can be made of carbonyl iron.
Magnetic developer can be used to troubleshoot problems with magnetic stripes and the equipment that encodes and reads them. By making the encoding visible, one can see how encoding head alignment affects the position of the data tracks, and observe any possible magnetic damage that has occurred on the magnetic stripe.
See also
Magnasee
References
Magnetic devices
|
https://en.wikipedia.org/wiki/Se%C4%BEany
|
Seľany () is a village and municipality in the Veľký Krtíš District of the Banská Bystrica Region of southern Slovakia.
External links
http://www.statistics.sk/mosmis/eng/run.html
Villages and municipalities in Veľký Krtíš District
|
https://en.wikipedia.org/wiki/Senn%C3%A9%2C%20Ve%C4%BEk%C3%BD%20Krt%C3%AD%C5%A1%20District
|
Senné () is a village and municipality in the Veľký Krtíš District of the Banská Bystrica Region of southern Slovakia.
External links
http://www.statistics.sk/mosmis/eng/run.html
Villages and municipalities in Veľký Krtíš District
|
https://en.wikipedia.org/wiki/%C5%A0ir%C3%A1kov
|
Širákov () is a village and municipality in the Veľký Krtíš District of the Banská Bystrica Region of southern Slovakia.
External links
Statistics
Villages and municipalities in Veľký Krtíš District
|
https://en.wikipedia.org/wiki/%C5%A0u%C4%BEa
|
Šuľa () is a village and municipality in the Veľký Krtíš District of the Banská Bystrica Region of southern Slovakia.
External links
http://www.statistics.sk/mosmis/eng/run.html
Villages and municipalities in Veľký Krtíš District
|
https://en.wikipedia.org/wiki/List%20of%20career%20achievements%20by%20Michael%20Jordan
|
This page details statistics, records, and other achievements pertaining to Michael Jordan.
College statistics
The three-point line did not exist during Michael Jordan's freshman and junior seasons in North Carolina in the NCAA. During his sophomore season, the three-point line was tested within ACC play. Many other conferences also tested with the line during this season, but again, only within their respective conference competition.
Averages
Totals
NBA career statistics
Averages
Totals
Source: basketball-reference.com and nba.com
Playoffs
Source: basketball-reference.com
Awards and accomplishments
NBA achievements
Naismith Memorial Basketball Hall of Fame Class of 2009
6× NBA champion: 1991, 1992, 1993, 1996, 1997, 1998
5× NBA Most Valuable Player: 1987–88, 1990–91, 1991–92, 1995–96, 1997–98
6× NBA Finals Most Valuable Player: 1991, 1992, 1993, 1996, 1997, 1998
10× Scoring leader: 1986–87, 1987–88, 1988–89, 1989–90, 1990–91, 1991–92, 1992–93, 1995–96, 1996–97, 1997–98
NBA Defensive Player of the Year: 1987–88
NBA Rookie of the Year: 1984–85
14× NBA All-Star: 1985, 1986 (selected but injured), 1987, 1988, 1989, 1990, 1991, 1992, 1993, 1996, 1997, 1998, 2002, 2003
3× NBA All-Star Game Most Valuable Player: 1988, 1996, 1998
2× NBA Slam Dunk Contest champion: 1987, 1988
Runner-up in 1985
3× Steals leader: 1987–88, 1989–90, 1992–93
2× Minutes leader: 1987–88, 1988–89
2× IBM Award winner: 1985, 1989
11× All-NBA selection:
First Team: 1987–93, 1996
|
https://en.wikipedia.org/wiki/Don%27t%20It%20Make%20My%20Brown%20Eyes%20Blue
|
"Don't It Make My Brown Eyes Blue" is a song written by Richard Leigh, and recorded by American country music singer Crystal Gayle. It was released in June 1977 as the first single from Gayle's album We Must Believe in Magic.
Background
"Don't It Make My Brown Eyes Blue" composer Richard Leigh had been responsible for all three of Crystal Gayle's previous Top Ten C&W hits, the third of which "I'll Get Over You" had reached number 1. According to Gayle's regular producer Allen Reynolds, he was advised by Leigh's landlady, songwriter Sandy Mason Theoret, that Leigh was "a little down in the dumps lately because nothing much [was] happening" after the success of "I'll Get Over You". At Theoret's suggestion, Reynolds visited Leigh to cheer him up. Reynolds explained, "we were sittin' on the floor...singing songs to one another. [Leigh] mentioned a song that his publisher was gonna get to Shirley Bassey...[and] sang it for me: 'Don't It Make My Brown Eyes Blue'. I said, 'Shirley Bassey my ass, I want that song!'" Reynolds recalls that when he played "Don't It Make My Brown Eyes Blue" for Gayle "she was just as excited [by the song] as I was."
The track was recorded at Jack's Tracks in Nashville on October 27, 1976. As Reynolds' regular session keyboardist Charles Cochran had suffered a stroke with some resultant numbness in his hands, Reynolds hired Hargus "Pig" Robbins to play keyboards, and Robbins instantly devised the song's signature acoustic piano riff; Cochran was als
|
https://en.wikipedia.org/wiki/Metering%20pump
|
A metering pump moves a precise volume of liquid in a specified time period providing an accurate volumetric flow rate.
Delivery of fluids in precise adjustable flow rates is sometimes called metering. The term "metering pump" is based on the application or use rather than the exact kind of pump used, although a couple types of pumps are far more suitable than most other types of pumps.
Although metering pumps can pump water, they are often used to pump chemicals, solutions, or other liquids. Many metering pumps are rated to be able to pump into a high discharge pressure. They are typically made to meter at flow rates which are practically constant (when averaged over time) within a wide range of discharge (outlet) pressure. Manufacturers provide each of their models of metering pumps with a maximum discharge pressure rating against which each model is guaranteed to be able to pump against. An engineer, designer, or user should ensure that the pressure and temperature ratings and wetted pump materials are compatible for the application and the type of liquid being pumped.
Most metering pumps have a pump head and a motor. The liquid being pumped goes through the pump head, entering through an inlet line and leaving through an outlet line. The motor is commonly an electric motor which drives the pump head.
Dispensing pump
Some metering pumps can be used for dispensing. A metering pump is designed to deliver a continuous rate of flow, however, a dispensing pump is
|
https://en.wikipedia.org/wiki/Phase%20offset%20modulation
|
Phase offset modulation works by overlaying two instances of a periodic waveform on top of each other. (In software synthesis, the waveform is usually generated by using a lookup table.) The two instances of the waveform are kept slightly out of sync with each other, as one is further ahead or further behind in its cycle. The values of both of the waveforms are either multiplied together, or the value of one is subtracted from the other.
This generates an entirely new waveform with a drastically different shape. For example, one sawtooth (ramp) wave subtracted from another will create a pulse wave, with the amount of offset (i.e. the difference between the two waveforms' starting points) dictating the duty cycle. If you slowly change the offset amount, you create pulse-width modulation.
Using this technique, not only can a ramp wave create pulsewidth modulation, but any other waveform can achieve a comparable effect.
Wave mechanics
|
https://en.wikipedia.org/wiki/Surface%20reconstruction
|
Surface reconstruction refers to the process by which atoms at the surface of a crystal assume a different structure than that of the bulk. Surface reconstructions are important in that they help in the understanding of surface chemistry for various materials, especially in the case where another material is adsorbed onto the surface.
Basic principles
In an ideal infinite crystal, the equilibrium position of each individual atom is determined by the forces exerted by all the other atoms in the crystal, resulting in a periodic structure. If a surface is introduced to the surroundings by terminating the crystal along a given plane, then these forces are altered, changing the equilibrium positions of the remaining atoms. This is most noticeable for the atoms at or near the surface plane, as they now only experience inter-atomic forces from one direction. This imbalance results in the atoms near the surface assuming positions with different spacing and/or symmetry from the bulk atoms, creating a different surface structure. This change in equilibrium positions near the surface can be categorized as either a relaxation or a reconstruction.
Relaxation refers to a change in the position of surface atoms relative to the bulk positions, while the bulk unit cell is preserved at the surface. Often this is a purely normal relaxation: that is, the surface atoms move in a direction normal to the surface plane, usually resulting in a smaller-than-usual inter-layer spacing. This makes int
|
https://en.wikipedia.org/wiki/Simply%20the%20Best
|
Simply the Best may refer to:
Music
Simply the Best (Art Garfunkel album), 1998
Simply the Best (Crystal Lewis album)
Simply the Best (Tina Turner album), 1991
"The Best" (song), also known as "Simply the Best", a 1988 song recorded by Bonnie Tyler and later covered by Tina Turner
"Simply the Best" (song), 2022
Simply the Best, a 2006 mixtape by Scorcher
"Simply the Best", from the television series Schitt's Creek, covered by Noah Reid
Other uses
Simply the Best (game show), a British game show
|
https://en.wikipedia.org/wiki/Concordant%20pair
|
In statistics, a concordant pair is a pair of observations, each on two variables, (X1,Y1) and (X2,Y2), having the property that
where "sgn" refers to whether a number is positive, zero, or negative (its sign). Specifically, the signum function, often represented as sgn, is defined as:
That is, in a concordant pair, both elements of one pair are either greater than, equal to, or less than the corresponding elements of the other pair.
In contrast, a discordant pair is a pair of two-variable observations such that
That is, if one pair contains a higher value of X then the other pair contains a higher value of Y.
Uses
The Kendall tau distance between two series is the total number of discordant pairs. The Kendall tau rank correlation coefficient, which measures how closely related two series of numbers are, is proportional to the difference between the number of concordant pairs and the number of discordant pairs. An estimate of Goodman and Kruskal's gamma, another measure of rank correlation, is given by the ratio of the difference to the sum of the numbers of concordant and discordant pairs. Somers' D is another similar but asymmetric measure given by the ratio of the difference in the number of concordant and discordant pairs to the number of pairs with unequal values for one of the two variables.
See also
Spearman's rank correlation coefficient
References
Abdi, Hervé (2007). "The Kendall Rank Correlation Coefficient". In: Neil Salkind (Ed.), Encyclopedia of Mea
|
https://en.wikipedia.org/wiki/Target-site%20overlap
|
In a zinc finger protein, certain sequences of amino acid residues are able to recognise and bind to an extended target-site of four or even five nucleotides When this occurs in a ZFP in which the three-nucleotide subsites are contiguous, one zinc finger interferes with the target-site of the zinc finger adjacent to it, a situation known as target-site overlap. For example, a zinc finger containing arginine at position -1 and aspartic acid at position 2 along its alpha-helix will recognise an extended sequence of four nucleotides of the sequence 5'-NNG(G/T)-3'. The hydrogen bond between Asp2 and the N4 of either a cytosine or adenine base paired to the guanine or thymine, respectively defines these two nucleotides at the 3' position, defining a sequence that overlaps into the subsite of any zinc finger that may be attached N-terminally.
Target-site overlap limits the modularity of those zinc fingers which exhibit it, by restricting the number of situations to which they can be applied. If some of the zinc fingers are restricted in this way, then a larger repertoire is required to address the situations in which those zinc fingers cannot be used. Target-site overlap may also affect the selection of zinc fingers during by display, in cases where amino acids on a non-randomised finger, and the bases of its associated subsite, influence the binding of residues on the adjacent finger which contains the randomised residues. Indeed, attempts to derive zinc finger proteins targeting
|
https://en.wikipedia.org/wiki/Endoglin
|
Endoglin (ENG) is a type I membrane glycoprotein located on cell surfaces and is part of the TGF beta receptor complex. It is also commonly referred to as CD105, END, FLJ41744, HHT1, ORW and ORW1. It has a crucial role in angiogenesis, therefore, making it an important protein for tumor growth, survival and metastasis of cancer cells to other locations in the body.
Gene and expression
The human endoglin gene is located on human chromosome 9 with location of the cytogenic band at 9q34.11. Endoglin glycoprotein is encoded by 39,757 bp and translates into 658 amino acids.
The expression of the endoglin gene is usually low in resting endothelial cells. This, however, changes once neoangiogenesis begins and endothelial cells become active in places like tumor vessels, inflamed tissues, skin with psoriasis, vascular injury and during embryogenesis. The expression of the vascular system begins at about 4 weeks and continues after that. Other cells in which endoglin is expressed consist of monocytes, especially those transitioning into macrophages, low expression in normal smooth muscle cells, high expression vascular smooth muscle cells and in kidney and liver tissues undergoing fibrosis.
Structure
The glycoprotein consists of a homodimer of 180 kDA stabilized by intermolecular disulfide bonds. It has a large extracellular domain of about 561 amino acids, a hydrophobic transmembrane domain and a short cytoplasmic tail domain composed of 45 amino acids. The 260 amino acid reg
|
https://en.wikipedia.org/wiki/Gibbs%E2%80%93Donnan%20effect
|
The Gibbs–Donnan effect (also known as the Donnan's effect, Donnan law, Donnan equilibrium, or Gibbs–Donnan equilibrium) is a name for the behaviour of charged particles near a semi-permeable membrane that sometimes fail to distribute evenly across the two sides of the membrane. The usual cause is the presence of a different charged substance that is unable to pass through the membrane and thus creates an uneven electrical charge. For example, the large anionic proteins in blood plasma are not permeable to capillary walls. Because small cations are attracted, but are not bound to the proteins, small anions will cross capillary walls away from the anionic proteins more readily than small cations.
Thus, some ionic species can pass through the barrier while others cannot. The solutions may be gels or colloids as well as solutions of electrolytes, and as such the phase boundary between gels, or a gel and a liquid, can also act as a selective barrier. The electric potential arising between two such solutions is called the Donnan potential.
The effect is named after the American physicist Josiah Willard Gibbs who proposed it in 1878 and the British chemist Frederick G. Donnan who studied it experimentally in 1911.
The Donnan equilibrium is prominent in the triphasic model for articular cartilage proposed by Mow and Lai, as well as in electrochemical fuel cells and dialysis.
The Donnan effect is tactic pressure attributable to cations (Na+ and K+) attached to dissolved plasma
|
https://en.wikipedia.org/wiki/La%20Job
|
La Job is a Canadian French-language comedy television series set in Montreal, Quebec. It is an adaptation of the British show The Office. Produced by Anne-Marie Losique's Image Diffusion International, it has been broadcast for a limited number of viewers on Bell Satellite TV satellite television, beginning on October 9, 2006. It was later seen by a wider audience on the public broadcaster Radio-Canada (starting in January 2007) and specialty channel ARTV (starting in the third quarter of the same year). It is the third official foreign adaptation of the concept, and the second in a language other than English.
Synopsis
National industry leader Les Papiers Jennings, a multinational carton and packaging company, is restructuring. The regional manager of their branch on Côte-de-Liesse, Saint-Laurent, in Montreal, is David Gervais (the name is an homage to Ricky Gervais, and his original character David Brent). He will need to compete with the Terrebonne branch and operate an important effort to avoid the shut-down of their branch. He will also have to cope with occasionally rebellious employees.
David is a failed comedian and rocker who also fails to grasp the notion of political correctness. He tends to either make a fool of himself in front of the office crew or make it intensely uncomfortable. The one who seems to enjoy him the most is Sam Bisaillon, former army cadet who worships David. He shares his desk with Louis Tremblay, who is secretly in love with the shy recepti
|
https://en.wikipedia.org/wiki/Charlie-class%20submarine
|
The Project 670 Skat submarine (NATO classification Charlie class) was a nuclear-powered cruise missile submarine built for the Soviet Navy and later operated by the Russian Navy. All Charlie I/II-class submarines are decommissioned. One Charlie-class submarine was used for testing an Oniks missile. Charlie I and its successor Charlie II-class submarines are designed by the Lazurit Central Design Bureau of Gorky.
Background
The Charlie I-class submarine (Project 670 Skat) SSGN was first launched at the Krasnoye Sormovo inland shipyard at Gorkiy in 1967 with another ten following over a period of five years. The Charlie Is had two banks of four missile tubes angled upwards on each side of the bow outside the pressure hull. The tubes were covered by large outer doors and the design was to incorporate the P-120 Malakhit (SS-N-9 Siren) medium-range anti-ship missile. Due to delays in the missile development, the missile was substituted with the shorter range P-70 Ametist (SS-N-7 Starbright) submerged launch missile which itself was a development of the P-15 Termit (SS-N-2 Styx) surface-launched missile. The missiles were designed for pop up surprise attacks on high value surface targets such as aircraft carriers.
In 1972 to 1979, six improved units called the Project 670M Skat-M (Charlie II class) were built. The improved Charlie IIs were built at Gorkiy with an insert in the hull forward of the fin. The insert incorporated electronics and launch systems for targeting and firi
|
https://en.wikipedia.org/wiki/Nanomanufacturing
|
Nanomanufacturing is both the production of nanoscaled materials, which can be powders or fluids, and the manufacturing of parts "bottom up" from nanoscaled materials or "top down" in smallest steps for high precision, used in several technologies such as laser ablation, etching and others. Nanomanufacturing differs from molecular manufacturing, which is the manufacture of complex, nanoscale structures by means of nonbiological mechanosynthesis (and subsequent assembly).
The term "nanomanufacturing" is widely used, e.g. by the European Technology Platform MINAM and the U.S. National Nanotechnology Initiative (NNI). The NNI refers to the sub-domain of nanotechnology as one of its five "priority areas." There is also a nanomanufacturing program at the U.S. National Science Foundation, through which the National Nanomanufacturing Network (NNN) has been established. The NNN is an organization that works to expedite the transition of nanotechnologies from laboratory research to production manufacturing and it does so through information exchange, strategic workshops, and roadmap development.
The NNI has defined nanotechnology very broadly, to include a wide range of tiny structures, including those created by large and imprecise tools. However, nanomanufacturing is not defined in the NNI's recent report, Instrumentation and Metrology for Nanotechnology. In contrast, another "priority area," nanofabrication, is defined as "the ability to fabricate, by directed or self-assembly me
|
https://en.wikipedia.org/wiki/Chevron%20plot
|
A chevron plot is a way of representing protein folding kinetic data in the presence of varying concentrations of denaturant that disrupts the protein's native tertiary structure. The plot is known as "chevron" plot because of the canonical v, or chevron shape observed when the logarithm of the observed relaxation rate is plotted as a function of the denaturant concentration.
In a two-state system, folding and unfolding rates dominate the observed relaxation rates below and above the denaturation midpoint (Cm). This gives rise to the terminology of folding and unfolding arms for the limbs of the chevron. A priori information on the Cm of a protein can be obtained from equilibrium experiments. In fitting to a two-state model, the logarithm of the folding and unfolding rates is assumed to depend linearly on the denaturant concentration, thus resulting in the slopes mf and mu, called the folding and unfolding m-values, respectively (also called the kinetic m-values). The sum of the two rates is the observed relaxation rate. An agreement between equilibrium m-value and the absolute sum of the kinetic m-values is typically seen as a signature for two-state behavior. Most of the reported denaturation experiments have been carried out at 298 K with either urea or guanidinium chloride (GuHCl) as denaturants.
Experimental methodology
To generate the folding limb of the chevron, the protein in a highly concentrated denaturant solution is diluted rapidly (in less than a millisecond) i
|
https://en.wikipedia.org/wiki/Andoni%20Iraola
|
Andoni Iraola Sagarna (, ; born 22 June 1982) is a Spanish professional football manager and former player who is the current manager of club AFC Bournemouth.
Utilized primarily as a right-back through his career, Iraola was highly combative and possessed good passing skills. He spent the vast majority of his professional career with Athletic Bilbao, appearing in 510 competitive matches over 12 seasons.
Iraola began managing in 2018, being in charge of Rayo Vallecano for three years.
Playing career
Club
Athletic Bilbao
Iraola was born in Usurbil, Gipuzkoa. He played as a youth for Antiguoko, alongside teammates such as Mikel Arteta, Xabi Alonso, Mikel Alonso and Aritz Aduriz. A product of Athletic Bilbao's youth system at Lezama, he made his debut with the first team in the 2003–04 season, becoming first-choice while often taking penalties and free kicks. On 30 August 2003, he made his first La Liga appearance, starting in a 1–0 home loss against FC Barcelona, and his five goals in 30 appearances helped the team to qualify for the UEFA Cup.
During his 12 seasons, Iraola never played fewer than 30 league matches, scoring in all but one league campaign – like former club legend Aitor Larrazábal, who played as a left-back– while also helping the Basque side to finish second in three Copa del Rey tournaments and the 2011–12 UEFA Europa League. On 28 January 2007, he netted twice in a 2–0 away win over neighbours Real Sociedad, who were finally relegated; Athletic narrowly
|
https://en.wikipedia.org/wiki/Diaphragm%20valve
|
Diaphragm valves (or membrane valves) consists of a valve body with two or more ports, a flexible diaphragm, and a "weir or saddle" or seat upon which the diaphragm closes the valve. The valve body may be constructed from plastic, metal, wood or other materials depending on the intended use.
Categories
There are two main categories of diaphragm valves: one type seals over a "weir" (saddle) and the other (sometimes called a "full bore or straight-through" valve) seals over a seat. In general, straight-through diaphragm valves are used in on-off applications and weir-type diaphragm valves are used for control or throttling applications. While diaphragm valves usually come in two-port forms (2/2-way diaphragm valve), they can also come with three ports (3/2-way diaphragm valves also called T-valves) and more (so called block-valves). When more than three ports are included, they generally require more than one diaphragm seat; however, special dual actuators can handle more ports with one membrane.
Diaphragm valves can be manual or automated. Automated diaphragm valves may use pneumatic, hydraulic or electric actuators along with accessories such as solenoid valves, limit switches and positioners.
In addition to the well known, two way shut off or throttling diaphragm valve, other types include: Three way zero deadleg valve, sterile access port, block and bleed, valbow and tank bottom valve.
Valve body
Many diaphragm valve body dimensions follow the Manufacturers Standardiz
|
https://en.wikipedia.org/wiki/Image%20Diffusion%20International
|
Image Diffusion International (IDI) is a Quebec production company founded by Anne-Marie Losique and Marc Trudeau in 1995. Based in Montreal, it specializes in producing entertainment and lifestyle television magazines. Its shows are sometimes Quebec-based in French and sometimes edited in two versions, French and English. Some of their programmes are shot in the studios of MusiquePlus, a music television station on which many IDI shows are aired. IDI's productions are broadcast on multiple networks across Quebec and Canada. Its show Sex-shop was sold to French television station XXL. Subject matter of their programs include cinema, travel (including gay tourism) and nightlife. A number of their television shows also feature the sex industry.
Productions
In French and English
Box-office
Écrans du monde (Screens)
Gros plan sur… (Spotlight On…)
Il a dit, Elle a dit (He Said, She Said)
Colour Travel Series
Blue: "the world’s most beautiful beaches"
Grey: "the trendiest and most avant-garde cities"
Green: "uncovering the natural beauties of our planet"
Pink: "the hottest gay vacations"
White: "the world’s most beautiful mountains"
Yellow: "exploring the world’s deserts"
Red: "the nightlife - why some cities never sleep"
Culture du X (XXX Culture)
Hot-parade
Others
La Vie rurale (adaptation of the American The Simple Life)
Bimbo, fantasmes et réalité
La Job (adaptation of the British The Office)
Culture de Stars
iCulture
BO2
Le Cinéjournal
Des gens pas ordinaires (adaptation
|
https://en.wikipedia.org/wiki/A3G
|
A3G may refer to:
APOBEC3G, an immune system enzyme
Apartment 3-G, a comic strip
A nickname for David Lat
|
https://en.wikipedia.org/wiki/%C3%89lisabeth%20Lutz
|
Élisabeth Lutz (May 14, 1914 – July 31, 2008) was a French mathematician. The Nagell–Lutz theorem in Diophantine geometry describes the torsion points of elliptic curves; it is named after Lutz and Trygve Nagell, who both published it in the 1930s.
Lutz was a student of André Weil at the University of Strasbourg, from 1934 to 1938. She earned a thesis for her research for him, on elliptic curves over -adic fields. She completed her doctorate (thèse d’état) on -adic Diophantine approximation at the University of Grenoble in 1951 under the supervision of Claude Chabauty; her dissertation was Sur les approximations diophantiennes linéaires -adiques.
She became a professor of mathematics at the University of Grenoble.
Selected publications
References
1914 births
2008 deaths
Number theorists
20th-century French mathematicians
21st-century French mathematicians
French women mathematicians
20th-century French women scientists
University of Strasbourg alumni
Grenoble Alpes University alumni
Academic staff of Grenoble Alpes University
20th-century women mathematicians
21st-century women mathematicians
21st-century French women
|
https://en.wikipedia.org/wiki/Satyam%20%282003%20film%29
|
Satyam is a 2003 Indian Telugu-language romantic drama film directed by debutant Surya Kiran and produced by actor Nagarjuna under Annapurna Studios banner. The film stars Sumanth and Genelia D'Souza in lead roles. The film received positive reviews and was very successful at the box-office. Released on 19 December 2003, it was one of the biggest box-office successes in Sumanth's career and it was also Genelia's debut in Telugu cinema. Chakri won the Filmfare Award for Best Male Playback Singer – Telugu. It was remade in Bengali language as Shakti.
Plot
Satyam is an aspiring songwriter who inadvertently gets misunderstood both by his father Vishwanath and his love interest Ankita. He ghostwrites for a selfish and popular film lyricist. He decides to prove himself as an independent songwriter before expressing his love to Ankita. In the meantime, a classmate of Ankita proposes to her. Through all of this, Ankita's father Shankar, unexpectedly befriends Satyam without his daughter's knowledge. Satyam eventually overcomes his obstacles and succeeds in reconciling with his father and Ankita.
Cast
Sumanth as Satyam
Genelia D'Souza as Ankita
Kota Srinivasa Rao as Shankar
Bramhanandam as Lingam
Rajesh as Satish Petla
Tanikella Bharani as Chakradhar
Raghava Malladi as Vishwanath
Kondavalasa as Simhadri
Varsha as Swati
Sridhar as Prakash
Narsing Yadav as MLA
Duvvasi Mohan as Chakradhar's assistant
Kanta Rao (Cameo appearance)
Chakri as himself (Cameo appearance)
|
https://en.wikipedia.org/wiki/Helly%27s%20selection%20theorem
|
In mathematics, Helly's selection theorem (also called the Helly selection principle) states that a uniformly bounded sequence of monotone real functions admits a convergent subsequence.
In other words, it is a sequential compactness theorem for the space of uniformly bounded monotone functions.
It is named for the Austrian mathematician Eduard Helly.
A more general version of the theorem asserts compactness of the space BVloc of functions locally of bounded total variation that are uniformly bounded at a point.
The theorem has applications throughout mathematical analysis. In probability theory, the result implies compactness of a tight family of measures.
Statement of the theorem
Let (fn)n ∈ N be a sequence of increasing functions mapping the real line R into itself,
and suppose that it is uniformly bounded: there are a,b ∈ R such that a ≤ fn ≤ b for every n ∈ N.
Then the sequence (fn)n ∈ N admits a pointwise convergent subsequence.
Generalisation to BVloc
Let U be an open subset of the real line and let fn : U → R, n ∈ N, be a sequence of functions. Suppose that
(fn) has uniformly bounded total variation on any W that is compactly embedded in U. That is, for all sets W ⊆ U with compact closure W̄ ⊆ U,
where the derivative is taken in the sense of tempered distributions;
and (fn) is uniformly bounded at a point. That is, for some t ∈ U, { fn(t) | n ∈ N } ⊆ R is a bounded set.
Then there exists a subsequence fnk, k ∈ N, of fn and a function f : U → R, locally of b
|
https://en.wikipedia.org/wiki/Cheerios%20effect
|
In fluid mechanics, the Cheerios effect is a colloquial name for the phenomenon of floating objects appearing to either attract or repel one another. The example which gives the effect its name is the observation that pieces of breakfast cereal (for example, Cheerios) floating on the surface of a bowl will tend to clump together, or appear to stick to the side of the bowl.
Description
The effect is observed in small objects which are supported by the surface of a liquid. There are two types of such objects: objects which are sufficiently buoyant that they will always float on the surface (for example, Cheerios in milk), and objects which are heavy enough to sink when immersed, but not so heavy as to overcome the surface tension of the liquid (for example, steel pins on water). Objects of the same type will appear to attract one another, and objects of opposite types will appear to repel one another.
In addition, the same attractive or repulsive effect can be observed between objects and the wall of the container. Once again there are two possibilities: the interface between the liquid and the container wall is either a concave or a convex meniscus. Buoyant objects will be attracted in the case of a concave meniscus and repelled for convex. Non-buoyant floating objects will do the opposite.
Explanation
All objects in a fluid experience two opposed forces in the vertical direction: gravity (determined by the mass of the object) and buoyancy (determined by the density
|
https://en.wikipedia.org/wiki/Erna%20Lazarus
|
Erna Lazarus (June 16, 1903 – February 19, 2006) was a screen and television writer from the 1930s through the 1960s.
Lazarus, born in Boston, Massachusetts, was one of the founding members of the Screen Writers Guild. On her death, Variety credited her as "one of the first female screenwriters working steadily in the studio system." She also had an influential role in the formation of the Interguild Federal Credit Union.
Lazarus died on February 19, 2006, in Woodland Hills, California, at the age of 102.
Selected filmography
Hollywood or Bust (the last film featuring Jerry Lewis and Dean Martin) - sole story and screen play
Flareup (starring Raquel Welch) - associate producer
Meet Me After the Show (starring Betty Grable) - original story
Moonlight in Hawaii
Double Date
Atlantic Flight
Let's Go Steady
The Girl of the Limberlost (1945)
Slightly Scandalous (1946)
Selected radio writing
Mayor of the Town
Selected TV writing
Racket Squad
Mr. and Mrs. North
Petticoat Junction
Bewitched
Hawaiian Eye
Surfside Six
References
External links
1903 births
2006 deaths
American centenarians
American television writers
American women screenwriters
Women centenarians
20th-century American women writers
20th-century American screenwriters
21st-century American women
|
https://en.wikipedia.org/wiki/PTPRC
|
Protein tyrosine phosphatase, receptor type, C also known as PTPRC is an enzyme that, in humans, is encoded by the PTPRC gene. PTPRC is also known as CD45 antigen (CD stands for cluster of differentiation), which was originally called leukocyte common antigen (LCA).
Function
The protein product of this gene, best known as CD45, is a member of the protein tyrosine phosphatase (PTP) family. PTPs are signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. CD45 contains an extracellular domain, a single transmembrane segment, and two tandem intracytoplasmic catalytic domains, and thus belongs to the receptor type PTP family.
CD45 is a type I transmembrane protein that is present in various isoforms on all differentiated hematopoietic cells (except erythrocytes and plasma cells). CD45 has been shown to be an essential regulator of T- and B-cell antigen receptor signalling. It functions through either direct interaction with components of the antigen receptor complexes via its extracellular domain (a form of co-stimulation), or by activating various Src family kinases required for the antigen receptor signaling via its cytoplasmic domain. CD45 also suppresses JAK kinases, and so functions as a negative regulator of cytokine receptor signaling.
Many alternatively spliced transcripts variants of this gene, which encode distinct isoforms, have been reported. Antibodies against the dif
|
https://en.wikipedia.org/wiki/Hydroxycitric%20acid
|
Hydroxycitric acid (HCA) is a derivative of citric acid that is found in a variety of tropical plants including Garcinia cambogia and Hibiscus sabdariffa.
There are four isomers, (+)- and (-)-hydroxycitric acid, and (+)- and (-)-allo-hydroxycitric acid. The (-)-hydroxycitric acid isomer is the one found in Garcinia.
Chemistry
Hydroxy citric acid as such cannot be isolated from garcinia fruits or hibiscus sabdariffa fruits. Hydroxy citric acid exist in both the open and lactone forms. The presence of two chiral centres in the molecule is exploited to construct molecular skeletons that are otherwise difficult to synthesize, thus demonstrating the lactones use as chirons.
Biological effects
(-)-HCA is a competitive inhibitor of ATP citrate lyase, which converts citrate into oxaloacetate and acetyl CoA. The reverse of this conversion is a step in the citric acid cycle.
Laboratory and animal studies of HCA have produced results that indicate a potential for modulation of lipid metabolism. However, a clinical study has demonstrated that HCA has no effect in terms of weight loss or reduction of fat mass. A meta-analysis published in 2010 revealed that gastrointestinal adverse effects were twice as likely for users of hydroxycitric acid.
The use of HCA is contraindicated in patients suffering Colitis or Inflammatory Bowel Disease.
One isomer of HCA, known as (2S,3R)-HCA, inhibits pancreatic alpha-amylase and intestinal alpha-glucosidase, leading to a reduction in carbohydrate
|
https://en.wikipedia.org/wiki/Mal%C3%A1%20Lehota
|
Malá Lehota () is a village and municipality in the Žarnovica District, Banská Bystrica Region in Slovakia.
External links
https://web.archive.org/web/20071217080336/http://www.statistics.sk/mosmis/eng/run.html
Villages and municipalities in Žarnovica District
|
https://en.wikipedia.org/wiki/Ve%C4%BEk%C3%A1%20Lehota
|
Veľká Lehota () is a village and municipality in the Žarnovica District, Banská Bystrica Region in Slovakia.
External links
https://web.archive.org/web/20080111223415/http://www.statistics.sk/mosmis/eng/run.html
Villages and municipalities in Žarnovica District
|
https://en.wikipedia.org/wiki/%C5%BDupkov
|
Župkov () is a village and municipality in the Žarnovica District, Banská Bystrica Region in Slovakia.
External links
http://www.statistics.sk/mosmis/eng/run.html
Villages and municipalities in Žarnovica District
|
https://en.wikipedia.org/wiki/Wafer%20dicing
|
In the context of manufacturing integrated circuits, wafer dicing is the process by which die are separated from a wafer of semiconductor following the processing of the wafer. The dicing process can involve scribing and breaking, mechanical sawing (normally with a machine called a dicing saw) or laser cutting. All methods are typically automated to ensure precision and accuracy.
Following the dicing process the individual silicon chips may be encapsulated into chip carriers which are then suitable for use in building electronic devices such as computers, etc.
During dicing, wafers are typically mounted on dicing tape which has a sticky backing that holds the wafer on a thin sheet metal frame. Dicing tape has different properties depending on the dicing application. UV curable tapes are used for smaller sizes and non-UV dicing tape for larger die sizes. Dicing saws may use a dicing blade with diamond particles, rotating at 30,000 RPM and cooled with deionized water. Once a wafer has been diced, the pieces left on the dicing tape are referred to as die, dice or dies. Each will be packaged in a suitable package or placed directly on a printed circuit board substrate as a "bare die". The areas that have been cut away, called die streets, are typically about 75 micrometres (0.003 inch) wide. Once a wafer has been diced, the die will stay on the dicing tape until they are extracted by die-handling equipment, such as a die bonder or die sorter, further in the electronics assem
|
https://en.wikipedia.org/wiki/GH1
|
GH1 can refer to:
Glycoside hydrolase family 1, a family of enzymes
Growth hormone 1, a human gene
Pseudomonas virus gh1, a bacteriophage which infects some strains of Pseudomonas putida.
Panasonic Lumix DMC-GH1, a digital hybrid still photography/video camera
Guitar Hero (video game), the first game in the series
Hill GH1, 1975 Formula One car
|
https://en.wikipedia.org/wiki/Sand%20dune%20ecology
|
Sand dune ecology describes the biological and physico-chemical interactions that are a characteristic of sand dunes.
Sand dune systems are excellent places for biodiversity, partly because they are not very productive for agriculture, and partly because disturbed, stressful, and stable habitats are present in proximity to each other. Many of them are protected as nature reserves, and some are parts of larger conservation areas, incorporating other coastal habitats like salt marshes, mud flats, grasslands, scrub, and woodland.
Plant habitat
Sand dunes provide a range of habitats for a range of unusual, interesting and characteristic plants that can cope with disturbed habitats. In the UK these may include restharrow Ononis repens, sand spurge Euphorbia arenaria and ragwort Senecio vulgaris - such plants are termed ruderals.
Other very specialised plants are adapted to the accretion of sand, surviving the continual burial of their shoots by sending up very rapid vertical growth. Marram grass, Ammophila arenaria specialises in this, and is largely responsible for the formation and stabilisation of many dunes by binding sand grains together. The sand couch-grass Elytrigia juncea also performs this function on the seaward edge of the dunes, and is responsible, with some other pioneers like the sea rocket Cakile maritima, for initiating the process of dune building by trapping wind blown sand.
In accreting situations small mounds of vegetation or tide-washed debris form
|
https://en.wikipedia.org/wiki/Eileen%20Power
|
Eileen Edna Le Poer Power (9 January 18898 August 1940) was a British economic historian and medievalist.
Early life and education
Eileen Power was the eldest daughter of a stockbroker and was born at Altrincham, Cheshire (now part of Greater Manchester) in 1889. She was a sister of Rhoda Power, the children's writer and broadcaster, and Beryl Millicent Le Poer Power, a civil servant (1891-1974). When she was three her father, a stockbroker, was arrested for fraud and the family moved to Bournemouth to live with Benson Clegg (Power's grandfather). After her mother died of tuberculosis when Power was only 14, she moved to Oxford with her two sisters to live with her aunt. Power was educated at the Oxford High School for Girls, then matriculated at Girton College, Cambridge, and the Sorbonne.
Power was a granddaughter of the Revd Philip Bennett Power. Revd Philip Bennett Power, a prolific writer of evangelical tracts, was originally from Waterford, Ireland.
Career
Power was Director of Studies in History at Girton College, University of Cambridge (1913–21), Lecturer in Political Science at the London School of Economics (1921–24), and Reader of the University of London (1924–31). In 1910, she was awarded the Gilchrist research fellowship and studied at the University of Paris and the École des Chartes. From 1922 until her death in 1940 she lived in Mecklenburgh Square, on the fringes of Bloomsbury.
In 1931, she became the second woman to be appointed to the Chair of Econ
|
https://en.wikipedia.org/wiki/Denaturation%20midpoint
|
Denaturation midpoint of a protein is defined as the temperature (Tm) or concentration of denaturant (Cm) at which both the folded and unfolded states are equally populated at equilibrium (assuming two-state protein folding). Tm is often determined using a thermal shift assay.
If the widths of the folded and unfolded wells are assumed to be equal both these states will have identical free energies at the midpoint. However, for natural proteins this is not the case. There is an inherent asymmetry as evidenced by the difference in heat capacities between them - the folded ensemble has a lower heat capacity (in other words, lower fluctuations thus indicating a narrower well) than the unfolded ensemble. This would mean that the free energy of the folded state is lower at the denaturation midpoint than the unfolded state. In such a scenario, the temperature at which both the wells have identical free energies is termed the characteristic temperature (To).
References
Protein structure
|
https://en.wikipedia.org/wiki/Chiusi%20della%20Verna
|
Chiusi della Verna is a comune (municipality) in the Province of Arezzo in the Italian region Tuscany, located about east of Florence and about north of Arezzo. It is in the Casentino traditional region.
Chiusi della Verna borders the following municipalities: Bagno di Romagna, Bibbiena, Caprese Michelangelo, Castel Focognano, Chitignano, Pieve Santo Stefano, Poppi, Subbiano, Verghereto.
In the frazione La Verna is the famous Sanctuary of St. Francis.
Demographics
Sister cities
Helmstadt, Germany
References
External links
Official website
Cities and towns in Tuscany
|
https://en.wikipedia.org/wiki/Citerna
|
Citerna is a comune (municipality) in the Province of Perugia in the Italian region Umbria, located about 50 km northwest of Perugia.
It is a member of the I Borghi più belli d'Italia ("The most beautiful villages of Italy") association.
References
External links
www.citerna.net/
Cities and towns in Umbria
Borghi più belli d'Italia
|
https://en.wikipedia.org/wiki/Neurofibromin%201
|
neurofibromatosis 1 (NF1) is a gene in humans that is located on chromosome 17. NF1 codes for neurofibromin, a GTPase-activating protein that negatively regulates RAS/MAPK pathway activity by accelerating the hydrolysis of Ras-bound GTP. NF1 has a high mutation rate and mutations in NF1 can alter cellular growth control, and neural development, resulting in neurofibromatosis type 1 (NF1, also known as von Recklinghausen syndrome). Symptoms of NF1 include disfiguring cutaneous neurofibromas (CNF), café au lait pigment spots, plexiform neurofibromas (PN), skeletal defects, optic nerve gliomas, life-threatening malignant peripheral nerve sheath tumors (MPNST), pheochromocytoma, attention deficits, learning deficits and other cognitive disabilities.
Gene
NF1 was cloned in 1990 and its gene product neurofibromin was identified in 1992. Neurofibromin, a GTPase-activating protein, primarily regulates the protein Ras. NF1 is located on the long arm of chromosome 17, position q11.2 NF1 spans over 350-kb of genomic DNA and contains 62 exons. 58 of these exons are constitutive and 4 exhibit alternative splicing ( 9a, 10a-2, 23a, and 28a). The genomic sequence starts 4,951-bp upstream of the transcription start site and 5,334-bp upstream of the translation initiation codon, with the length of the 5' UTR being 484-bp long.
There are three genes that are present within intron 27b of NF1. These genes are EVI2B, EVI2A and OMG, which are encoded on the opposite strand and are transcribed i
|
https://en.wikipedia.org/wiki/Neurofibromin
|
Neurofibromin can refer to one of two different proteins:
Neurofibromin 1
Neurofibromin 2
See also
Neurofibromatosis type I
Neurofibromatosis type II
Proteins
|
https://en.wikipedia.org/wiki/Exchangeable%20random%20variables
|
In statistics, an exchangeable sequence of random variables (also sometimes interchangeable) is a sequence X1, X2, X3, ... (which may be finitely or infinitely long) whose joint probability distribution does not change when the positions in the sequence in which finitely many of them appear are altered. Thus, for example the sequences
both have the same joint probability distribution.
It is closely related to the use of independent and identically distributed random variables in statistical models. Exchangeable sequences of random variables arise in cases of simple random sampling.
Definition
Formally, an exchangeable sequence of random variables is a finite or infinite sequence X1, X2, X3, ... of random variables such that for any finite permutation σ of the indices 1, 2, 3, ..., (the permutation acts on only finitely many indices, with the rest fixed), the joint probability distribution of the permuted sequence
is the same as the joint probability distribution of the original sequence.
(A sequence E1, E2, E3, ... of events is said to be exchangeable precisely if the sequence of its indicator functions is exchangeable.) The distribution function FX1,...,Xn(x1, ..., xn) of a finite sequence of exchangeable random variables is symmetric in its arguments Olav Kallenberg provided an appropriate definition of exchangeability for continuous-time stochastic processes.
History
The concept was introduced by William Ernest Johnson in his 1924 book Logic, Part III: The Lo
|
https://en.wikipedia.org/wiki/Recognition%20sequence
|
A recognition sequence is a DNA sequence to which a structural motif of a DNA-binding domain exhibits binding specificity. Recognition sequences are palindromes.
The transcription factor Sp1 for example, binds the sequences 5'-(G/T)GGGCGG(G/A)(G/A)(C/T)-3', where (G/T) indicates that the domain will bind a guanine or thymine at this position.
The restriction endonuclease PstI recognizes, binds, and cleaves the sequence 5'-CTGCAG-3'.
A recognition sequence is different from a recognition site. A given recognition sequence can occur one or more times, or not at all, on a specific DNA fragment. A recognition site is specified by the position of the site. For example, there are two PstI recognition sites in the following DNA sequence fragment, starting at base 9 and 31 respectively. A recognition sequence is a specific sequence, usually very short (less than 10 bases). Depending on the degree of specificity of the protein, a DNA-binding protein can bind to more than one specific sequence. For PstI, which has a single sequence specificity, it is 5'-CTGCAG-3'. It is always the same whether at the first recognition site or the second in the following example sequence. For Sp1, which has multiple (16) sequence specificity as shown above, the two recognition sites in the following example sequence fragment are at 18 and 32, and their respective recognition sequences are 5'-GGGGCGGAGC-3' and 5'-TGGGCGGAAC-3'.
5'-AACGTTAGCTGCAGTCGGGGCGGAGCTAGGCTGCAGGAATTGGGCGGAACCT-3'
See also
DNA
|
https://en.wikipedia.org/wiki/Edna%20May
|
Edna May Pettie (September 2, 1878 – January 1, 1948), known on stage as Edna May, was an American actress and singer. A popular postcard beauty, May was famous for her leading roles in Edwardian musical comedies.
Life and career
May was born in Syracuse, New York, to Edgar and Cora Petty. The family later changed the surname to "Pettie". Her siblings were Adelbert, Jennie and Marguerite. At the age of 5, she played Little Willie Allen in a production of Dora. The next year, her performances "charmed a number of audiences lately with her child voice". By the age of 7, she had joined a children's opera company and performed Gilbert and Sullivan productions in Syracuse. She studied music at the New York Conservatoire as a teenager.
May made her professional debut in 1895 in Si Stebbings in Syracuse. She then moved to New York to take the small role of Clairette in Oscar Hammerstein's Broadway show, Santa Maria. That year, she married Fred Titus, who held a world record for cycling. They had no children and divorced in 1904.
In 1897, May played Violet Grey in The Belle of New York with only moderate success. The following year, the production played in London, becoming a hit and running for 697 performances, making May a star. After that, among others, she played Gabrielle Dalmonte in An American Beauty in London (1900), Olga in The Girl from Up There (1901) in New York and then London, Edna Branscombe in Three Little Maids (1902), Lillian Leigh in The School Girl (1903–
|
https://en.wikipedia.org/wiki/Membrane%20reactor
|
A membrane reactor is a physical device that combines a chemical conversion process with a membrane separation process to add reactants or remove products of the reaction.
Chemical reactors making use of membranes are usually referred to as membrane reactors. The membrane can be used for different tasks:
Separation
Selective extraction of products
Retention of the catalyst
Distribution/dosing of a reactant
Catalyst support (often combined with distribution of reactants)
Membrane reactors are an example for the combination of two unit operations in one step, e.g., membrane filtration with the chemical reaction. The integration of reaction section with selective extraction of a reactant allows an enhancement of the conversions compared to the equilibrium value. This characteristic makes membrane reactors suitable to perform equilibrium-limited endothermic reactions.
Benefits and critical issues
Selective membranes inside the reactor lead to several benefits: reactor section substitutes several downstream processes. Moreover, removing a product allows to exceed thermodynamics limitations. In this way, it is possible to reach higher conversions of the reactants or to obtain the same conversion with a lower temperature.
Reversible reactions are usually limited by thermodynamics: when direct and reverse reactions, whose rate depends from reactants and product concentrations, are balanced, a chemical equilibrium state is achieved. If temperature and pressure are fixed, this
|
https://en.wikipedia.org/wiki/Mel%20Blyth
|
Melvin Bernard Blyth (born 28 July 1944) is an English former footballer who played for several clubs, including Southampton with whom he won the FA Cup in 1976, and Crystal Palace.
Norwich City and Scunthorpe United
Blyth started his football career with non-league Great Yarmouth. He then joined Norwich City, although he never made an appearance in the first team.
In October 1967, former Norwich manager, Ron Ashman, took up the reins at Scunthorpe United, then struggling at the foot of Division 3. He returned to his old club to sign several players, including Steve Deere, Geoff Barnard and Blyth to shore up the holes in the defence.
Scunthorpe were relegated at the end of the 1967–68 season and in July 1968, Blyth moved on to Crystal Palace.
Crystal Palace
Blyth joined Crystal Palace in the summer of 1968 as an old-style wing-half, but he developed into a centre-back. He immediately became a regular member of Palace's 1968–69 Division 2 promotion side, and in their first ever match in Division 1, he scored Palace's first goal in the top flight with a looping header against Manchester United. He scored another goal the following Saturday, against Everton.
As Palace struggled in Division 1, regularly finishing just above the relegation zone, Blyth became a permanent fixture in the defence alongside John McCormick. He was deposed as centre back for a while by Roger Hynd. But after playing in midfield for much of the 1969–70 season he won his place back when Hynd was temp
|
https://en.wikipedia.org/wiki/Rezina
|
Rezina is a city in Moldova and the capital of Rezina District. Three villages are administered by the city: Boşerniţa, Ciorna and Stohnaia.
Geography
In the northeastern part of Moldova, as far as 98 km from Chișinău, the town of Rezina is situated on three successive terraces formed by the picturesque right bank of the Dniester. The lowest terrace (along the Dniester) houses the older town, the second one (on the hill slope) contains buildings constructed in the 1950-60s, while the upper terrace is the seat of the new town constructed in the 1970-90s. The town is 3 km from the Rîbnița railway station and 6 km from that of Mateuţi. The republican highway Orhei – Rîbnița is going through the town.
History
Archaeological monuments prove the fact that first settlements appeared in the area 40-10 millennia ago. The Indo-European period (5000–3000 BC) witnessed the settlement of the Thracians (Geto-Dacians in particular) here. In 1946–1947, on Rezina's western outskirts (near the road to Echimăuţi) scientists discovered an ancient site founded by the Geto-Dacians in the 4–3rd centuries BC. It was built on a small promontory at the merger of two depressions and was 50 m long and 100 m wide. Regrettably, the site was heavily damaged by construction works on a cattle-breeding farm and a repair station for agricultural machines. The area needs further excavations in order to establish the period and causes of population destruction.
Its seal was approved on 10 September 1936.
The
|
https://en.wikipedia.org/wiki/Cell%20Loss%20Priority
|
Cell Loss Priority (CLP) is a flag bit in the ATM cell header that determines the probability of a cell being discarded if the network becomes congested. Cells where the CLP = 0 are insured traffic and unlikely to be dropped. Cells with CLP = 1 are best-effort traffic, which may be discarded in congested conditions in order to free up resources to handle insured traffic.
CLP is used as a control for a network traffic "policing mechanism". Policing is a process that determines if the cells meet predefined restrictions as they enter an ATM network. These restrictions include traffic rates and "burst sizes" that are agreed upon by the customer and the network provider.
Link protocols
|
https://en.wikipedia.org/wiki/Dermcidin
|
Dermcidin is a protein with 110 amino acids that in humans is encoded by the DCD gene. The full-length protein produces derived peptides as proteolysis-inducing factor (PIF) and other anti-microbial peptides, secreted by human eccrine sweat glands onto the skin as a part of the innate host defense of the immune system. PIF is involved in muscular proteolysis.
Function
Dermcidin is a secreted protein that is subsequently processed into mature peptides of distinct biological activities. The C-terminal peptide is constitutively expressed in sweat and has antibacterial and antifungal activities. The N-terminal peptide, also known as diffusible survival evasion peptide, promotes neural cell survival under conditions of severe oxidative stress. A glycosylated form of the N-terminal peptide may be associated with cachexia (muscle wasting) in cancer patients.
Survival evasion peptide Antimicrobial peptide
YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
The C-terminal precursor DCD-1L is a 48 residue peptide that shows partial helicity in solution, as evidenced by the determination of its solution structure by NMR and CD-spectroscopy. The full length precursor is processed by undetermined proteases present in human sweat, to form several shorter peptides that show variable antimicrobial activity, named according to their C-terminal triplet of amino acids and their residue length. One such active pepti
|
https://en.wikipedia.org/wiki/List%20of%20Asian%20American%20jurists
|
Research history
Studies led by California Supreme Court Justice Goodwin Liu (2017) and the Center for American Progress (2019) provided in-depth statistics into the issue.
Judicial officers
This is a dynamic list of Asian Americans who are or were judges, magistrate judges, court commissioners, or administrative law judges. If known, it will be listed if a judge has served on multiple courts.
Other topics of interest
List of first minority male lawyers and judges in the United States
List of first women lawyers and judges in the United States
List of African-American jurists
List of Hispanic and Latino American jurists
List of Jewish American jurists
List of LGBT jurists in the United States
List of Native American jurists
References
Sources
Asian American Bar Association of The Greater Bay Area
APAs In The Judiciary Resource Page
Asian Americans and Pacific Islanders on the Federal Bench
Current Asian Pacific American Federal Judges
Selected APA Judges in California
First Vietnamese American and Korean American Women Seated on State Judiciary, by Sam Chu Lin, AsianWeek, August 23, 2002
Vietnamese American Facts, Tieng Magazine
Two New APA Judges in Cook County, Illinois, AsianWeek, March 30, 2007
Asian-American issues
Jurists
Lists of American judges
|
https://en.wikipedia.org/wiki/Trigona%20hypogea
|
Trigona hypogea is a species of stingless bee from the Neotropics; it is unusual in that it is one of only three known species of bee that exclusively uses carrion as a protein source, rather than pollen, earning it the nickname "vulture bee". These bees consume flesh, carry it internally back to the colony, and regurgitate it along with other secretions into storage pots similar to those used by other bee species to store honey; the larvae are fed on this substance, while the adult bees consume the honey.
References
hypogea
Insects described in 1902
|
https://en.wikipedia.org/wiki/Masaru%20Tomita
|
is a Japanese scientist in the fields of systems biology and computer science, best known as the founder of the E-Cell simulation system and/or the inventor of GLR parser algorithm. He served a professor of Keio University, Director of the Institute for Advanced Biosciences, and the founder and board member of various spinout companies, including Human Metabolome Technologies, Inc. and Spiber Inc. He is also the co-founder and on the board of directors of The Metabolomics Society. His father was the renowned composer and synthesiser pioneer Isao Tomita.
From Oct. 2005 to Sep. 2007, he served as Dean of Faculty of Environment and Information Studies, Keio University.
He received an M.S. (1983) and a Ph.D. (1985) in computer science from Carnegie Mellon University (CMU) under Jaime Carbonell, and two other doctoral degrees in electronic engineering and molecular biology from Kyoto University (1994) and Keio University (1998).
At CMU, starting in 1985, Tomita achieved a series of academic promotions from assistant professor to associate professor of computer science and from 1986 he became an associate director of the Center for Machine Translation.
In 1990, he returned to Keio University and served as associate professor, professor, and Dean of the faculty of Environmental Information. At Keio University, he shifted his research emphasis to the studies of molecular biology and systems biology. In 2001, he founded Institute for Advanced Biosciences, Keio University in Tsuruo
|
https://en.wikipedia.org/wiki/Skorokhod%27s%20representation%20theorem
|
In mathematics and statistics, Skorokhod's representation theorem is a result that shows that a weakly convergent sequence of probability measures whose limit measure is sufficiently well-behaved can be represented as the distribution/law of a pointwise convergent sequence of random variables defined on a common probability space. It is named for the Soviet mathematician A. V. Skorokhod.
Statement
Let be a sequence of probability measures on a metric space such that converges weakly to some probability measure on as . Suppose also that the support of is separable. Then there exist -valued random variables defined on a common probability space such that the law of is for all (including ) and such that converges to , -almost surely.
See also
Convergence in distribution
References
(see p. 7 for weak convergence, p. 24 for convergence in distribution and p. 70 for Skorokhod's theorem)
Probability theorems
Theorems in statistics
|
https://en.wikipedia.org/wiki/Sayers%20%28surname%29
|
Sayers is a surname. Notable people with the surname include:
Alan Sayers, New Zealand athlete
Ben Sayers, early professional golfer
Dorothy L. Sayers (1893–1957) English crime writer
Edna Sayers (1912–1986), Australian cyclist
Edward Sayers (aviator) (1897–1918), English World War I flying ace
Edward Sayers (doctor) (1902–1985), New Zealand doctor
Edward Sayers (politician) (1818–1909), New South Wales politician
Eddie Sayers (born 1941), Northern Irish loyalist
Foster J. Sayers, Medal of Honor recipient
Gale Sayers (1943–2020), American professional football player
James Sayers, British illustrator
Joe Sayers (cricketer), English cricketer
Joseph D. Sayers, the 22nd governor of Texas
Laura Sayers, British radio producer
Marguerite Sayers, BE CEng FIEI, President for Engineers Ireland
Mark Sayers, Computer hacker
Michael Sayers, Irish poet and author
Peig Sayers, Irish author and seanchaí
Royd R. Sayers, American physician and industrial hygienist
Thomas Sayers, English bare-knuckle prize fighter
Zehra Sayers, Turkish biologist
Fictional characters
Lena Sayers, a character in the anime series My-Otome
Nina Sayers, the titular character in the film Black Swan
See also
Sayer
Sayers (disambiguation)
|
https://en.wikipedia.org/wiki/Gabor%20atom
|
In applied mathematics, Gabor atoms, or Gabor functions, are functions used in the analysis proposed by Dennis Gabor in 1946 in which a family of functions is built from translations and modulations of a generating function.
Overview
In 1946, Dennis Gabor suggested the idea of using a granular system to produce sound. In his work, Gabor discussed the problems with Fourier analysis. Although he found the mathematics to be correct, it did not reflect the behaviour of sound in the world, because sounds, such as the sound of a siren, have variable frequencies over time. Another problem was the underlying supposition, as we use sine waves analysis, that the signal under concern has infinite duration even though sounds in real life have limited duration – see time–frequency analysis. Gabor applied ideas from quantum physics to sound, allowing an analogy between sound and quanta. He proposed a mathematical method to reduce Fourier analysis into cells. His research aimed at the information transmission through communication channels. Gabor saw in his atoms a possibility to transmit the same information but using less data. Instead of transmitting the signal itself it would be possible to transmit only the coefficients which represent the same signal using his atoms.
Mathematical definition
The Gabor function is defined by
where a and b are constants and g is a fixed function in L2(R), such that ||g|| = 1. Depending on , , and , a Gabor system may be a basis for L2(R), which is de
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.