Biological Process
stringlengths
7
1.01k
Cellular Component
stringlengths
6
867
Molecular Function
stringlengths
11
871
Organism
stringlengths
8
73
Keywords
stringlengths
1
810
Sequence 10
stringlengths
5
10
Sequence
stringlengths
5
1.02k
Combined
stringlengths
136
3.91k
de novo' NAD biosynthetic process from aspartate DNA damage response NAD salvage
cytosol
ATP binding glutaminase activity magnesium ion binding NAD+ synthase (glutamine-hydrolyzing) activity NAD+ synthase activity protein homodimerization activity
Escherichia coli
3D-structure ATP-binding Direct protein sequencing Ligase Magnesium Metal-binding NAD Nucleotide-binding Phosphoprotein Reference proteome
MTLQQQIIKA
MTLQQQIIKALGAKPQINAEEEIRRSVDFLKSYLQTYPFIKSLVLGISGGQDSTLAGKLCQMAINELRLETGNESLQFIAVRLPYGVQADEQDCQDAIAFIQPDRVLTVNIKGAVLASEQALREAGIELSDFVRGNEKARERMKAQYSIAGMTSGVVVGTDHAAEAITGFFTKYGDGGTDINPLYRLNKRQGKQLLAALACPEHLYKKAPTADLEDDRPSLPDEVALGVTYDNIDDYLEGKNVPQQVARTIENWYLKTEHKRRPPITVFDDFWKK
de novo' NAD biosynthetic process from aspartate DNA damage response NAD salvage cytosol ATP binding glutaminase activity magnesium ion binding NAD+ synthase (glutamine-hydrolyzing) activity NAD+ synthase activity protein homodimerization activity Escherichia coli 3D-structure ATP-binding Direct protein sequencing Liga...
behavioral response to nicotine nervous system development signal transduction synaptic transmission involved in micturition
acetylcholine-gated channel complex; endoplasmic reticulum; Golgi apparatus; postsynaptic membrane
acetylcholine receptor activity acetylcholine-gated monoatomic cation-selective channel activity
Carassius auratus
Cell membrane Disulfide bond Endoplasmic reticulum Glycoprotein Golgi apparatus Ion channel Ion transport Ligand-gated ion channel Membrane Postsynaptic cell membrane Receptor Reference proteome Signal Synapse Transmembrane Transmembrane helix Transport
MNSASRITLF
MNSASRITLFFLLTVLITQECLSSKGEDRLFRRLFRRYNQFIRPVENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLKWLPAEFDGIEFIRVPSNKIWRPDIVLYNNAVGDFLVEDKTKALLKYDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAKIDLVLIGSKVNLKDFWESGEWEIIDAPGYKHDIKYNCCEEIYPDITYSFYIRRLPLFYTINLIIPCLLISFLTILVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNV...
behavioral response to nicotine nervous system development signal transduction synaptic transmission involved in micturition acetylcholine-gated channel complex; endoplasmic reticulum; Golgi apparatus; postsynaptic membrane acetylcholine receptor activity acetylcholine-gated monoatomic cation-selective channel activity...
cAMP-mediated signaling positive regulation of DNA replication positive regulation of neuron projection development positive regulation of transcription by RNA polymerase II protein-containing complex assembly regulation of transcription by RNA polymerase II response to cobalt ion response to purine-containing compound...
ATF1-ATF4 transcription factor complex; ATF4-CREB1 transcription factor complex; chromatin; nucleoplasm; nucleus; RNA polymerase II transcription regulator complex
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific identical protein binding protein-containing complex binding RNA polymerase II cis-regulatory region sequence-specific DNA binding RNA ...
Homo sapiens
Activator Alternative splicing Chromosomal rearrangement DNA-binding Isopeptide bond Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation Ubl conjugation
MEDSHKSTTS
MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILARRPSYRKILKDLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYSNKSV
cAMP-mediated signaling positive regulation of DNA replication positive regulation of neuron projection development positive regulation of transcription by RNA polymerase II protein-containing complex assembly regulation of transcription by RNA polymerase II response to cobalt ion response to purine-containing compound...
cellular response to amino acid starvation endoplasmic reticulum unfolded protein response gluconeogenesis negative regulation of ERK1 and ERK2 cascade negative regulation of transcription by RNA polymerase II positive regulation of cell population proliferation positive regulation of gene expression positive regulatio...
CHOP-ATF3 complex; chromatin; nucleolus; nucleoplasm; nucleus; RNA polymerase II transcription regulator complex
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific DNA-binding transcription repressor activity, RNA polymerase II-specific identical protein binding protein heterodimerization activity ...
Homo sapiens
Alternative splicing Disease variant DNA-binding Isopeptide bond Nucleus Phosphoprotein Reference proteome Repressor Transcription Transcription regulation Ubl conjugation
MMLQHPGQVS
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
cellular response to amino acid starvation endoplasmic reticulum unfolded protein response gluconeogenesis negative regulation of ERK1 and ERK2 cascade negative regulation of transcription by RNA polymerase II positive regulation of cell population proliferation positive regulation of gene expression positive regulatio...
ATF6-mediated unfolded protein response endoplasmic reticulum unfolded protein response ERAD pathway eye development positive regulation of apoptotic process positive regulation of ATF6-mediated unfolded protein response positive regulation of autophagy positive regulation of transcription by RNA polymerase II protein ...
chromatin; cytosol; endoplasmic reticulum; endoplasmic reticulum membrane; Golgi apparatus; Golgi membrane; membrane; nuclear envelope; nucleoplasm; nucleus; RNA polymerase II transcription regulator complex
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific enzyme binding identical protein binding protein heterodimerization activity RNA polymerase II cis-regulatory region sequence-specific ...
Homo sapiens
Activator Disease variant DNA-binding Endoplasmic reticulum Glycoprotein Golgi apparatus Isopeptide bond Membrane Nucleus Reference proteome Signal-anchor Transcription Transcription regulation Transmembrane Transmembrane helix Ubl conjugation Unfolded protein response
MGEPAGVAGT
MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLMPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTNSSVPAKTIIIQTVPTLMPLAKQQPIISLQPAPTKGQTVLLSQPTVVQLQAPGVLPSAQPVLAVAGGVTQLPNHVVNVVPAPSANSPVNGKLSVTKPVLQSTMRNVGSDIAVLRRQQRMIKNRESA...
ATF6-mediated unfolded protein response endoplasmic reticulum unfolded protein response ERAD pathway eye development positive regulation of apoptotic process positive regulation of ATF6-mediated unfolded protein response positive regulation of autophagy positive regulation of transcription by RNA polymerase II protein ...
chemotropism establishment of protein localization to plasma membrane G protein-coupled receptor signaling pathway invasive growth in response to glucose limitation pheromone-dependent signal transduction involved in conjugation with cellular fusion protein localization to mating projection tip regulation of pheromone-...
Cdc24p-Far1p-Gbetagamma complex; cell cortex; cytoplasm; G-protein beta/gamma-subunit complex; heterotrimeric G-protein complex; mating projection; plasma membrane
G-protein alpha-subunit binding G-protein gamma-subunit binding protein kinase binding scaffold protein binding signaling receptor complex adaptor activity small GTPase binding
Saccharomyces cerevisiae
3D-structure Pheromone response Reference proteome Repeat Transducer WD repeat
MAAHQMDSIT
MAAHQMDSITYSNNVTQQYIQPQSLQDISAVEDEIQNKIEAARQESKQLHAQINKAKHKIQDASLFQMANKVTSLTKNKINLKPNIVLKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSCAISPSSTLVASAGLNNNCTIYRVSKENRVAQNVASIFKGHTCYISDIEFTDNAHILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNSENSSNTFASCGSDGYTYIWDSRSPSAVQSFYVNDSDINALRFFKDGMSIVAGSDNGAINMYDLRSDCSIATFSLFRGYEERTPT...
chemotropism establishment of protein localization to plasma membrane G protein-coupled receptor signaling pathway invasive growth in response to glucose limitation pheromone-dependent signal transduction involved in conjugation with cellular fusion protein localization to mating projection tip regulation of pheromone-...
G protein-coupled receptor signaling pathway pheromone-dependent signal transduction involved in conjugation with cellular fusion regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion
Cdc24p-Far1p-Gbetagamma complex; cell cortex; cell periphery; cytoplasm; G-protein beta/gamma-subunit complex; heterotrimeric G-protein complex; plasma membrane
G-protein beta-subunit binding
Saccharomyces cerevisiae
3D-structure Lipoprotein Membrane Methylation Palmitate Pheromone response Prenylation Reference proteome Transducer
MTSVQNSPRL
MTSVQNSPRLQQPQEQQQQQQQLSLKIKQLKLKRINELNNKLRKELSRERITASNACLTIINYTSNTKDYTLPELWGYPVAGSNHFIEGLKNAQKNSQMSNSNSVCCTLM
G protein-coupled receptor signaling pathway pheromone-dependent signal transduction involved in conjugation with cellular fusion regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion Cdc24p-Far1p-Gbetagamma complex; cell cortex; cell periphery; cytoplasm; G-protein beta/gam...
anatomical structure morphogenesis base-excision repair base-excision repair, gap-filling cell division DNA biosynthetic process DNA ligation DNA recombination DNA repair lagging strand elongation mismatch repair Okazaki fragment processing involved in mitotic DNA replication
intracellular membrane-bounded organelle; mitochondrion; nucleoplasm; nucleus
ATP binding DNA binding DNA ligase (ATP) activity DNA ligase activity metal ion binding
Homo sapiens
3D-structure Acetylation Alternative splicing ATP-binding Cell cycle Cell division Disease variant DNA damage DNA recombination DNA repair DNA replication Ligase Magnesium Metal-binding Nucleotide-binding Nucleus Phosphoprotein Reference proteome
MQRSIMSFFH
MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKAARVLGSEGEEEDEALSPAKGQKPALDCSQVSPPRPATSPENNASLSDTSPMDSSPSGIPKRRTARKQLPKRTIQEVLEEQSEDEDREAKRKKEEEEEETPKESLTEAEVATEKEGEDGDQPTTPPKPLKTSKAETPTESVSEPEVATKQELQEEEEQTKPPRRAPKTLSSFFTPRKPAVKKEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIEEVSARLRMVETLSNLLRSVV...
anatomical structure morphogenesis base-excision repair base-excision repair, gap-filling cell division DNA biosynthetic process DNA ligation DNA recombination DNA repair lagging strand elongation mismatch repair Okazaki fragment processing involved in mitotic DNA replication intracellular membrane-bounded organelle; m...
proton motive force-driven ATP synthesis proton motive force-driven mitochondrial ATP synthesis substantia nigra development
mitochondrial inner membrane; mitochondrial proton-transporting ATP synthase complex; mitochondrial proton-transporting ATP synthase complex, coupling factor F(o); mitochondrion
proton transmembrane transporter activity
Homo sapiens
3D-structure Acetylation Alternative splicing CF(0) Direct protein sequencing Hydrogen ion transport Ion transport Membrane Mitochondrion Mitochondrion inner membrane Phosphoprotein Reference proteome Transit peptide Transport
MILQRLFRFS
MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA
proton motive force-driven ATP synthesis proton motive force-driven mitochondrial ATP synthesis substantia nigra development mitochondrial inner membrane; mitochondrial proton-transporting ATP synthase complex; mitochondrial proton-transporting ATP synthase complex, coupling factor F(o); mitochondrion proton transmembr...
cardiac muscle tissue development cell development cell-cell signaling chemical synaptic transmission gap junction assembly vasculogenesis visual perception
connexin complex; endoplasmic reticulum; nucleoplasm; synapse
gap junction channel activity gap junction channel activity involved in AV node cell-bundle of His cell electrical coupling monoatomic ion channel activity
Gallus gallus
Cell junction Cell membrane Gap junction Membrane Reference proteome Transmembrane Transmembrane helix
MSWSFLTRLL
MSWSFLTRLLEEIHNHSTFVGKIWLSVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGCENVCYDAFAPLSHVRFWVFQIILVATPSVMYLGYAIHKIARMVEHSDVDRRFRSKSFSTRWKQHRGLEEAEDDHEEDPMMYPEIELESERENKEQQPPAKAKHDGRRRIREDGLMRIYVLQLLVRATFEVGFLIGQYLLYGFEVSPVFVCSRKPCPHKIDCFISRPTEKTIFLLIMYGVSCMCLLLNVWEMLHLGFGTIRDTLNNKRKELEDSGTYNYPFTWNTPSAPPGYNIAVKPDQMQYTELSNAKMAYKQNKANIA...
cardiac muscle tissue development cell development cell-cell signaling chemical synaptic transmission gap junction assembly vasculogenesis visual perception connexin complex; endoplasmic reticulum; nucleoplasm; synapse gap junction channel activity gap junction channel activity involved in AV node cell-bundle of His ce...
adenylate cyclase-modulating G protein-coupled receptor signaling pathway dopamine receptor signaling pathway G protein-coupled receptor signaling pathway locomotory behavior negative regulation of calcium ion transport negative regulation of insulin secretion regulation of heart contraction response to organonitrogen ...
cell body; dendrite; heterotrimeric G-protein complex; membrane; myelin sheath; plasma membrane
corticotropin-releasing hormone receptor 1 binding G protein-coupled serotonin receptor binding G-protein beta/gamma-subunit complex binding GTP binding GTPase activating protein binding GTPase activity metal ion binding mu-type opioid receptor binding signaling receptor binding
Mus musculus
3D-structure Alternative splicing Cell membrane Direct protein sequencing GTP-binding Lipoprotein Magnesium Membrane Metal-binding Myristate Nucleotide-binding Palmitate Reference proteome Transducer
MGCTLSAEER
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAGDYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYPGSNTYEDAAAYIQTQFESKNRSPNKEIY...
adenylate cyclase-modulating G protein-coupled receptor signaling pathway dopamine receptor signaling pathway G protein-coupled receptor signaling pathway locomotory behavior negative regulation of calcium ion transport negative regulation of insulin secretion regulation of heart contraction response to organonitrogen ...
carnitine metabolic process fatty acid beta-oxidation in utero embryonic development long-chain fatty acid metabolic process long-chain fatty acid transport positive regulation of cold-induced thermogenesis response to fatty acid
mitochondrial inner membrane; mitochondrion
acyltransferase activity carnitine O-octanoyltransferase activity carnitine O-palmitoyltransferase activity
Rattus norvegicus
3D-structure Acetylation Acyltransferase Direct protein sequencing Fatty acid metabolism Lipid metabolism Membrane Mitochondrion Mitochondrion inner membrane Reference proteome Transferase Transit peptide Transport
MMPRLLFRAW
MMPRLLFRAWPRCPSLVLGAPSRPLSAVSGPDDYLQHSIVPTMHYQDSLPRLPIPKLEDTMKRYLNAQKPLLDDSQFRRTEALCKNFETGVGKELHAHLLAQDKQNKHTSYISGPWFDMYLTARDSIVLNFNPFMAFNPDPKSEYNDQLTRATNLTVSAVRFLKTLQAGLLEPEVFHLNPSKSDTDAFKRLIRFVPPSLSWYGAYLVNAYPLDMSQYFRLFNSTRIPRPNRDELFTDTKARHLLVLRKGHFYVFDVLDQDGNIVNPLEIQAHLKYILSDSSPVPEFPVAYLTSENRDVWAELRQKLIFDGNEETLKKVDS...
carnitine metabolic process fatty acid beta-oxidation in utero embryonic development long-chain fatty acid metabolic process long-chain fatty acid transport positive regulation of cold-induced thermogenesis response to fatty acid mitochondrial inner membrane; mitochondrion acyltransferase activity carnitine O-octanoylt...
base-excision repair cerebellum morphogenesis double-strand break repair via nonhomologous end joining hippocampus development negative regulation of protection from non-homologous end joining at telomere negative regulation of protein ADP-ribosylation positive regulation of DNA ligase activity positive regulation of s...
chromatin; chromosome, telomeric region; ERCC4-ERCC1 complex; nucleolus; nucleoplasm; nucleus; site of DNA damage
3' overhang single-stranded DNA endodeoxyribonuclease activity ADP-D-ribose modification-dependent protein binding enzyme binding oxidized DNA binding poly-ADP-D-ribose binding
Homo sapiens
3D-structure Chromosome DNA damage DNA repair Isopeptide bond Neurodegeneration Nucleus Phosphoprotein Reference proteome Repeat Ubl conjugation
MPEIRLRHVV
MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRPKLPAPTRTPATAPVPARAQGAVTGKPRGEGTEPRRPRAGPEELGKIL...
base-excision repair cerebellum morphogenesis double-strand break repair via nonhomologous end joining hippocampus development negative regulation of protection from non-homologous end joining at telomere negative regulation of protein ADP-ribosylation positive regulation of DNA ligase activity positive regulation of s...
chromatin remodeling maturation of LSU-rRNA nucleotide-excision repair positive regulation of transcription by RNA polymerase I positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II
chromatin; cytosol; nucleus; SWI/SNF complex
rDNA binding
Saccharomyces cerevisiae
3D-structure Activator Alternative initiation Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation
MGVIKKKRSH
MGVIKKKRSHHGKASRQQYYSGVQVGGVGSMGAINNNIPSLTSFAEENNYQYGYSGSSAGMNGRSLTYAQQQLNKQRQDFERVRLRPEQLSNIIHDESDTISFRSNLLKNFISSNDAFNMLSLTTVPCDRIEKSRLFSEKTIRYLMQKQHEMKTQAAELQEKPLTPLKYTKLIAAAEDGSRSTKDMIDAVFEQDSHLRYQPDGVVVHRDDPALVGKLRGDLREAPADYWTHAYRDVLAQYHEAKERIRQKEVTAGEAQDEASLQQQQQQDLQQQQQVVTTVASQSPHATATEKEPVPAVVDDPLENMFGDYSNEPFNTNF...
chromatin remodeling maturation of LSU-rRNA nucleotide-excision repair positive regulation of transcription by RNA polymerase I positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II chromatin; cytosol; nucleus; SWI/SNF complex rDNA binding Saccharomyces cerevisiae 3...
D-alanine catabolic process D-serine catabolic process D-serine metabolic process digestion dopamine biosynthetic process leucine metabolic process proline catabolic process
cytoplasm; cytosol; peroxisomal matrix; peroxisomal membrane; peroxisome
D-amino-acid dehydrogenase activity D-amino-acid oxidase activity FAD binding identical protein binding
Mus musculus
FAD Flavoprotein Oxidoreductase Peroxisome Reference proteome
MRVAVIGAGV
MRVAVIGAGVIGLSTALCIHERYHPTQPLHMKIYADRFTPFTTSDVAAGLWQPYLSDPSNPQEAEWSQQTFDYLLSCLHSPNAEKMGLALISGYNLFRDEVPDPFWKNAVLGFRKLTPSEMDLFPDYGYGWFNTSLLLEGKSYLPWLTERLTERGVKLIHRKVESLEEVARGVDVIINCTGVWAGALQADASLQPGRGQIIQVEAPWIKHFILTHDPSLGIYNSPYIIPGSKTVTLGGIFQLGNWSGLNSVRDHNTIWKSCCKLEPTLKNARIVGELTGFRPVRPQVRLEREWLRHGSSSAEVIHNYGHGGYGLTIHWGC...
D-alanine catabolic process D-serine catabolic process D-serine metabolic process digestion dopamine biosynthetic process leucine metabolic process proline catabolic process cytoplasm; cytosol; peroxisomal matrix; peroxisomal membrane; peroxisome D-amino-acid dehydrogenase activity D-amino-acid oxidase activity FAD bin...
protein geranylgeranylation
CAAX-protein geranylgeranyltransferase complex; cytoplasm
CAAX-protein geranylgeranyltransferase activity zinc ion binding
Saccharomyces cerevisiae
Cytoplasm Magnesium Metal-binding Prenyltransferase Reference proteome Repeat Transferase Zinc
MCQATNGPSR
MCQATNGPSRVVTKKHRKFFERHLQLLPSSHQGHDVNRMAIIFYSISGLSIFDVNVSAKYGDHLGWMRKHYIKTVLDDTENTVISGFVGSLVMNIPHATTINLPNTLFALLSMIMLRDYEYFETILDKRSLARFVSKCQRPDRGSFVSCLDYKTNCGSSVDSDDLRFCYIAVAILYICGCRSKEDFDEYIDTEKLLGYIMSQQCYNGAFGAHNEPHSGYTSCALSTLALLSSLEKLSDKFKEDTITWLLHRQVSSHGCMKFESELNASYDQSDDGGFQGRENKFADTCYAFWCLNSLHLLTKDWKMLCQTELVTNYLLDR...
protein geranylgeranylation CAAX-protein geranylgeranyltransferase complex; cytoplasm CAAX-protein geranylgeranyltransferase activity zinc ion binding Saccharomyces cerevisiae Cytoplasm Magnesium Metal-binding Prenyltransferase Reference proteome Repeat Transferase Zinc MCQATNGPSR MCQATNGPSRVVTKKHRKFFERHLQLLPSSHQGHDVN...
DNA repair
cytoplasm; cytosol
ATP hydrolysis activity GTPase activity
Saccharomyces cerevisiae
Direct protein sequencing Glycoprotein Phosphoprotein Reference proteome Repeat Stress response
MGLFDKVKQF
MGLFDKVKQFANSNNNNNDSGNNNQGDYVTKAENMIGEDRVNQFKSKIGEDRFDKMESKVRQQFSNTSINDNDSNNNDSYGSNNNDSYGSNNNDSYGSNNNDSYGSNNNDSYGSNNDDSYGSSNKKKSSYGSNNDDSYGSSNNNDSYGSNNNDSYGSNNNDSYGSNNDDSYGSSNKNKSSYGSNNDDSYGSNNDDSYGSSNKKKSSYGSSNNDSYGSNNDDSYGSNNNDSYGSNNDDSYGSSNKKKSSYGSNNDDSYGSSNNNDSYGSNNDDSYGSSNKNKSSYGSSSNDDSYGSSNNDDSYGSSNKKKSSYGSNNDDSY...
DNA repair cytoplasm; cytosol ATP hydrolysis activity GTPase activity Saccharomyces cerevisiae Direct protein sequencing Glycoprotein Phosphoprotein Reference proteome Repeat Stress response MGLFDKVKQF MGLFDKVKQFANSNNNNNDSGNNNQGDYVTKAENMIGEDRVNQFKSKIGEDRFDKMESKVRQQFSNTSINDNDSNNNDSYGSNNNDSYGSNNNDSYGSNNNDSYGSNNNDSYGSNND...
intracellular potassium ion homeostasis intracellular sodium ion homeostasis potassium ion import across plasma membrane proton transmembrane transport regulation of sodium ion transport sodium ion export across plasma membrane
axon; basolateral plasma membrane; melanosome; membrane; plasma membrane; sarcolemma; sodium:potassium-exchanging ATPase complex
ATP binding ATP hydrolysis activity metal ion binding P-type sodium:potassium-exchanging transporter activity
Equus caballus
Acetylation ATP-binding Cell membrane Cell projection Ion transport Magnesium Membrane Metal-binding Nucleotide-binding Phosphoprotein Potassium Potassium transport Reference proteome Sodium Sodium transport Sodium/potassium transport Translocase Transmembrane Transmembrane helix Transport
MGKGGGRDKY
MGKGGGRDKYEPAAISEHGNKKKAKKERDMDELKKEVSMDDHKLSLDELQRKYGTDLSRGLTTARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGIQAATEEEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVVRNGEKMSINAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAVFLGVTFFILSLILEYTWLEAVI...
intracellular potassium ion homeostasis intracellular sodium ion homeostasis potassium ion import across plasma membrane proton transmembrane transport regulation of sodium ion transport sodium ion export across plasma membrane axon; basolateral plasma membrane; melanosome; membrane; plasma membrane; sarcolemma; sodium...
one-carbon metabolic process
extracellular space
carbonate dehydratase activity zinc ion binding
Bos taurus
Direct protein sequencing Disulfide bond Glycoprotein Lyase Metal-binding Reference proteome Secreted Signal Zinc
MITLLFLLVV
MITLLFLLVVGAQAQHEWTYSEGVLDEKHWRLQYPDCGGTRQSPIDLKMKKVRYNPSLRALNLTGYGLRQGEFPMTNNGHTVQISLPSSMRMTTSDGSQYLAKQMHFHWGGDSSEISGSEHTVDGMRYIIEIHVVHYHSKYGSYEEAQNEPDGLAVLAALVEVKDYAENTYYSNFISHLEDIRYAGQSTVLRDLDIQDMLPGDLRYYYSYLGSLTTPSCTENVHWFVVADTVKLSKTQIEKLENSLLNHQNETIQNNYRSTQPLNHRVVEANFVSHPHQEYTLGSKLHFYLNNIDQNLEYLRRFIEQKITKRKKEKYWP
one-carbon metabolic process extracellular space carbonate dehydratase activity zinc ion binding Bos taurus Direct protein sequencing Disulfide bond Glycoprotein Lyase Metal-binding Reference proteome Secreted Signal Zinc MITLLFLLVV MITLLFLLVVGAQAQHEWTYSEGVLDEKHWRLQYPDCGGTRQSPIDLKMKKVRYNPSLRALNLTGYGLRQGEFPMTNNGHTVQISLP...
monoatomic cation transport regulation of membrane potential skeletal muscle contraction
acetylcholine-gated channel complex; neuron projection; plasma membrane; postsynaptic membrane; synapse
acetylcholine-gated monoatomic cation-selective channel activity ligand-gated monoatomic ion channel activity transmembrane signaling receptor activity
Rattus norvegicus
Cell membrane Disulfide bond Glycoprotein Ion channel Ion transport Ligand-gated ion channel Membrane Postsynaptic cell membrane Receptor Reference proteome Signal Synapse Transmembrane Transmembrane helix Transport
MHGGQGPQLL
MHGGQGPQLLLLLLATCLGAQSRNQEERLLADLMRNYDPHLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDYRLRWDPKDYEGLWILRVPSTMVWQPDIVLGNNVDGVFEVALYCNVLVSPDGCIYWLPPAIFRSSCSISVTYFPFDWQNCSLVFQSQTYSTSEINLQLSQEDGQAIEWIFIDPEAFTENGEWAIRHRPAKMLLDPVTPAEEAGHQKVVFYLLIQRKPLFYVINIIVPCVLISSVAILIYFLPAKAGGQKCTVATNVLLAQTVFLFLVAKKVPETSQAVPLISKYLTFLMVVTILIV...
monoatomic cation transport regulation of membrane potential skeletal muscle contraction acetylcholine-gated channel complex; neuron projection; plasma membrane; postsynaptic membrane; synapse acetylcholine-gated monoatomic cation-selective channel activity ligand-gated monoatomic ion channel activity transmembrane sig...
glycolytic process
cytoplasm
dihydrolipoyl dehydrogenase activity flavin adenine dinucleotide binding
Azotobacter vinelandii
3D-structure Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center
MSQKFDVIVI
MSQKFDVIVIGAGPGGYVAAIKSAQLGLKTALIEKYKGKEGKTALGGTCLNVGCIPSKALLDSSYKFHEAHESFKLHGISTGEVAIDVPTMIARKDQIVRNLTGGVASLIKANGVTLFEGHGKLLAGKKVEVTAADGSSQVLDTENVILASGSKPVEIPPAPVDQDVIVDSTGALDFQNVPGKLGVIGAGVIGLELGSVWARLGAEVTVLEAMDKFLPAVDEQVAKEAQKILTKQGLKILLGARVTGTEVKNKQVTVKFVDAEGEKSQAFDKLIVAVGRRPVTTDLLAADSGVTLDERGFIYVDDYCATSVPGVYAIGDV...
glycolytic process cytoplasm dihydrolipoyl dehydrogenase activity flavin adenine dinucleotide binding Azotobacter vinelandii3D-structure Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center MSQKFDVIVI MSQKFDVIVIGAGPGGYVAAIKSAQLGLKTALIEKYKGKEGKTALGGTCLNVGCIPSKALLDSSYKFHEAHESFKLHGIS...
mitochondrial electron transport, ubiquinol to cytochrome c respiratory electron transport chain response to oxidative stress
cytoplasm; mitochondrial respiratory chain complex III; mitochondrion
heme binding metal ion binding ubiquinol-cytochrome-c reductase activity
Gallus gallus
3D-structure Electron transport Heme Iron Membrane Metal-binding Mitochondrion Mitochondrion inner membrane Reference proteome Respiratory chain Transmembrane Transmembrane helix Transport Ubiquinone
MAPNIRKSHP
MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLLLAMHYTADTSLAFSSVAHTCRNVQYGWLIRNLHANGASFFFICIFLHIGRGLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHTLVEWAWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFLHESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPFLTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVLILFLIPFLHKSKQRTMTFRP...
mitochondrial electron transport, ubiquinol to cytochrome c respiratory electron transport chain response to oxidative stress cytoplasm; mitochondrial respiratory chain complex III; mitochondrion heme binding metal ion binding ubiquinol-cytochrome-c reductase activity Gallus gallus 3D-structure Electron transport Heme ...
amino acid salvage glutathione biosynthetic process glutathione catabolic process self proteolysis
outer membrane-bounded periplasmic space; periplasmic space
gamma-glutamyl-peptidase activity glutathione hydrolase activity leukotriene C4 gamma-glutamyl transferase activity
Escherichia coli
3D-structure Acyltransferase Direct protein sequencing Glutathione biosynthesis Hydrolase Periplasm Protease Reference proteome Signal Transferase Zymogen
MIKPTFLRRV
MIKPTFLRRVAIAALLSGSCFSAAAAPPAPPVSYGVEEDVFHPVRAKQGMVASVDATATQVGVDILKEGGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLIRSKNGNTTAIDFREMAPAKATRDMFLDDQGNPDSKKSLTSHLASGTPGTVAGFSLALDKYGTMPLNKVVQPAFKLARDGFIVNDALADDLKTYGSEVLPNHENSKAIFWKEGEPLKKGDTLVQANLAKSLEMIAENGPDEFYKGTIAEQIAQEMQKNGGLITKEDLAAYKAVERTPISGDYRGYQVYSMPPPSSGGIHIVQILNILENFDMKKYGFGSA...
amino acid salvage glutathione biosynthetic process glutathione catabolic process self proteolysis outer membrane-bounded periplasmic space; periplasmic space gamma-glutamyl-peptidase activity glutathione hydrolase activity leukotriene C4 gamma-glutamyl transferase activity Escherichia coli 3D-structure Acyltransferase...
cell wall organization eisosome assembly phosphorylation regulation of cell shape regulation of fungal-type cell wall organization
cytoplasm; nucleus
ATP binding protein serine kinase activity protein serine/threonine kinase activity
Saccharomyces cerevisiae
ATP-binding Cell shape Cell wall biogenesis/degradation Cytoplasm Kinase Nucleotide-binding Nucleus Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase
MHSWRISKFK
MHSWRISKFKLGRSKEDDGSSEDENEKSWGNGLFHFHHGEKHHDGSPKNHNHEHEHHIRKINTNETLPSSLSSPKLRNDASFKNPSGIGNDNSKASERKASQSSTETQGPSSESGLMTVKVYSGKDFTLPFPITSNSTILQKLLSSGILTSSSNDASEVAAIMRQLPRYKRVDQDSAGEGLIDRAFATKFIPSSILLPGSTNSSPLLYFTIEFDNSITTISPDMGTMEQPVFNKISTFDVTRKLRFLKIDVFARIPSLLLPSKNWQQEIGEQDEVLKEILKKINTNQDIHLDSFHLPLNLKIDSAAQIRLYNHHWISLER...
cell wall organization eisosome assembly phosphorylation regulation of cell shape regulation of fungal-type cell wall organization cytoplasm; nucleus ATP binding protein serine kinase activity protein serine/threonine kinase activity Saccharomyces cerevisiae ATP-binding Cell shape Cell wall biogenesis/degradation Cyto...
proteolysis
extracellular region
serine-type endopeptidase activity toxin activity
Daboia siamensis
Blood coagulation cascade activating toxin Direct protein sequencing Disulfide bond Glycoprotein Hemostasis impairing toxin Hydrolase Protease Secreted Serine protease Toxin
VVGGDECNIN
VVGGDECNINEHPFLVALYTSTSSTIHCGGALINREWVLTAAHCDRRNIRIKLGMHSKNIRNEDEQIRVPRGKYFCLNTKFPNGLDKDIMLIRLRRPVTYSTHIAPVSLPSRSRGVGSRCRIMGWGKISTTEDTYPDVPHCTNIFIVKHKWCEPLYPWVPADSRTLCAGILKGGRDTCHGDSGGPLICNGQIQGIVAGGSEPCGQHLKPAVYTKVFDYNNWIQNIIAGNRTVTCPP
proteolysis extracellular region serine-type endopeptidase activity toxin activity Daboia siamensis Blood coagulation cascade activating toxin Direct protein sequencing Disulfide bond Glycoprotein Hemostasis impairing toxin Hydrolase Protease Secreted Serine protease Toxin VVGGDECNIN VVGGDECNINEHPFLVALYTSTSSTIHCGGALIN...
proteolysis
extracellular region
serine-type endopeptidase activity toxin activity
Daboia siamensis
3D-structure Blood coagulation cascade activating toxin Direct protein sequencing Disulfide bond Glycoprotein Hemostasis impairing toxin Hydrolase Protease Secreted Serine protease Signal Toxin
MVLIKVLANL
MVLIKVLANLLVLQLSYAQKSSELVVGGDECNINEHPFLVALYTSASSTIHCAGALINREWVLTAAHCDRRNIRIKLGMHSKNIRNEDEQIRVPRGKYFCLNTKFPNGLDKDIMLIRLRRPVTYSTHIAPVSLPSRSRGVGSRCRIMGWGKISTTEDTYPDVPHCTNIFIVKHKWCEPLYPWVPADSRTLCAGILKGGRDTCHGDSGGPLICNGEMHGIVAGGSEPCGQHLKPAVYTKVFDYNNWIQSIIAGNRTVTCPP
proteolysis extracellular region serine-type endopeptidase activity toxin activity Daboia siamensis 3D-structure Blood coagulation cascade activating toxin Direct protein sequencing Disulfide bond Glycoprotein Hemostasis impairing toxin Hydrolase Protease Secreted Serine protease Signal Toxin MVLIKVLANL MVLIKVLANLLVLQ...
cell differentiation involved in embryonic placenta development epithelial cell differentiation intermediate filament organization Notch signaling pathway response to estrogen sarcomere organization
apicolateral plasma membrane; cell periphery; costamere; cytoskeleton; dystrophin-associated glycoprotein complex; intermediate filament; plasma membrane; sarcolemma; terminal web; Z disc
protein-containing complex binding structural constituent of muscle
Mus musculus
Coiled coil Intermediate filament Keratin Methylation Phosphoprotein Reference proteome
MTSYSYRQTS
MTSYSYRQTSAMSSFGGTGGGSVRIGSGGVFRAPSIHGGSGGRGVSVSSTRFVTSSSGSYGGVRGGSFSGTLAVSDGLLSGNEKITMQNLNDRLASYLDKVRALEQANGELEVKIRDWYQKQGPGPSRDYNHYFKTIEDLRDKILGATIDNSKIVLQIDNARLAADDFRTKFETEHALRLSVEADINGLRRVLDELTLARTDLEMQIESLKEELAYLKKNHEEEITALRSQVGGQVSVEVDSTPGVDLAKILSEMRSQYEIMAEKNRKDAEATYLARIEELNTQVAVHSEQIQISKTEVTDLRRTLQGLEIELQSQLSMK...
cell differentiation involved in embryonic placenta development epithelial cell differentiation intermediate filament organization Notch signaling pathway response to estrogen sarcomere organization apicolateral plasma membrane; cell periphery; costamere; cytoskeleton; dystrophin-associated glycoprotein complex; interm...
epidermis development epithelial cell differentiation intermediate filament organization
cytoskeleton; cytosol; extracellular exosome; intermediate filament; nucleus
scaffold protein binding structural constituent of cytoskeleton
Homo sapiens
Alternative splicing Coiled coil Intermediate filament Isopeptide bond Keratin Phosphoprotein Reference proteome Ubl conjugation
MTTTFLQTSS
MTTTFLQTSSSTFGGGSTRGGSLLAGGGGFGGGSLSGGGGSRSISASSARFVSSGSGGGYGGGMRVCGFGGGAGSVFGGGFGGGVGGGFGGGFGGGDGGLLSGNEKITMQNLNDRLASYLDKVRALEEANADLEVKIHDWYQKQTPTSPECDYSQYFKTIEELRDKIMATTIDNSRVILEIDNARLAADDFRLKYENELALRQGVEADINGLRRVLDELTLARTDLEMQIEGLNEELAYLKKNHEEEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSKTEELNKEVASNTEMIQTSKT...
epidermis development epithelial cell differentiation intermediate filament organization cytoskeleton; cytosol; extracellular exosome; intermediate filament; nucleus scaffold protein binding structural constituent of cytoskeleton Homo sapiens Alternative splicing Coiled coil Intermediate filament Isopeptide bond Kerati...
cytoskeleton organization epithelial cell differentiation intermediate filament organization keratinization negative regulation of epithelial cell proliferation
cell surface; cytosol; intermediate filament; intermediate filament cytoskeleton; keratin filament; nucleus
structural constituent of skin epidermis
Homo sapiens
Coiled coil Disease variant Intermediate filament Keratin Methylation Reference proteome
MIARQQCVRG
MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQGACFGGAGGFGTGGFGGGFGGSFSGKGGPGFPVCPAGGIQEVTINQSLLTPLHVEIDPEIQKVRTEEREQIKLLNNKFASFIDKVQFLEQQNKVLETKWNLLQQQTTTTSSKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAENDFVVLKKDVDAAYLNKVELEAKVDSLNDEINFLKVLYDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVRAQYEEIAQ...
cytoskeleton organization epithelial cell differentiation intermediate filament organization keratinization negative regulation of epithelial cell proliferation cell surface; cytosol; intermediate filament; intermediate filament cytoskeleton; keratin filament; nucleus structural constituent of skin epidermis Homo sapie...
cell differentiation female sex determination female somatic sex determination male somatic sex determination mRNA processing mRNA splicing, via spliceosome positive regulation of mRNA splicing, via spliceosome regulation of alternative mRNA splicing, via spliceosome reproduction sex determination sex differentiation s...
precatalytic spliceosome; spliceosomal complex
identical protein binding mRNA binding pre-mRNA binding RNA binding
Drosophila melanogaster
Alternative splicing Developmental protein Differentiation mRNA processing mRNA splicing Phosphoprotein Reference proteome RNA-binding Sexual differentiation Spermatogenesis
MDREPLSSGR
MDREPLSSGRLHCSARYKHKRSASSSSAGTTSSGHKDRRSDYDYCGSRRHQRSSSRRRSRSRSSSESPPPEPRHRSGRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRYDYRNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLRRTSSRY
cell differentiation female sex determination female somatic sex determination male somatic sex determination mRNA processing mRNA splicing, via spliceosome positive regulation of mRNA splicing, via spliceosome regulation of alternative mRNA splicing, via spliceosome reproduction sex determination sex differentiation s...
fatty acid primary amide biosynthetic process peptide amidation response to zinc ion
extracellular exosome; extracellular region; membrane; secretory granule membrane; transport vesicle membrane
calcium ion binding copper ion binding L-ascorbic acid binding peptidylamidoglycolate lyase activity peptidylglycine monooxygenase activity zinc ion binding
Homo sapiens
Alternative splicing Calcium Cleavage on pair of basic residues Copper Cytoplasmic vesicle Disulfide bond Glycoprotein Lipid metabolism Lyase Membrane Metal-binding Monooxygenase Multifunctional enzyme Oxidoreductase Phosphoprotein Reference proteome Repeat Secreted Signal Sulfation Transmembrane Transmembrane helix Vi...
MAGRVPSLLV
MAGRVPSLLVLLVFPSSCLAFRSPLSVFKRFKETTRPFSNECLGTTRPVVPIDSSDFALDIRMPGVTPKQSDTYFCMSMRIPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYKNYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVGHPVDVSFGDLLAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEA...
fatty acid primary amide biosynthetic process peptide amidation response to zinc ion extracellular exosome; extracellular region; membrane; secretory granule membrane; transport vesicle membrane calcium ion binding copper ion binding L-ascorbic acid binding peptidylamidoglycolate lyase activity peptidylglycine monooxyg...
chylomicron remnant clearance high-density lipoprotein particle clearance lipid catabolic process lipid transport negative regulation of very-low-density lipoprotein particle clearance positive regulation of fatty acid biosynthetic process positive regulation of lipoprotein lipase activity positive regulation of phosph...
chylomicron; intermediate-density lipoprotein particle; low-density lipoprotein particle; spherical high-density lipoprotein particle; very-low-density lipoprotein particle
lipid binding lipoprotein lipase activator activity phospholipase activator activity phospholipase binding
Bos taurus
Chylomicron Direct protein sequencing Glycoprotein HDL LDL Lipid degradation Lipid metabolism Lipid transport Reference proteome Secreted Sialic acid Signal Transport VLDL
MGTRYFLVGF
MGTRYFLVGFLILLVLGFEVQGAHVPQQDEASSPALLTQVQESLLGYWDTAKAAAQKLYKKTYLPAVDEKIRDIYSKSTAAVTTYAGIITDQVFSVLSGKD
chylomicron remnant clearance high-density lipoprotein particle clearance lipid catabolic process lipid transport negative regulation of very-low-density lipoprotein particle clearance positive regulation of fatty acid biosynthetic process positive regulation of lipoprotein lipase activity positive regulation of phosph...
actin filament organization budding cell apical bud growth budding cell isotropic bud growth Cdc42 protein signal transduction cell cycle conjugation with cellular fusion endocytosis establishment of cell polarity establishment or maintenance of cell polarity invasive growth in response to glucose limitation pheromone-...
cell periphery; cellular bud neck; cellular bud tip; fungal-type vacuole membrane; incipient cellular bud site; mating projection tip; nuclear membrane; plasma membrane; septin ring
GTP binding GTPase activity protein kinase binding
Saccharomyces cerevisiae
Cell cycle Cell division Cell membrane GTP-binding Hydrolase Lipoprotein Membrane Methylation Nucleotide-binding Pheromone response Prenylation Reference proteome
MQTLKCVVVG
MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPPVIKKSKKCAIL
actin filament organization budding cell apical bud growth budding cell isotropic bud growth Cdc42 protein signal transduction cell cycle conjugation with cellular fusion endocytosis establishment of cell polarity establishment or maintenance of cell polarity invasive growth in response to glucose limitation pheromone-...
negative regulation of blood coagulation regulation of gene expression spermatogenesis
cell surface; extracellular exosome; membrane
integrin binding
Homo sapiens
Glycoprotein Membrane Reference proteome Transmembrane Transmembrane helix
MAGVSACIKY
MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK
negative regulation of blood coagulation regulation of gene expression spermatogenesis cell surface; extracellular exosome; membrane integrin binding Homo sapiens Glycoprotein Membrane Reference proteome Transmembrane Transmembrane helix MAGVSACIKY MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGF...
cytidine deamination
cytosol
cytidine deaminase activity deoxycytidine deaminase activity identical protein binding zinc ion binding
Bacillus subtilis
3D-structure Hydrolase Metal-binding Reference proteome Zinc
MNRQELITEA
MNRQELITEALKARDMAYAPYSKFQVGAALLTKDGKVYRGCNIENAAYSMCNCAERTALFKAVSEGDTEFQMLAVAADTPGPVSPCGACRQVISELCTKDVIVVLTNLQGQIKEMTVEELLPGAFSSEDLHDERKL
cytidine deamination cytosol cytidine deaminase activity deoxycytidine deaminase activity identical protein binding zinc ion binding Bacillus subtilis 3D-structure Hydrolase Metal-binding Reference proteome Zinc MNRQELITEA MNRQELITEALKARDMAYAPYSKFQVGAALLTKDGKVYRGCNIENAAYSMCNCAERTALFKAVSEGDTEFQMLAVAADTPGPVSPCGACRQVISELC...
amino acid biosynthetic process aromatic amino acid family biosynthetic process chorismate metabolic process
cytoplasm
chorismate mutase activity
Bacillus subtilis
3D-structure Amino-acid biosynthesis Aromatic amino acid biosynthesis Cytoplasm Direct protein sequencing Isomerase Reference proteome
MMIRGIRGAT
MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKVVVLRPDLSLTKNTEL
amino acid biosynthetic process aromatic amino acid family biosynthetic process chorismate metabolic process cytoplasm chorismate mutase activity Bacillus subtilis 3D-structure Amino-acid biosynthesis Aromatic amino acid biosynthesis Cytoplasm Direct protein sequencing Isomerase Reference proteome MMIRGIRGAT MMIRGIRGAT...
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway adenylate cyclase-modulating G protein-coupled receptor signaling pathway G protein-coupled receptor signaling pathway G protein-coupled serotonin receptor signaling pathway negative regulation of insulin secretion
cell body; dendrite; endoplasmic reticulum; heterotrimeric G-protein complex; nuclear envelope; plasma membrane
adenylate cyclase inhibitor activity G protein-coupled receptor binding G protein-coupled serotonin receptor binding G-protein beta/gamma-subunit complex binding GTP binding GTPase activity metal ion binding
Homo sapiens
3D-structure ADP-ribosylation GTP-binding Lipoprotein Magnesium Membrane Metal-binding Myristate Nucleotide-binding Palmitate Reference proteome Transducer
MGCRQSSEEK
MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGGFNLEACKEYKPLIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEITPELLGVMRRLWADPGAQACFSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQTSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLAEKIRRIPLTICFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEI...
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway adenylate cyclase-modulating G protein-coupled receptor signaling pathway G protein-coupled receptor signaling pathway G protein-coupled serotonin receptor signaling pathway negative regulation of insulin secretion cell body; dendrite; endoplasmi...
adenylate cyclase-modulating G protein-coupled receptor signaling pathway background adaptation cell morphogenesis cone retinal bipolar cell differentiation detection of chemical stimulus involved in sensory perception of bitter taste detection of light stimulus involved in visual perception dopamine metabolic process ...
heterotrimeric G-protein complex; photoreceptor inner segment; photoreceptor outer segment; photoreceptor outer segment membrane; plasma membrane; synapse
G protein-coupled photoreceptor activity G protein-coupled receptor binding G-protein beta/gamma-subunit complex binding GTP binding GTPase activity metal ion binding
Homo sapiens
3D-structure ADP-ribosylation Cell projection GTP-binding Lipoprotein Magnesium Metal-binding Myristate Nucleotide-binding Reference proteome Sensory transduction Transducer Vision
MGSGASAEDK
MGSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEFKAIIYGNVLQSILAIIRAMTTLGIDYAEPSCADDGRQLNNLADSIEEGTMPPELVEVIRRLWKDGGVQACFERAAEYQLNDSASYYLNQLERITDPEYLPSEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYDDAGNYIKSQFLDLNMRKDVKEIY...
adenylate cyclase-modulating G protein-coupled receptor signaling pathway background adaptation cell morphogenesis cone retinal bipolar cell differentiation detection of chemical stimulus involved in sensory perception of bitter taste detection of light stimulus involved in visual perception dopamine metabolic process ...
aldosterone biosynthetic process C21-steroid hormone biosynthetic process cellular response to hormone stimulus cellular response to peptide hormone stimulus cellular response to potassium ion cholesterol metabolic process cortisol biosynthetic process cortisol metabolic process glucocorticoid biosynthetic process mine...
mitochondrial inner membrane; mitochondrion
corticosterone 18-monooxygenase activity heme binding iron ion binding steroid 11-beta-monooxygenase activity steroid hydroxylase activity
Homo sapiens
3D-structure Disease variant Heme Iron Lipid metabolism Membrane Metal-binding Mitochondrion Mitochondrion inner membrane Monooxygenase Oxidoreductase Reference proteome Steroid metabolism Steroidogenesis Transit peptide
MALRAKAEVC
MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTA...
aldosterone biosynthetic process C21-steroid hormone biosynthetic process cellular response to hormone stimulus cellular response to peptide hormone stimulus cellular response to potassium ion cholesterol metabolic process cortisol biosynthetic process cortisol metabolic process glucocorticoid biosynthetic process mine...
glucocorticoid biosynthetic process hormone biosynthetic process progesterone metabolic process steroid metabolic process
axon; endoplasmic reticulum membrane; neuronal cell body
17-alpha-hydroxyprogesterone aldolase activity heme binding iron ion binding steroid 17-alpha-monooxygenase activity
Sus scrofa
Endoplasmic reticulum Heme Iron Lipid metabolism Lyase Membrane Metal-binding Microsome Monooxygenase Oxidoreductase Reference proteome Steroidogenesis
MWVLLVFFLL
MWVLLVFFLLTLTYLFWPKTKGSGAKYPRSLPVLPVVGSLPFLPRRGHQHMNFFKLQDKYGPIFSFRLGSKTTVVIGDHQLAKEVLLKKGKEFSGRPRVMTLDILSDNQKGIAFADHGTSWQLHRKLALSTFSLFKGGNLKLENIINQEIKVLCDFLATRNGESIDLAQPLSLAMTNIVSFICFNFSFKKGDPALQAIVNFNDGILDAVGKEILYDMFPGIRILPSQTLENMKQCVRMRNELLREILENRKENYSRNSITNLLDIMIQAKTNAESNTGGPDHNLKLLSDRHMLATVADIFGAGVETSASVVKWIVAFLLH...
glucocorticoid biosynthetic process hormone biosynthetic process progesterone metabolic process steroid metabolic process axon; endoplasmic reticulum membrane; neuronal cell body 17-alpha-hydroxyprogesterone aldolase activity heme binding iron ion binding steroid 17-alpha-monooxygenase activity Sus scrofa Endoplasmic r...
extrinsic apoptotic signaling pathway via death domain receptors immune response necroptotic signaling pathway negative regulation of protein-containing complex disassembly positive regulation of apoptotic process positive regulation of canonical NF-kappaB signal transduction positive regulation of extrinsic apoptotic ...
cell surface; extracellular space; plasma membrane
cytokine activity tumor necrosis factor receptor binding
Felis catus
Cell membrane Cytokine Disulfide bond Glycoprotein Lipoprotein Membrane Myristate Phosphoprotein Reference proteome Secreted Signal-anchor Transmembrane Transmembrane helix
MSTESMIRDV
MSTESMIRDVELAEEALPKKAGGPQGSGRCLCLSLFSFLLVAGATTLFCLLHFGVIGPQREELPHGLQLINPLPQTLRSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELTDNQLKVPSDGLYLIYSQVLFTGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSTEINLPAYLDFAESGQVYFGIIAL
extrinsic apoptotic signaling pathway via death domain receptors immune response necroptotic signaling pathway negative regulation of protein-containing complex disassembly positive regulation of apoptotic process positive regulation of canonical NF-kappaB signal transduction positive regulation of extrinsic apoptotic ...
platelet aggregation protein localization to plasma membrane regulation of cell shape
cytoplasm; cytosol; extracellular exosome; myosin II complex; stress fiber; Z disc
calcium ion binding glutamate receptor binding
Homo sapiens
Calcium Metal-binding Motor protein Muscle protein Myosin Phosphoprotein Reference proteome Repeat
MSSKRTKTKT
MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
platelet aggregation protein localization to plasma membrane regulation of cell shape cytoplasm; cytosol; extracellular exosome; myosin II complex; stress fiber; Z disc calcium ion binding glutamate receptor binding Homo sapiens Calcium Metal-binding Motor protein Muscle protein Myosin Phosphoprotein Reference proteome...
adaptation of rhodopsin mediated signaling deactivation of rhodopsin mediated signaling desensitization of G protein-coupled receptor signaling pathway G protein-coupled receptor internalization metarhodopsin inactivation photoreceptor cell maintenance sensory perception of smell sensory perception of sound visual perc...
cytoplasm; rhabdomere; subrhabdomeral cisterna
G protein-coupled receptor binding opsin binding
Drosophila melanogaster
Cell projection Phosphoprotein Reference proteome Sensory transduction Vision
MVVSVKVFKK
MVVSVKVFKKATPNGKVTFYLGRRDFIDHIDYCDPVDGVIVVEPDYLKNRKVFGQLATTYRYGREEDEVMGVKFSKELILCREQIVPMTNPNMEMTPMQEKLVRKLGSNAYPFTFHFPPNSPSSVTLQQEGDDNGKPLGVEYTIRAFVGDSEDDRQHKRSMVSLVIKKLQYAPLNRGQRLPSSLVSKGFTFSNGKISLEVTLDREIYYHGEKTAATVQVSNNSKKSVKSIKCFIVQHTEITMVNAQFSKHVAQLETKEGCPITPGANLTKTFYLIPLAANNKDRHGIALDGHLKDEDVNLASSTMVQEGKSTGDACGIVI...
adaptation of rhodopsin mediated signaling deactivation of rhodopsin mediated signaling desensitization of G protein-coupled receptor signaling pathway G protein-coupled receptor internalization metarhodopsin inactivation photoreceptor cell maintenance sensory perception of smell sensory perception of sound visual perc...
defense response to virus immune system process mRNA splicing, via spliceosome regulation of alternative mRNA splicing, via spliceosome regulation of defense response to virus regulation of translation regulatory ncRNA-mediated post-transcriptional gene silencing
catalytic step 2 spliceosome; cytoplasm; cytosol; nucleolus; nucleus; polytene chromosome; polytene chromosome puff; precatalytic spliceosome; ribonucleoprotein complex
ATP binding ATP hydrolysis activity mRNA binding RNA binding RNA helicase activity
Drosophila melanogaster
Alternative splicing Antiviral defense ATP-binding Cytoplasm Helicase Hydrolase Immunity mRNA processing mRNA splicing Nucleotide-binding Nucleus Reference proteome RNA-binding RNA-mediated gene silencing Translation regulation
MLKLVQYIAP
MLKLVQYIAPRVGGATPRPTACGWGNLLLISPRSGASSEKCITQRRHFLFSSASSSGTFASSSSLCTEQRQQFHGSRRNRETILFPSTYSSLQAQSQRAFRDSSKPDSDDYVDSIPKAEQRTRTRKSLFNDPDERTEEIKIEGVMAPHDRDFGHSGRGGRGGDRGGDDRRGGGGGGNRFGGGGGGGDYHGIRNGRVEKRRDDRGGGNRFGGGGGFGDRRGGGGGGSQDLPMRPVDFSNLAPFKKNFYQEHPNVANRSPYEVQRYREEQEITVRGQVPNPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSN...
defense response to virus immune system process mRNA splicing, via spliceosome regulation of alternative mRNA splicing, via spliceosome regulation of defense response to virus regulation of translation regulatory ncRNA-mediated post-transcriptional gene silencing catalytic step 2 spliceosome; cytoplasm; cytosol; nucleo...
cellular hyperosmotic salinity response cellular hypotonic salinity response cellular response to cAMP cellular response to insulin stimulus cellular response to magnesium ion cellular response to phorbol 13-acetate 12-myristate cellular response to raffinose cellular response to xenobiotic stimulus dephosphorylation f...
cytoplasm; cytosol; extracellular space; nucleus
AMP binding fructose 1,6-bisphosphate 1-phosphatase activity identical protein binding metal ion binding monosaccharide binding RNA polymerase II-specific DNA-binding transcription factor binding
Rattus norvegicus
Acetylation Allosteric enzyme Carbohydrate metabolism Direct protein sequencing Gluconeogenesis Hydrolase Magnesium Metal-binding Phosphoprotein Reference proteome
MVDHAPFETD
MVDHAPFETDISTLTRFVLEEGRKAGGTGEMTQLLNSLCTAIKAISSAVRQAGIAQLYGIAGSTNVTGDQVKKLDILSNDLVINMLKSSYATCVLVSEEDTHAIIIEPEKRGKYVVCFDPLDGSSNIDCLASIGTIFGIYRKTSANEPSEKDALQPGRNLVAAGYALYGSATMLVLAMNCGVNCFMLDPSIGEFILVDRDVKIKKKGNIYSINEGYAKDFDPAINEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKNPSGKLRLLYECNPIAYVMEKAGGLATTGNEDILDIVPTEIHQKAPVIMG...
cellular hyperosmotic salinity response cellular hypotonic salinity response cellular response to cAMP cellular response to insulin stimulus cellular response to magnesium ion cellular response to phorbol 13-acetate 12-myristate cellular response to raffinose cellular response to xenobiotic stimulus dephosphorylation f...
catecholamine biosynthetic process histamine biosynthetic process histidine catabolic process histidine metabolic process
cytoplasm; cytosol
histidine decarboxylase activity pyridoxal phosphate binding
Homo sapiens
3D-structure Alternative splicing Catecholamine biosynthesis Decarboxylase Lyase Pyridoxal phosphate Reference proteome
MMEPEEYRER
MMEPEEYRERGREMVDYICQYLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGDIERIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVMDWLAKMLGLPEHFLHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDADESCLNARLVAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGEALQKAIEEDKQRGLVPVFVCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFTFNPSKWMMVHFDCTGFWVKD...
catecholamine biosynthetic process histamine biosynthetic process histidine catabolic process histidine metabolic process cytoplasm; cytosol histidine decarboxylase activity pyridoxal phosphate binding Homo sapiens 3D-structure Alternative splicing Catecholamine biosynthesis Decarboxylase Lyase Pyridoxal phosphate Refe...
chaperone cofactor-dependent protein refolding chaperone-mediated autophagy translocation complex disassembly clathrin coat disassembly late endosomal microautophagy mRNA processing negative regulation of DNA-templated transcription protein refolding protein targeting to lysosome involved in chaperone-mediated autophag...
autophagosome; cytoplasm; dendrite; lysosomal membrane; lysosome; melanosome; nucleolus; nucleus; plasma membrane; postsynaptic cytosol; presynaptic cytosol; Prp19 complex; ribonucleoprotein complex; spliceosomal complex; terminal bouton
ATP binding ATP hydrolysis activity ATP-dependent protein folding chaperone clathrin-uncoating ATPase activity heat shock protein binding protein folding chaperone protein-macromolecule adaptor activity
Bos taurus
3D-structure Acetylation ATP-binding Autophagy Cell membrane Chaperone Cytoplasm Hydrolase Isopeptide bond Lysosome Membrane Methylation mRNA processing mRNA splicing Nucleotide-binding Nucleus Phosphoprotein Reference proteome Repressor Spliceosome Stress response Transcription Transcription regulation Ubl conjugation
MSKGPAVGID
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKA...
chaperone cofactor-dependent protein refolding chaperone-mediated autophagy translocation complex disassembly clathrin coat disassembly late endosomal microautophagy mRNA processing negative regulation of DNA-templated transcription protein refolding protein targeting to lysosome involved in chaperone-mediated autophag...
cellular response to calcium ion starvation cellular response to starvation negative regulation of mitochondrial depolarization response to virus response to vitamin A
cytoplasm; extracellular space; protein-containing complex; yolk
DNA binding fatty acid binding metal ion binding pyridoxal phosphate binding small molecule binding toxic substance binding
Gallus gallus
Allergen Calcium Copper Direct protein sequencing Disulfide bond Glycoprotein Lipid-binding Metal-binding Reference proteome Repeat Secreted Signal Zinc
MKWVTLISFI
MKWVTLISFIFLFSSATSRNLQRFARDAEHKSEIAHRYNDLKEETFKAVAMITFAQYLQRCSYEGLSKLVKDVVDLAQKCVANEDAPECSKPLPSIILDEICQVEKLRDSYGAMADCCSKADPERNECFLSFKVSQPDFVQPYQRPASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAPAILSFAVDFEHALQSCCKESDVGACLDTKEIVMREKAKGVSVKQQYFCGILKQFGDRVFQARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDMVECMDDMARMMSNLCSQQDVFSGKIKDCCEKPIVERSQCIME...
cellular response to calcium ion starvation cellular response to starvation negative regulation of mitochondrial depolarization response to virus response to vitamin A cytoplasm; extracellular space; protein-containing complex; yolk DNA binding fatty acid binding metal ion binding pyridoxal phosphate binding small mole...
cardiac muscle contraction diaphragm contraction regulation of ATP-dependent activity regulation of muscle contraction regulation of muscle filament sliding speed response to metal ion skeletal muscle contraction transition between fast and slow fiber ventricular cardiac muscle tissue morphogenesis
cardiac Troponin complex; contractile fiber; troponin complex
actin filament binding calcium ion binding calcium-dependent protein binding protein homodimerization activity troponin I binding troponin T binding
Mus musculus
3D-structure Acetylation Calcium Metal-binding Muscle protein Phosphoprotein Reference proteome Repeat
MDDIYKAAVE
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKMMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
cardiac muscle contraction diaphragm contraction regulation of ATP-dependent activity regulation of muscle contraction regulation of muscle filament sliding speed response to metal ion skeletal muscle contraction transition between fast and slow fiber ventricular cardiac muscle tissue morphogenesis cardiac Troponin com...
intracellular iron ion homeostasis iron ion transport
extracellular space
ferric iron binding
Oryctolagus cuniculus
3D-structure Direct protein sequencing Disulfide bond Glycoprotein Ion transport Iron Iron transport Metal-binding Methylation Phosphoprotein Reference proteome Repeat Secreted Signal Transport
MRLAAGALLA
MRLAAGALLACAALGLCLAVTEKTVRWCAVNDHEASKCANFRDSMKKVLPEDGPRIICVKKASYLDCIKAIAAHEADAVTLDAGLVHEAGLTPNNLKPVVAEFYGSKENPKTFYYAVALVKKGSNFQLNELQGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVASFFSGSCVPCADGADFPQLCQLCPGCGCSSVQPYFGYSGAFKCLKDGLGDVAFVKQETIFENLPSKDERDQYELLCLDNTRKPVDEYEQCHLARVPSHAVVARSVDGKEDLIWELLNQAQEHFGKDKSGDFQLFSSPHGKNLLFKDSAYG...
intracellular iron ion homeostasis iron ion transport extracellular space ferric iron binding Oryctolagus cuniculus 3D-structure Direct protein sequencing Disulfide bond Glycoprotein Ion transport Iron Iron transport Metal-binding Methylation Phosphoprotein Reference proteome Repeat Secreted Signal Transport MRLAAGALLA...
cellular response to oxidative stress hydrogen peroxide catabolic process lignin catabolic process
extracellular region
heme binding manganese peroxidase activity metal ion binding
Phanerodontia chrysosporium
Calcium Direct protein sequencing Disulfide bond Glycoprotein Heme Hydrogen peroxide Iron Lignin degradation Manganese Metal-binding Oxidoreductase Peroxidase Secreted Signal
MAFGSLLAFV
MAFGSLLAFVALAAITRAAPTAESAVCPDGTRVTNAACCAFIPLAQDLQETLFQGDCGEDAHEVIRLTFHDAIAISQSLGPQAGGGADGSMLHFPTIEPNFSANSGIDDSVNNLLPFMQKHDTISAADLVQFAGAVALSNCPGAPRLEFMAGRPNTTIPAVEGLIPEPQDSVTKILQRFEDAGNFSPFEVVSLLASHTVARADKVDETIDAAPFDSTPFTFDTQVFLEVLLKGTGFPGSNNNTGEVMSPLPLGSGSDTGEMRLQSDFALARDERTACFWQSFVNEQEFMAASFKAAMAKLAILGHSRSSLIDCSDVVPVP...
cellular response to oxidative stress hydrogen peroxide catabolic process lignin catabolic process extracellular region heme binding manganese peroxidase activity metal ion binding Phanerodontia chrysosporium Calcium Direct protein sequencing Disulfide bond Glycoprotein Heme Hydrogen peroxide Iron Lignin degradation M...
apoptotic process cell cycle cerebral cortex development double-strand break repair liver regeneration negative regulation of cysteine-type endopeptidase activity involved in apoptotic process negative regulation of translation negative regulation of ubiquitin-dependent protein catabolic process peptidyl-serine phospho...
chromatin; cytosol; nucleus; PcG protein complex; PML body; protein kinase CK2 complex; Sin3-type complex
ATP binding beta-catenin binding identical protein binding kinase activity protein phosphatase regulator activity protein serine kinase activity protein serine/threonine kinase activity ribonucleoprotein complex binding
Rattus norvegicus
3D-structure Apoptosis ATP-binding Biological rhythms Cell cycle Direct protein sequencing Kinase Nucleotide-binding Nucleus Phosphoprotein Reference proteome Serine/threonine-protein kinase Transcription Transcription regulation Transferase Wnt signaling pathway
MSGPVPSRAR
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAME...
apoptotic process cell cycle cerebral cortex development double-strand break repair liver regeneration negative regulation of cysteine-type endopeptidase activity involved in apoptotic process negative regulation of translation negative regulation of ubiquitin-dependent protein catabolic process peptidyl-serine phospho...
amino acid transmembrane transport amino acid transport polyamine transport
COPII-coated ER to Golgi transport vesicle; endoplasmic reticulum; endoplasmic reticulum membrane; endosome; fungal-type vacuole lumen; multivesicular body; plasma membrane
amino acid transmembrane transporter activity beta-alanine transmembrane transporter activity L-phenylalanine transmembrane transporter activity L-proline transmembrane transporter activity polyamine transmembrane transporter activity
Saccharomyces cerevisiae
Amino-acid transport Cell membrane Endoplasmic reticulum Isopeptide bond Membrane Reference proteome Transmembrane Transmembrane helix Transport Ubl conjugation
MSNTSSYEKN
MSNTSSYEKNNPDNLKHNGITIDSEFLTQEPITIPSNGSAVSIDETGSGSKWQDFKDSFKRVKPIEVDPNLSEAEKVAIITAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAFAGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVPKAA...
amino acid transmembrane transport amino acid transport polyamine transport COPII-coated ER to Golgi transport vesicle; endoplasmic reticulum; endoplasmic reticulum membrane; endosome; fungal-type vacuole lumen; multivesicular body; plasma membrane amino acid transmembrane transporter activity beta-alanine transmembran...
intracellular protein transport macroautophagy vesicle-mediated transport
cytosol; Golgi apparatus; plasma membrane
GTP binding GTPase activity
Saccharomyces cerevisiae
3D-structure ER-Golgi transport Golgi apparatus GTP-binding Isopeptide bond Lipoprotein Myristate Nucleotide-binding Protein transport Reference proteome Transport Ubl conjugation
MGLYASKLFS
MGLYASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQSTCATSGEGLYEGLEWLSNNLKNQS
intracellular protein transport macroautophagy vesicle-mediated transport cytosol; Golgi apparatus; plasma membrane GTP binding GTPase activity Saccharomyces cerevisiae 3D-structure ER-Golgi transport Golgi apparatus GTP-binding Isopeptide bond Lipoprotein Myristate Nucleotide-binding Protein transport Reference prote...
cell wall macromolecule catabolic process chitin catabolic process defense response to fungus killing of cells of another organism plant-type hypersensitive response polysaccharide catabolic process
plant-type vacuole; secretory vesicle; vacuole
chitin binding chitinase activity
Arabidopsis thaliana
Antimicrobial Carbohydrate metabolism Chitin degradation Chitin-binding Direct protein sequencing Disulfide bond Fungicide Glycosidase Hydrolase Hypersensitive response Plant defense Polysaccharide degradation Reference proteome Signal Vacuole
MPPQKENHRT
MPPQKENHRTLNKMKTNLFLFLIFSLLLSLSSAEQCGRQAGGALCPNGLCCSEFGWCGNTEPYCKQPGCQSQCTPGGTPPGPTGDLSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFPGFGTTGDTATRKKEVAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPASDYCEPSATWPCASGKRYYGRGPMQLSWNYNYGLCGRAIGVDLLNNPDLVANDAVIAFKAAIWFWMTAQPPKPSCHAVIAGQWQPSDADRAAGRLPGYGVITNIINGGLECGRGQDGRVADRIGFYQRYCNIFGVNPGGNLDC...
cell wall macromolecule catabolic process chitin catabolic process defense response to fungus killing of cells of another organism plant-type hypersensitive response polysaccharide catabolic process plant-type vacuole; secretory vesicle; vacuole chitin binding chitinase activity Arabidopsis thaliana Antimicrobial Carbo...
cellular response to water deprivation chitin catabolic process pattern recognition receptor signaling pathway polysaccharide catabolic process response to cold response to light intensity response to salt stress response to wounding
extracellular region
beta-glucosidase activity chitinase activity lysozyme activity
Arabidopsis thaliana
Carbohydrate metabolism Chitin degradation Disulfide bond Glycosidase Hydrolase Polysaccharide degradation Reference proteome Secreted Signal
MTNMTLRKHV
MTNMTLRKHVIYFLFFISCSLSKPSDASRGGIAIYWGQNGNEGNLSATCATGRYAYVNVAFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSREDAKVIADYLWNNFLGGKSSSRPLGDAVLDGIDFNIELGSPQHWDDLARTLSKFSHRGRKIYLTGAPQCPFPDRLMGSALNTKRFDYVWIQFYNNPPCSYSSGNTQNLFDSWNKWTTSIAAQKFFLGLPAAPEAAGSGYIPPDVLTSQILPTLKKSRKYGGVMLWSKFWDDKNGYSSSILASV
cellular response to water deprivation chitin catabolic process pattern recognition receptor signaling pathway polysaccharide catabolic process response to cold response to light intensity response to salt stress response to wounding extracellular region beta-glucosidase activity chitinase activity lysozyme activity Ar...
muscle cell differentiation negative regulation of axon extension negative regulation of collateral sprouting positive regulation of transcription by RNA polymerase II skeletal muscle tissue regeneration striated muscle tissue development
cytoplasm; nucleus; sarcoplasm
RNA polymerase II-specific DNA-binding transcription factor binding
Mus musculus
Developmental protein Differentiation Reference proteome
MPKNKKRNAP
MPKNKKRNAPHRGGGGGGGSGAATSAATAGGPHRTVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGLKNALSSKVLYEFVLERRMTLTDSIERCLKKGKSDEQRAAAAVASVLCIQLGPGFESEEILKTLGPILKKIICDGAASIQARQTCATCFGVCCFIATDDITELYSTLECFENIFTKSYLKEKDTNVTCSTPNTVLHISSLLAWTLLLTICPINEVKKKLELHFHKLPSLLSCDDVNMRIAAGESLALLFELARGMESDFFYEDMDSLTQMLRALATD...
muscle cell differentiation negative regulation of axon extension negative regulation of collateral sprouting positive regulation of transcription by RNA polymerase II skeletal muscle tissue regeneration striated muscle tissue development cytoplasm; nucleus; sarcoplasm RNA polymerase II-specific DNA-binding transcripti...
positive regulation of translational elongation positive regulation of translational termination translational elongation translational frameshifting
cytosolic ribosome
ribosome binding RNA binding translation elongation factor activity
Saccharomyces cerevisiae
Acetylation Cytoplasm Elongation factor Hypusine Isopeptide bond Phosphoprotein Protein biosynthesis Reference proteome RNA-binding Ubl conjugation
MSDEEHTFEN
MSDEEHTFENADAGASATYPMQCSALRKNGFVVIKGRPCKIVDMSTSKTGKHGHAKVHLVTLDIFTGKKLEDLSPSTHNLEVPFVKRSEYQLLDIDDGYLSLMTMDGETKDDVKAPEGELGDSMQAAFDEGKDLMVTIISAMGEEAAISFKEAPRSD
positive regulation of translational elongation positive regulation of translational termination translational elongation translational frameshifting cytosolic ribosome ribosome binding RNA binding translation elongation factor activity Saccharomyces cerevisiae Acetylation Cytoplasm Elongation factor Hypusine Isopepti...
estrogen metabolic process sulfation
cytoplasm; cytosol
aryl sulfotransferase activity estrone sulfotransferase activity steroid binding steroid sulfotransferase activity
Bos taurus
Cytoplasm Direct protein sequencing Lipid metabolism Lipid-binding Phosphoprotein Reference proteome Steroid-binding Transferase
MSSSKPSFSD
MSSSKPSFSDYFGKLGGIPMYKKFIEQFHNVEEFEARPDDLVIVTYPKSGTTWLSEIICMIYNNGDVEKCKEDVIFNRVPYLECSTEHVMKGVKQLNEMASPRIVKSHLPVKLLPVSFWEKNCKIIYLSRNAKDVVVSYYFLILMVTAIPDPDSFQDFVEKFMDGEVPYGSWFEHTKSWWEKSKNPQVLFLFYEDMKENIRKEVMKLLEFLGRKASDELVDKIIKHTSFQEMKNNPSTNYTTLPDEVMNQKVSPFMRKGDVGDWKNHFTVALNEKFDMHYEQQMKGSTLKFRTKI
estrogen metabolic process sulfation cytoplasm; cytosol aryl sulfotransferase activity estrone sulfotransferase activity steroid binding steroid sulfotransferase activity Bos taurus Cytoplasm Direct protein sequencing Lipid metabolism Lipid-binding Phosphoprotein Reference proteome Steroid-binding Transferase MSSSKPSFS...
antigen transcytosis by M cells in mucosal-associated lymphoid tissue establishment of localization in cell innate immune response neutrophil migration
apical plasma membrane; cell surface; endosome; external side of plasma membrane; extracellular space; membrane raft; zymogen granule membrane
antigen binding
Rattus norvegicus
Cell membrane Cytoplasmic vesicle Direct protein sequencing Disulfide bond EGF-like domain Endosome Glycoprotein GPI-anchor Immunity Innate immunity Lipoprotein Membrane Receptor Reference proteome Secreted Signal
MVACDLLWLA
MVACDLLWLAAASCLLTLVFPSTTHQGYGNPRNTSNVDLDCGAPGSSSAGICFDPCQNHTVLNDPSRSTENTVSSEECDSHLRGWYRFVGDGGVKMPETCVNVYRCHTYAPMWLSGSHPILGDGIVNRTACANWNENCCFWSSEVQVKACLGESGEYHVYKLQGTPECSLRYCTDPSTAPKKCEIACRPEEECVFQNNSWTCVCRQDLNVSDTLSLQPLLDCGANEIKVKLDKCLLGGLGFKEDIITYLNDRNCRGTMKDEPNNWVSTTSPVVANDCGNILENNGTQAIYRNTLSLATDFIIRDFLVNVNFQCAYPLDMN...
antigen transcytosis by M cells in mucosal-associated lymphoid tissue establishment of localization in cell innate immune response neutrophil migration apical plasma membrane; cell surface; endosome; external side of plasma membrane; extracellular space; membrane raft; zymogen granule membrane antigen binding Rattus no...
cellular glucuronidation negative regulation of cellular glucuronidation negative regulation of fatty acid metabolic process negative regulation of glucuronosyltransferase activity xenobiotic metabolic process
endoplasmic reticulum; endoplasmic reticulum membrane; intracellular membrane-bounded organelle
enzyme binding glucuronosyltransferase activity protein heterodimerization activity protein homodimerization activity
Homo sapiens
Alternative splicing Endoplasmic reticulum Glycoprotein Glycosyltransferase Membrane Microsome Reference proteome Signal Transferase Transmembrane Transmembrane helix
MACLLRSFQR
MACLLRSFQRISAGVFFLALWGMVVGDKLLVVPQDGSHWLSMKDIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLYFINCQSLLQDRDTLNFFKESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEHTFSRSPDPVSYIPRCYTKFSDHMTFSQRVANFLVNLLEPYLFYCLFSKYEELASAVLKRDVDIITLYQKVSVWLLRYDFVLEYPRPVMPNMVFIGGINCKKRKDLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMA...
cellular glucuronidation negative regulation of cellular glucuronidation negative regulation of fatty acid metabolic process negative regulation of glucuronosyltransferase activity xenobiotic metabolic process endoplasmic reticulum; endoplasmic reticulum membrane; intracellular membrane-bounded organelle enzyme binding...
brain development cytokine-mediated signaling pathway decidualization heart development hemopoiesis positive regulation of cell population proliferation signal transduction
external side of plasma membrane; extracellular region; nuclear speck; plasma membrane
erythropoietin receptor activity identical protein binding
Homo sapiens
3D-structure Alternative splicing Cell membrane Congenital erythrocytosis Disease variant Disulfide bond Glycoprotein Isopeptide bond Membrane Phosphoprotein Receptor Reference proteome Secreted Signal Transmembrane Transmembrane helix Ubl conjugation
MDHLGASLWP
MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTHKGNFQLWLYQNDGCLWWSPC...
brain development cytokine-mediated signaling pathway decidualization heart development hemopoiesis positive regulation of cell population proliferation signal transduction external side of plasma membrane; extracellular region; nuclear speck; plasma membrane erythropoietin receptor activity identical protein binding H...
proteolysis
cytoplasm; extracellular space
serine-type endopeptidase activity
Canis lupus familiaris
Cytoplasm Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Protease Reference proteome Serine protease Signal Zymogen
MLWLLVLTAP
MLWLLVLTAPWLGGSVPISPDPGLRHEQVGIVGGCKVPARRYPWQVSLRFHGMGSGQWQHICGGSLIHPQWVLTAAHCVELEGLEAATLRVQVGQLRLYDHDQLCNVTEIIRHPNFNMSWYGWDSADIALLKLEAPLTLSEDVNLVSLPSPSLIVPPGMLCWVTGWGDIADHTPLPPPYHLQEVEVPIVGNRECNCHYQTILEQDDEVIKQDMLCAGSEGHDSCQMDSGGPLVCRWKCTWIQVGVVSWGYGCGYNLPGVYARVTSYVSWIHQHIPLSPGP
proteolysis cytoplasm; extracellular space serine-type endopeptidase activity Canis lupus familiaris Cytoplasm Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Protease Reference proteome Serine protease Signal Zymogen MLWLLVLTAP MLWLLVLTAPWLGGSVPISPDPGLRHEQVGIVGGCKVPARRYPWQVSLRFHGMGSGQWQHICGGSLIHPQWVLT...
cardiac muscle contraction regulation of striated muscle contraction skeletal muscle contraction transition between fast and slow fiber ventricular cardiac muscle tissue morphogenesis
cytosol; troponin complex
actin binding
Homo sapiens
Acetylation Actin-binding Muscle protein Phosphoprotein Reference proteome
MPEVERKPKI
MPEVERKPKITASRKLLLKSLMLAKAKECWEQEHEEREAEKVRYLAERIPTLQTRGLSLSALQDLCRELHAKVEVVDEERYDIEAKCLHNTREIKDLKLKVMDLRGKFKRPPLRRVRVSADAMLRALLGSKHKVSMDLRANLKSVKKEDTEKERPVEVGDWRKNVEAMSGMEGRKKMFDAAKSPTSQ
cardiac muscle contraction regulation of striated muscle contraction skeletal muscle contraction transition between fast and slow fiber ventricular cardiac muscle tissue morphogenesis cytosol; troponin complex actin binding Homo sapiens Acetylation Actin-binding Muscle protein Phosphoprotein Reference proteome MPEVERKP...
fusion of virus membrane with host endosome membrane receptor-mediated endocytosis of virus by host cell virion attachment to host cell
host cell endoplasmic reticulum membrane; host cell Golgi membrane; host cell plasma membrane; membrane; viral envelope; virion membrane
metal ion binding
Mopeia virus
Disulfide bond Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Host cell membrane Host endoplasmic reticulum Host Golgi apparatus Host membrane Host-virus interaction Lipoprotein Membrane Metal-binding Myristate Transmembrane Transmembrane helix Viral attac...
MGQIVTFFQE
MGQIVTFFQEVPHILEEVMNIVLMTLSILAILKGIYNVMTCGIIGLITFLFLCGRSCSSIYKDNYEFFSLDLDMSSLNATMPLSCSKNNSHHYIQVGNETGLELTLTNTSIINHKFCNLSDAHRRNLYDKALMSILTTFHLSIPDFNQYEAMSCDFNGGKISVQYNLSHSNYVDAGNHCGTIANGIMDVFRRMYWSTSLSVASDISGTQCIQTDYKYLIIQNTSWEDHCMFSRPSPMGFLSLLSQRTRNFYISRRLLGLFTWTLSDSEGNDMPGGYCLTRSMLIGLDLKCFGNTAIAKCNQAHDEEFCDMLRLFDFNKQA...
fusion of virus membrane with host endosome membrane receptor-mediated endocytosis of virus by host cell virion attachment to host cell host cell endoplasmic reticulum membrane; host cell Golgi membrane; host cell plasma membrane; membrane; viral envelope; virion membrane metal ion binding Mopeia virus Disulfide bond F...
cellular response to type II interferon cytoplasmic translation homeostatic process lung morphogenesis macrophage chemotaxis negative regulation of formation of translation preinitiation complex negative regulation of translation response to lipopolysaccharide translation at postsynapse translation at presynapse
cytoplasm; cytosol; cytosolic large ribosomal subunit; cytosolic ribosome; GAIT complex; postsynapse; presynapse; ribonucleoprotein complex; ribosome; synapse
mRNA binding structural constituent of ribosome
Mus musculus
3D-structure Acetylation Citrullination Cytoplasm Direct protein sequencing Phosphoprotein Reference proteome Ribonucleoprotein Ribosomal protein Translation regulation Tumor antigen
MAEGQVLVLD
MAEGQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQILRLRKQAEKNVEKKICKFTEVLKTNGLLV
cellular response to type II interferon cytoplasmic translation homeostatic process lung morphogenesis macrophage chemotaxis negative regulation of formation of translation preinitiation complex negative regulation of translation response to lipopolysaccharide translation at postsynapse translation at presynapse cytopl...
cell-cell adhesion cellular response to tumor necrosis factor cellular response to type II interferon heterotypic cell-cell adhesion positive regulation of interleukin-8 production
cell surface; extracellular exosome; ficolin-1-rich granule membrane; membrane; plasma membrane; secretory granule membrane
signaling receptor binding
Homo sapiens
3D-structure Alternative splicing Cell membrane Direct protein sequencing Disulfide bond Glycoprotein Immunoglobulin domain Membrane Reference proteome Signal Transmembrane Transmembrane helix
MVAGSDAGRA
MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN
cell-cell adhesion cellular response to tumor necrosis factor cellular response to type II interferon heterotypic cell-cell adhesion positive regulation of interleukin-8 production cell surface; extracellular exosome; ficolin-1-rich granule membrane; membrane; plasma membrane; secretory granule membrane signaling recep...
cellular response to reactive oxygen species glomerular basement membrane development homeostatic process inner ear development mitochondrial genome maintenance reactive oxygen species metabolic process regulation of mitochondrial DNA metabolic process regulation of reactive oxygen species metabolic process
cytoplasm; mitochondrial inner membrane; mitochondrion; peroxisome
channel activity
Mus musculus
Deafness Membrane Mitochondrion Mitochondrion inner membrane Reference proteome Transmembrane Transmembrane helix
MALWRAYQRA
MALWRAYQRALAAHPWKVQVLTAGSLMGVGDMISQQLVERRGLQQHQAGRTLTMVSLGCGFVGPVVGGWYKVLDHLIPGTTKVHALKKMLLDQGGFAPCFLGCFLPLVGILNGMSAQDNWAKLKRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAIVWNSYLSWKAHQF
cellular response to reactive oxygen species glomerular basement membrane development homeostatic process inner ear development mitochondrial genome maintenance reactive oxygen species metabolic process regulation of mitochondrial DNA metabolic process regulation of reactive oxygen species metabolic process cytoplasm; ...
2-oxoglutarate metabolic process L-lysine catabolic process to acetyl-CoA via saccharopine tricarboxylic acid cycle
mitochondrial alpha-ketoglutarate dehydrogenase complex; mitochondrial nucleoid; mitochondrial oxoglutarate dehydrogenase complex; mitochondrion
dihydrolipoyllysine-residue succinyltransferase activity
Saccharomyces cerevisiae
Acyltransferase Lipoyl Mitochondrion Phosphoprotein Reference proteome Repeat Transferase Transit peptide Tricarboxylic acid cycle
MLSRATRTAA
MLSRATRTAAAKSLVKSKVARNVMAASFVKRHASTSLFKQANKVESLGSIYLSGKKISVAANPFSITSNRFKSTSIEVPPMAESLTEGSLKEYTKNVGDFIKEDELLATIETDKIDIEVNSPVSGTVTKLNFKPEDTVTVGEELAQVEPGEAPAEGSGESKPEPTEQAEPSQGVAARENSSEETASKKEAAPKKEAAPKKEVTEPKKADQPKKTVSKAQEPPVASNSFTPFPRTETRVKMNRMRLRIAERLKESQNTAASLTTFNEVDMSALMEMRKLYKDEIIKKTGTKFGFMGLFSKACTLAAKDIPAVNGAIEGDQI...
2-oxoglutarate metabolic process L-lysine catabolic process to acetyl-CoA via saccharopine tricarboxylic acid cycle mitochondrial alpha-ketoglutarate dehydrogenase complex; mitochondrial nucleoid; mitochondrial oxoglutarate dehydrogenase complex; mitochondrion dihydrolipoyllysine-residue succinyltransferase activity Sa...
amino acid metabolic process ethanolamine catabolic process
cytosol; ethanolamine ammonia-lyase complex; ethanolamine degradation polyhedral organelle
cobalamin binding ethanolamine ammonia-lyase activity
Salmonella typhimurium
Bacterial microcompartment Cobalamin Cobalt Lyase Reference proteome Virulence
MKLKTTLFGN
MKLKTTLFGNVYQFKDVKEVLAKANELRSGDVLAGVAAASSQERVAAKQVLSEMTVADIRNNPVIAYEEDCVTRLIQDDVNETAYNRIKNWSISELREYVLSDETSVDDIAFTRKGLTSEVVAAVAKICSNADLIYGGKKMPVIKKANTTIGIPGTFSCRLQPNDTRDDVQSIAAQIYEGLSFGAGDAVIGVNPVTDDVENLTRVLDTVYGVIDKFNIPTQGCVLAHVTTQIEAIRRGAPGGLIFQSICGSEKGLKEFGVELAMLDEARAVGAEFNRIAGENCLYFETGQGSALSAGANFGADQVTMEARNYGLARHYDP...
amino acid metabolic process ethanolamine catabolic process cytosol; ethanolamine ammonia-lyase complex; ethanolamine degradation polyhedral organelle cobalamin binding ethanolamine ammonia-lyase activity Salmonella typhimurium Bacterial microcompartment Cobalamin Cobalt Lyase Reference proteome Virulence MKLKTTLFGN MK...
amino acid metabolic process ethanolamine catabolic process
ethanolamine ammonia-lyase complex; ethanolamine degradation polyhedral organelle
cobalamin binding ethanolamine ammonia-lyase activity
Salmonella typhimurium
Bacterial microcompartment Cobalamin Cobalt Lyase Reference proteome Virulence
MDQKQIEEIV
MDQKQIEEIVRSVMASMGQDVPQPAAPSTQEGAKPQCAAPTVTESCALDLGSAEAKAWIGVENPHRADVLTELRRSTAARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLSPEAIDALKSQCVMNPDVQVVVSDGLSTDAITANYEEILPPLLAGLKQAGLNVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRVATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR
amino acid metabolic process ethanolamine catabolic process ethanolamine ammonia-lyase complex; ethanolamine degradation polyhedral organelle cobalamin binding ethanolamine ammonia-lyase activity Salmonella typhimurium Bacterial microcompartment Cobalamin Cobalt Lyase Reference proteome Virulence MDQKQIEEIV MDQKQIEEIVR...
DNA topological change protein homooligomerization
chromosome; cytoplasm
double-stranded DNA binding protein heterodimerization activity protein homodimerization activity
Methanothermus fervidus
3D-structure Chromosome Cytoplasm Direct protein sequencing DNA-binding
MELPIAPIGR
MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFKK
DNA topological change protein homooligomerization chromosome; cytoplasm double-stranded DNA binding protein heterodimerization activity protein homodimerization activity Methanothermus fervidus3D-structure Chromosome Cytoplasm Direct protein sequencing DNA-binding MELPIAPIGR MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEA...
cell development cell killing negative regulation of cell population proliferation response to axon injury response to chromate response to hormone response to organic cyclic compound response to protozoan response to xenobiotic stimulus salivary gland development
cytoplasm; extracellular space; secretory granule; vesicle
cysteine-type endopeptidase inhibitor activity protease binding
Rattus norvegicus
Direct protein sequencing Disulfide bond Protease inhibitor Reference proteome Secreted Signal Thiol protease inhibitor
MAYLLHAQLF
MAYLLHAQLFLLTTFILVLNMRLCPVLGHFLGGIEKSSMEEEGASEALNYAVNEYNEKNSDLYLSRVVEVKDVQKQVVAGTKFFFDVILGKTICLKTQGDLTNCPLNEEADQQEHEFCSFVVHDIPWENYIVLLSSSCHSI
cell development cell killing negative regulation of cell population proliferation response to axon injury response to chromate response to hormone response to organic cyclic compound response to protozoan response to xenobiotic stimulus salivary gland development cytoplasm; extracellular space; secretory granule; vesi...
anaerobic electron transport chain anaerobic respiration DNA damage response nitrate assimilation nitrate metabolic process
membrane; nitrate reductase complex; plasma membrane
3 iron, 4 sulfur cluster binding 4 iron, 4 sulfur cluster binding electron transfer activity iron-sulfur cluster binding metal ion binding nitrate reductase activity
Escherichia coli
3Fe-4S 4Fe-4S Cell membrane Direct protein sequencing Electron transport Iron Iron-sulfur Membrane Metal-binding Nitrate assimilation Oxidoreductase Reference proteome Repeat Transport
MKIRSQVGMV
MKIRSQVGMVLNLDKCIGCHTCSVTCKNVWTGREGMEYAWFNNVETKPGIGYPKNWEDQEEWQGGWVRDVNGKIRPRLGNKMGVITKIFANPVVPQIDDYYEPFTFDYEHLHSAPEGKHIPTARPRSLIDGKRMDKVIWGPNWEELLGGEFEKRARDRNFEAMQKEMYGQFENTFMMYLPRLCEHCLNPSCVATCPSGAIYKREEDGIVLIDQDKCRGWRLCISGCPYKKIYFNWKSGKSEKCIFCYPRIESGQPTVCSETCVGRIRYLGVLLYDADRIEEAASTEREVDLYERQCEVFLDPHDPSVIEEALKQGIPQNV...
anaerobic electron transport chain anaerobic respiration DNA damage response nitrate assimilation nitrate metabolic process membrane; nitrate reductase complex; plasma membrane 3 iron, 4 sulfur cluster binding 4 iron, 4 sulfur cluster binding electron transfer activity iron-sulfur cluster binding metal ion binding nitr...
amine metabolic process B cell differentiation calcium-mediated signaling using intracellular calcium source cardiac neuron differentiation cell adhesion cell chemotaxis cell-cell adhesion in response to extracellular stimulus cell-matrix adhesion cellular response to amyloid-beta cellular response to tumor necrosis fa...
alpha9-beta1 integrin-vascular cell adhesion molecule-1 complex; apical part of cell; cell surface; early endosome; endoplasmic reticulum; external side of plasma membrane; extracellular exosome; extracellular space; filopodium; Golgi apparatus; microvillus; plasma membrane; podosome; sarcolemma
cell adhesion mediator activity cell adhesion molecule binding integrin binding primary amine oxidase activity
Homo sapiens
3D-structure Alternative splicing Cell adhesion Cell membrane Direct protein sequencing Disulfide bond Glycoprotein Immunoglobulin domain Membrane Reference proteome Repeat Secreted Signal Transmembrane Transmembrane helix Ubl conjugation
MPGKMVVILG
MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKNRKEVELIVQEKPFTVEISPG...
amine metabolic process B cell differentiation calcium-mediated signaling using intracellular calcium source cardiac neuron differentiation cell adhesion cell chemotaxis cell-cell adhesion in response to extracellular stimulus cell-matrix adhesion cellular response to amyloid-beta cellular response to tumor necrosis fa...
chondrocyte development involved in endochondral bone morphogenesis collagen biosynthetic process collagen fibril organization protein maturation
collagen-containing extracellular matrix; cytoplasm; endoplasmic reticulum; endoplasmic reticulum lumen; endoplasmic reticulum-Golgi intermediate compartment; extracellular space; membrane raft
collagen binding serine-type endopeptidase inhibitor activity unfolded protein binding
Mus musculus
Acetylation Chaperone Direct protein sequencing Endoplasmic reticulum Glycoprotein Phosphoprotein Reference proteome Signal Stress response
MRSLLLGTLC
MRSLLLGTLCLLAVALAAEVKKPLEAAAPGTAEKLSSKATTLAERSTGLAFSLYQAMAKDQAVENILLSPLVVASSLGLVSLGGKATTASQAKAVLSAEKLRDEEVHTGLGELLRSLSNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWASQTTDGKLPEVTKDVERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVTMMHRTGLYNYYDDEKEKLQMVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKAWMGKMQKKAVAISLPKGVVEVTHDLQKHL...
chondrocyte development involved in endochondral bone morphogenesis collagen biosynthetic process collagen fibril organization protein maturation collagen-containing extracellular matrix; cytoplasm; endoplasmic reticulum; endoplasmic reticulum lumen; endoplasmic reticulum-Golgi intermediate compartment; extracellular s...
adenylate cyclase-inhibiting serotonin receptor signaling pathway behavioral fear response chemical synaptic transmission exploration behavior G protein-coupled receptor signaling pathway G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger G protein-coupled serotonin receptor sig...
axon hillock; dendrite; GABA-ergic synapse; neuronal cell body; plasma membrane; presynaptic membrane
G protein-coupled serotonin receptor activity G-protein alpha-subunit binding neurotransmitter receptor activity receptor-receptor interaction serotonin binding signaling receptor binding
Rattus norvegicus
Behavior Cell membrane Cell projection Disulfide bond G-protein coupled receptor Glycoprotein Membrane Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MDVFSFGQGN
MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGTSLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGNSKEHLPLPSESGSNSYAPAC...
adenylate cyclase-inhibiting serotonin receptor signaling pathway behavioral fear response chemical synaptic transmission exploration behavior G protein-coupled receptor signaling pathway G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger G protein-coupled serotonin receptor sig...
adenylate cyclase-activating adrenergic receptor signaling pathway adrenergic receptor signaling pathway angiogenesis female pregnancy G protein-coupled receptor signaling pathway MAPK cascade platelet activation positive regulation of blood pressure positive regulation of MAPK cascade positive regulation of neuron dif...
cell surface; cytosol; intracellular membrane-bounded organelle; plasma membrane
adrenergic receptor activity alpha2-adrenergic receptor activity epinephrine binding
Rattus norvegicus
Cell membrane Disulfide bond G-protein coupled receptor Lipoprotein Membrane Palmitate Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MSGPTMDHQE
MSGPTMDHQEPYSVQATAAIASAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFWRAWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQRPEPRGLPQCELNQEAWYILASSIGSFFAPCLIMILVYLRIYVIAKRSHCRGLGAKRGSGEGESKKPQPVAGGVPTSAKVPTLVSPLSSVGEANGHPKPPREKEEGETPEDPEARALPPTWSALPRSGQGQKKGTSGATAEEGDEEDEEEVEECEPQTLPA...
adenylate cyclase-activating adrenergic receptor signaling pathway adrenergic receptor signaling pathway angiogenesis female pregnancy G protein-coupled receptor signaling pathway MAPK cascade platelet activation positive regulation of blood pressure positive regulation of MAPK cascade positive regulation of neuron dif...
muscle tissue morphogenesis negative regulation of DNA-templated transcription positive regulation of DNA-templated transcription positive regulation of myoblast differentiation positive regulation of skeletal muscle fiber development regulation of transcription by RNA polymerase II skeletal muscle cell differentiation...
nucleus
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity, RNA polymerase II-specific protein dimerization activity RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific double-stranded DNA binding
Rattus norvegicus
Developmental protein Differentiation DNA-binding Myogenesis Nucleus Reference proteome
MMMDLFETGS
MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPQEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAINYIERLQDLLHRLDQQEKMQELGVDPYSYKPKQEILEGADFLRTCSPQWPSVSDHSRGLVITAKEGGASVDASASSSLQRLSSIVDSISSEERKLPSVEEVVEK
muscle tissue morphogenesis negative regulation of DNA-templated transcription positive regulation of DNA-templated transcription positive regulation of myoblast differentiation positive regulation of skeletal muscle fiber development regulation of transcription by RNA polymerase II skeletal muscle cell differentiation...
apoptotic process involved in heart morphogenesis atrial septum morphogenesis atrioventricular valve morphogenesis cell-cell adhesion chondroblast differentiation extracellular matrix organization intussusceptive angiogenesis negative regulation of apoptotic process osteoblast differentiation positive regulation of apo...
extracellular region
extracellular matrix binding growth factor binding integrin binding
Gallus gallus
Disulfide bond Growth factor binding Phosphoprotein Reference proteome Secreted Signal
MGSAGARPAL
MGSAGARPALAAALLCLARLALGSPCPAVCQCPAAAPQCAPGVGLVPDGCGCCKVCAKQLNEDCSRTQPCDHTKGLECNFGASPAATNGICRAQSEGRPCEYNSKIYQNGESFQPNCKHQCTCIDGAVGCIPLCPQELSLPNLGCPSPRLVKVPGQCCEEWVCDESKDALEELEGFFSKEFGLDASEGELTRNNELIAIVKGGLKMLPVFGSEPQSRAFENPKCIVQTTSWSQCSKTCGTGISTRVTNDNPDCKLIKETRICEVRPCGQPSYASLKKGKKCTKTKKSPSPVRFTYAGCSSVKKYRPKYCGSCVDGRCCTP...
apoptotic process involved in heart morphogenesis atrial septum morphogenesis atrioventricular valve morphogenesis cell-cell adhesion chondroblast differentiation extracellular matrix organization intussusceptive angiogenesis negative regulation of apoptotic process osteoblast differentiation positive regulation of apo...
bile acid biosynthetic process bile acid catabolic process bile acid metabolic process protein homotetramerization response to bile acid
cytoplasm
3alpha-hydroxy bile acid-CoA-ester 3-dehydrogenase activity bile acid binding NAD+ binding oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
Clostridium scindens
3D-structure Lipid metabolism NAD Oxidoreductase Steroid metabolism
MNLVQDKVTI
MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLKELYPEEEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTGIFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNPPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGAYRP
bile acid biosynthetic process bile acid catabolic process bile acid metabolic process protein homotetramerization response to bile acid cytoplasm 3alpha-hydroxy bile acid-CoA-ester 3-dehydrogenase activity bile acid binding NAD+ binding oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as accep...
angiogenesis cellular response to epidermal growth factor stimulus cellular response to leukemia inhibitory factor negative regulation of insulin receptor signaling pathway negative regulation of translation positive regulation of mRNA splicing, via spliceosome positive regulation of transcription by RNA polymerase II ...
cell cortex; chromosome; cornified envelope; cytoplasmic ribonucleoprotein granule; extracellular exosome; membrane; nucleolus; nucleoplasm; nucleus; ribonucleoprotein complex; spliceosomal complex
DNA topoisomerase binding identical protein binding insulin receptor substrate binding mRNA 5'-UTR binding PH domain binding RNA binding telomeric DNA binding
Homo sapiens
3D-structure Acetylation Cytoplasm Direct protein sequencing DNA-binding Isopeptide bond Methylation Nucleus Phosphoprotein Reference proteome Repeat RNA-binding Ubl conjugation
MVKLAKAGKN
MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSA...
angiogenesis cellular response to epidermal growth factor stimulus cellular response to leukemia inhibitory factor negative regulation of insulin receptor signaling pathway negative regulation of translation positive regulation of mRNA splicing, via spliceosome positive regulation of transcription by RNA polymerase II ...
alternative mRNA splicing, via spliceosome epithelium regeneration female germ-line sex determination female sex determination germarium-derived cystoblast division imaginal disc growth negative regulation of mRNA splicing, via spliceosome negative regulation of receptor signaling pathway via JAK-STAT negative regulati...
cytoplasm; cytosol; messenger ribonucleoprotein complex; nucleus; protein-containing complex; ribonucleoprotein complex
molecular adaptor activity mRNA 3'-UTR binding mRNA 5'-UTR binding mRNA regulatory element binding translation repressor activity poly(A) binding poly(U) RNA binding poly-pyrimidine tract binding pre-mRNA binding RNA binding
Drosophila melanogaster
3D-structure Alternative splicing Differentiation Reference proteome Repeat RNA-binding Sexual differentiation Transcription Transcription regulation
MYGNNNPGSN
MYGNNNPGSNNNNGGYPPYGYNNKSSGGRGFGMSHSLPSGMSRYAFSPQDTEFSFPSSSSRRGYNDFPGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQMGVVPANVPPPPPQPPA...
alternative mRNA splicing, via spliceosome epithelium regeneration female germ-line sex determination female sex determination germarium-derived cystoblast division imaginal disc growth negative regulation of mRNA splicing, via spliceosome negative regulation of receptor signaling pathway via JAK-STAT negative regulati...
intracellular calcium ion homeostasis mesoderm development mitochondrion organization muscle cell cellular homeostasis muscle contraction muscle organ morphogenesis muscle thin filament assembly myofibril assembly regulation of cardiac muscle contraction by calcium ion signaling sarcomere organization
striated muscle thin filament; troponin complex
calcium ion binding tropomyosin binding
Drosophila melanogaster
Alternative splicing Muscle protein Reference proteome
MSDDEEYTSS
MSDDEEYTSSEEEEVVEETREETKPPQTPAEGEGDPEFIKRQDQKRSDLDDQLKEYITEWRKQRSKEEDELKKLKEKQAKRKVTRAEEEQKMAQRKKEEEERRVREAEEKKQREIEEKRMRLEEAEKKRQAMLQAMKDKDKKGPNFTIAKKDAGVLGLSSAAMERNKTKEQLEEEKKISLSFRIKPLAIEGFGEAKLREKAQELWELIVKLETEKYDLEERQKRQDYDLKELKERQKQQLRHKALKKGLDPEALTGKYPPKIQVASKYERRVDTRSYDDKKKLFEGGWDEISKDSNEKIWNEKKEQYTGRQKSKLPKWFG...
intracellular calcium ion homeostasis mesoderm development mitochondrion organization muscle cell cellular homeostasis muscle contraction muscle organ morphogenesis muscle thin filament assembly myofibril assembly regulation of cardiac muscle contraction by calcium ion signaling sarcomere organization striated muscle t...
animal organ regeneration astrocyte differentiation cellular response to amine stimulus cellular response to antibiotic cellular response to arsenic-containing substance cellular response to cytokine stimulus cellular response to dexamethasone stimulus cellular response to lead ion heme A biosynthetic process heme B bi...
axon; cytoplasm; cytosol; perinuclear region of cytoplasm
amine binding carboxylic acid binding hydroxymethylbilane synthase activity uroporphyrinogen-III synthase activity
Rattus norvegicus
Acetylation Alternative splicing Heme biosynthesis Phosphoprotein Porphyrin biosynthesis Reference proteome Transferase
MSGNGGAATT
MSGNGGAATTAEENGSMMRVIRVGTRKSQLARIQTDTVVAMLKTLYPGIQFEIIAMSTTGDKILDTALSKIGEKSLFTKELENALEKNEVDLVVHSLKDVPTILPPGFTIGAICKRENPCDAVVFHPKFIGKTLETLPEKSAVGTSSLRRVAQLQRKFPHLEFKSIRGNLNTRLRKLDEQLEFSAIILAVAGLQRMGWQNRVGQILHPEECMYAVGQGALAVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTVMKDGQLYLTGGVWSLDGSDSMQETMQATIQVPVQQEDGPEDDPQLVGITA...
animal organ regeneration astrocyte differentiation cellular response to amine stimulus cellular response to antibiotic cellular response to arsenic-containing substance cellular response to cytokine stimulus cellular response to dexamethasone stimulus cellular response to lead ion heme A biosynthetic process heme B bi...
amylopectin biosynthetic process brown fat cell differentiation cellular response to hypoxia cellular response to insulin stimulus cellular response to osmotic stress cellular response to tumor necrosis factor dehydroascorbic acid transport glucose homeostasis glucose import glucose import in response to insulin stimul...
cell surface; clathrin-coated pit; clathrin-coated vesicle; cytoplasm; cytoplasmic vesicle membrane; cytosol; endomembrane system; endosome; external side of plasma membrane; extracellular exosome; insulin-responsive compartment; membrane; membrane raft; multivesicular body; perinuclear region of cytoplasm; plasma memb...
D-glucose transmembrane transporter activity glucose transmembrane transporter activity glucose uniporter activity
Rattus norvegicus
Cell membrane Cytoplasm Glycoprotein Lipoprotein Membrane Palmitate Phosphoprotein Reference proteome Sugar transport Transmembrane Transmembrane helix Transport Ubl conjugation
MPSGFQQIGS
MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNATWLGRQGPGGPDSIPQGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLANNVLAVLGGALMGLANAAASYEILILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILVAQVLGLESMLGTATLWPLLLAITVLPALLQLLLLPFCPESPRYLYIIRNLEGPARKSLKRLTGWADVSDALAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFELAGVE...
amylopectin biosynthetic process brown fat cell differentiation cellular response to hypoxia cellular response to insulin stimulus cellular response to osmotic stress cellular response to tumor necrosis factor dehydroascorbic acid transport glucose homeostasis glucose import glucose import in response to insulin stimul...
methionine metabolic process one-carbon metabolic process S-adenosylmethionine biosynthetic process
cytoplasmic stress granule; cytosol
ATP binding metal ion binding methionine adenosyltransferase activity
Saccharomyces cerevisiae
Acetylation ATP-binding Magnesium Metal-binding Nucleotide-binding One-carbon metabolism Potassium Reference proteome Transferase
MSKSKTFLFT
MSKSKTFLFTSESVGEGHPDKICDQVSDAILDACLEQDPFSKVACETAAKTGMIMVFGEITTKARLDYQQIVRDTIKKIGYDDSAKGFDYKTCNVLVAIEQQSPDIAQGLHYEKSLEDLGAGDQGIMFGYATDETPEGLPLTILLAHKLNMAMADARRDGSLPWLRPDTKTQVTVEYEDDNGRWVPKRIDTVVISAQHADEISTADLRTQLQKDIVEKVIPKDMLDENTKYFIQPSGRFVIGGPQGDAGLTGRKIIVDAYGGASSVGGGAFSGKDYSKVDRSAAYAARWVAKSLVAAGLCKRVQVQFSYAIGIAEPLSLH...
methionine metabolic process one-carbon metabolic process S-adenosylmethionine biosynthetic process cytoplasmic stress granule; cytosol ATP binding metal ion binding methionine adenosyltransferase activity Saccharomyces cerevisiae Acetylation ATP-binding Magnesium Metal-binding Nucleotide-binding One-carbon metabolism...
cell differentiation chorionic trophoblast cell development in utero embryonic development negative regulation of Schwann cell proliferation negative regulation of T-helper 1 cell differentiation negative regulation of T-helper 17 cell differentiation negative regulation of T-helper 2 cell differentiation negative regu...
cytoplasm; nucleus; RNA polymerase II transcription regulator complex
bHLH transcription factor binding DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific DNA-binding transcription repressor activity, RNA polymerase II-specific E-box binding protein dimeri...
Rattus norvegicus
Cytoplasm Developmental protein Differentiation DNA-binding Neurogenesis Nucleus Reference proteome
MESHFNWYGV
MESHFNWYGVPRLQKASDACPRESCSSALPEAREGANVHFPPHPVPREHFSCGAPKPVAGAPALNASLMDGGALPRLVPTSSGVAGACTARRRPPSPELLRCSRRRRSGATEASSSSAAVARRNERERNRVKLVNLGFQALRQHVPHGGANKKLSKVETLRSAVEYIRALQRLLAEHDAVRAALSGGLLTPATRPSDVCTQPSASPASASLSCTSTSPDRLGCSEPASPRSAYSSEDSSCEGETYPMGQMFDFSNWLGGY
cell differentiation chorionic trophoblast cell development in utero embryonic development negative regulation of Schwann cell proliferation negative regulation of T-helper 1 cell differentiation negative regulation of T-helper 17 cell differentiation negative regulation of T-helper 2 cell differentiation negative regu...
defense response to fungus response to cold
chloroplast; chloroplast ATP synthase complex; chloroplast stroma; chloroplast thylakoid; chloroplast thylakoid membrane; plant-type cell wall; plastid; plastoglobule; proton-transporting ATP synthase complex, catalytic core F(1); stromule; thylakoid; thylakoid lumen
ATP binding ATP hydrolysis activity mRNA binding proton-transporting ATP synthase activity, rotational mechanism proton-transporting ATPase activity, rotational mechanism zinc ion binding
Arabidopsis thaliana
ATP synthesis ATP-binding CF(1) Chloroplast Hydrogen ion transport Ion transport Membrane Nucleotide-binding Phosphoprotein Plastid Reference proteome Thylakoid Translocase Transport
MRTNPTTSNP
MRTNPTTSNPEVSIREKKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTLGQEINVTCEVQQLLGNNRVRAVAMSATEGLKRGMDVVDMGNPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIELDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNLAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKKGS...
defense response to fungus response to cold chloroplast; chloroplast ATP synthase complex; chloroplast stroma; chloroplast thylakoid; chloroplast thylakoid membrane; plant-type cell wall; plastid; plastoglobule; proton-transporting ATP synthase complex, catalytic core F(1); stromule; thylakoid; thylakoid lumen ATP bind...
canonical glycolysis carbohydrate phosphorylation establishment of protein localization to mitochondrion fructose 6-phosphate metabolic process glucose 6-phosphate metabolic process glucose metabolic process glycolytic process inflammatory response innate immune response intracellular glucose homeostasis maintenance of...
cytosol; membrane raft; mitochondrial outer membrane; mitochondrion
ATP binding fructokinase activity glucokinase activity glucosamine kinase activity glucose binding hexokinase activity mannokinase activity peptidoglycan binding
Homo sapiens
3D-structure Acetylation Allosteric enzyme Alternative splicing ATP-binding Charcot-Marie-Tooth disease Cytoplasm Direct protein sequencing Disease variant Glycolysis Immunity Inflammatory response Innate immunity Intellectual disability Kinase Membrane Mitochondrion Mitochondrion outer membrane Neurodegeneration Neuro...
MIAAQLLAYY
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLF...
canonical glycolysis carbohydrate phosphorylation establishment of protein localization to mitochondrion fructose 6-phosphate metabolic process glucose 6-phosphate metabolic process glucose metabolic process glycolytic process inflammatory response innate immune response intracellular glucose homeostasis maintenance of...
clathrin coat disassembly mRNA processing negative regulation of DNA-templated transcription protein targeting to lysosome involved in chaperone-mediated autophagy RNA splicing
lysosomal membrane; melanosome; nucleolus; nucleus; plasma membrane; Prp19 complex; ribonucleoprotein complex; spliceosomal complex
ATP binding ATP-dependent protein folding chaperone hydrolase activity protein-macromolecule adaptor activity
Cricetulus griseus
Acetylation ATP-binding Autophagy Cell membrane Chaperone Cytoplasm Hydrolase Isopeptide bond Lysosome Membrane Methylation mRNA processing mRNA splicing Nucleotide-binding Nucleus Phosphoprotein Repressor Spliceosome Stress response Transcription Transcription regulation Ubl conjugation
MSKGPAVGID
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGEAKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRNDKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKA...
clathrin coat disassembly mRNA processing negative regulation of DNA-templated transcription protein targeting to lysosome involved in chaperone-mediated autophagy RNA splicing lysosomal membrane; melanosome; nucleolus; nucleus; plasma membrane; Prp19 complex; ribonucleoprotein complex; spliceosomal complex ATP binding...
negative regulation of DNA-templated transcription negative regulation of transcription by RNA polymerase II neural crest cell fate specification neural crest cell migration neural crest formation
nucleus
DNA binding metal ion binding
Xenopus laevis
Developmental protein DNA-binding Metal-binding Nucleus Reference proteome Repeat Ubl conjugation Zinc Zinc-finger
MPRSFLVKKH
MPRSFLVKKHFSASKKPNYSELESQTVYISPFIYDKFPVIPQPEILSTGAYYTPLVWDTGLLTTFFTSESDYKKSPISPSSSDDSSKPLDLTSFSSEDEGGKTSDPPSPASSATEAEKFQCNLCSKSYSTFAGLSKHKQLHCDSQTRKSFSCKYCEKEYVSLGALKMHIRSHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCTHCNRAFADRSNLRAHLQTHSDVKKYQCKSCSRTFSRMSLLHKHEETGCTVAH
negative regulation of DNA-templated transcription negative regulation of transcription by RNA polymerase II neural crest cell fate specification neural crest cell migration neural crest formation nucleus DNA binding metal ion binding Xenopus laevis Developmental protein DNA-binding Metal-binding Nucleus Reference prot...
transcription by RNA polymerase II
cytosol; nucleoplasm; nucleus; RNA polymerase II, core complex
DNA binding DNA-directed 5'-3' RNA polymerase activity protein dimerization activity
Homo sapiens
3D-structure Direct protein sequencing DNA-directed RNA polymerase Nucleus Phosphoprotein Reference proteome Transcription
MPYANQPTVR
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLISDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN
transcription by RNA polymerase II cytosol; nucleoplasm; nucleus; RNA polymerase II, core complex DNA binding DNA-directed 5'-3' RNA polymerase activity protein dimerization activity Homo sapiens 3D-structure Direct protein sequencing DNA-directed RNA polymerase Nucleus Phosphoprotein Reference proteome Transcription M...
protein stabilization transcription by RNA polymerase I transcription by RNA polymerase II transcription by RNA polymerase III
cytosol; nucleoplasm; nucleus; RNA polymerase I complex; RNA polymerase II, core complex; RNA polymerase III complex; RPAP3/R2TP/prefoldin-like complex
DNA binding DNA-directed 5'-3' RNA polymerase activity
Homo sapiens
3D-structure Acetylation Direct protein sequencing DNA-directed RNA polymerase Host-virus interaction Isopeptide bond Nucleus Reference proteome Transcription Ubl conjugation
MDDEEETYRL
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
protein stabilization transcription by RNA polymerase I transcription by RNA polymerase II transcription by RNA polymerase III cytosol; nucleoplasm; nucleus; RNA polymerase I complex; RNA polymerase II, core complex; RNA polymerase III complex; RPAP3/R2TP/prefoldin-like complex DNA binding DNA-directed 5'-3' RNA polyme...
positive regulation of myoblast fusion signal transduction
cell surface; cell-cell junction; extracellular exosome; immunological synapse; plasma membrane; specific granule membrane; tertiary granule membrane
identical protein binding
Homo sapiens
3D-structure Cell junction Cell membrane Glycoprotein Membrane Reference proteome Transmembrane Transmembrane helix
MGMSSLKLLK
MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL
positive regulation of myoblast fusion signal transduction cell surface; cell-cell junction; extracellular exosome; immunological synapse; plasma membrane; specific granule membrane; tertiary granule membrane identical protein binding Homo sapiens 3D-structure Cell junction Cell membrane Glycoprotein Membrane Reference...
neuropeptide signaling pathway
extracellular region
hormone activity
Cavia porcellus
Acetylation Amidation Cleavage on pair of basic residues Direct protein sequencing Disulfide bond Endorphin Glycoprotein Hormone Phosphoprotein Reference proteome Secreted Signal
MPRSCYSRSG
MPRSCYSRSGTLLLALLLQISMEVRGWCLESSQCQDLTTERHLLECLRACKPDLSAETPVFPGGADEQTPTESPRKYVTGHFRWGRFGRGNSSGASQKREEEAAAADPGFHGDGVEPGLREDKRSYSMEHFRWGKPVGKKRRPVKVYANGAEEESAEAFPLEFKRELTGERPAAAPGPDGLGFGLVAEAEAEAAAAEKKDAAEKKDDGSYRMEHFRWGTPRKGKRYGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ
neuropeptide signaling pathway extracellular region hormone activity Cavia porcellus Acetylation Amidation Cleavage on pair of basic residues Direct protein sequencing Disulfide bond Endorphin Glycoprotein Hormone Phosphoprotein Reference proteome Secreted Signal MPRSCYSRSG MPRSCYSRSGTLLLALLLQISMEVRGWCLESSQCQDLTTERHLLE...
bile acid biosynthetic process bile acid catabolic process lipid catabolic process
cytoplasm
ATP binding cholate-CoA ligase activity
Clostridium scindens
3D-structure ATP-binding Bile acid catabolism Ligase Lipid degradation Lipid metabolism Nucleotide-binding Steroid metabolism
MHKKSACERE
MHKKSACEREGKELKRDFFNKFNLGTSNFVTPGKQLEYVSECKPDSTAVICLDKEQNCSVITWHQLHVYSSQLAWYLIENEIGPGSIVLTMFPNSIEHIIAVFAIWKAGACYMPMSYKAAESEIREACDTIHPNAAFAECKIPGLKFCLSADEIYEAMEGRSKEMPSDRLANPNMISLSGGTSGKMKFIRQNLPCGLDDETIRSWSLMSGMGFEQRQLLVGPLFHGAPHSAAFNGLFMGNTLVLTRNLCPGNILNMIKKYKIEFIQMVPTLMNRLAKLEGVGKEDFASLKALCHTGGVCSPWLKQIWIDLLGPEKIYEMY...
bile acid biosynthetic process bile acid catabolic process lipid catabolic process cytoplasm ATP binding cholate-CoA ligase activity Clostridium scindens 3D-structure ATP-binding Bile acid catabolism Ligase Lipid degradation Lipid metabolism Nucleotide-binding Steroid metabolism MHKKSACERE MHKKSACEREGKELKRDFFNKFNLGTSNF...
bile acid biosynthetic process bile acid catabolic process lipid catabolic process
cytoplasm
bile-acid-CoA transferase activity choloyl-CoA hydrolase activity
Clostridium scindens
Bile acid catabolism Direct protein sequencing Hydrolase Lipid degradation Lipid metabolism Steroid metabolism Transferase
MAGIKDFPKF
MAGIKDFPKFGALAGLKILDSGSNIAGPLGGGLLAECGATVIHFEGPKKPDNQRGWYGYPQNHRNQLSMVADIKSEEGRKIFLDLIKWADIWVESSKGGQYDRLGLSDEVIWEVNPKIAIVHVSGYGQTGDPSYVTRASYDAVGQAFSGYMSLNGTTEALKINPYLSDFVCGLTTCWAMLACYVSTILTGKGESVDVAQYEALARIMDGRMIQYATDGVKMPRTGNKDAQAALFSFYTCKDGRTIFIGMTGAEVCKRGFPIIGLPVPGTGDPDFPEGFTGWMIYTPVGQRMEKAMEKYVSEHTMEEVEAEMQAHQIPCQR...
bile acid biosynthetic process bile acid catabolic process lipid catabolic process cytoplasm bile-acid-CoA transferase activity choloyl-CoA hydrolase activity Clostridium scindens Bile acid catabolism Direct protein sequencing Hydrolase Lipid degradation Lipid metabolism Steroid metabolism Transferase MAGIKDFPKF MAGIKD...
mitochondrial genome maintenance tricarboxylic acid cycle
cytosol; mitochondrial intermembrane space; mitochondrial matrix; mitochondrial nucleoid; mitochondrion
4 iron, 4 sulfur cluster binding aconitate hydratase activity double-stranded DNA binding iron-sulfur cluster binding metal ion binding single-stranded DNA binding
Saccharomyces cerevisiae
4Fe-4S Cytoplasm Direct protein sequencing Iron Iron-sulfur Lyase Metal-binding Mitochondrion Phosphoprotein Reference proteome Transit peptide Tricarboxylic acid cycle
MLSARSAIKR
MLSARSAIKRPIVRGLATVSNLTRDSKVNQNLLEDHSFINYKQNVETLDIVRKRLNRPFTYAEKILYGHLDDPHGQDIQRGVSYLKLRPDRVACQDATAQMAILQFMSAGLPQVAKPVTVHCDHLIQAQVGGEKDLKRAIDLNKEVYDFLASATAKYNMGFWKPGSGIIHQIVLENYAFPGALIIGTDSHTPNAGGLGQLAIGVGGADAVDVMAGRPWELKAPKILGVKLTGKMNGWTSPKDIILKLAGITTVKGGTGKIVEYFGDGVDTFSATGMGTICNMGAEIGATTSVFPFNKSMIEYLEATGRGKIADFAKLYHK...
mitochondrial genome maintenance tricarboxylic acid cycle cytosol; mitochondrial intermembrane space; mitochondrial matrix; mitochondrial nucleoid; mitochondrion 4 iron, 4 sulfur cluster binding aconitate hydratase activity double-stranded DNA binding iron-sulfur cluster binding metal ion binding single-stranded DNA bi...
cellular response to gamma radiation cellular response to testosterone stimulus gene expression hippocampal neuron apoptotic process liver development lung development positive regulation of DNA-templated transcription positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymera...
axon terminus; chromatin; dendrite; mitochondrial membrane; neuronal cell body; nucleoplasm; nucleus
chromatin binding DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific nuclear receptor coactivator activity RNA polymerase II cis-regulatory region sequence-specific DNA binding RNA polym...
Homo sapiens
3D-structure Activator Alternative splicing Direct protein sequencing DNA-binding Isopeptide bond Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation Ubl conjugation
MDPSVTLWQF
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLE...
cellular response to gamma radiation cellular response to testosterone stimulus gene expression hippocampal neuron apoptotic process liver development lung development positive regulation of DNA-templated transcription positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymera...