Biological Process
stringlengths
7
1.01k
Cellular Component
stringlengths
6
867
Molecular Function
stringlengths
11
871
Organism
stringlengths
8
73
Keywords
stringlengths
1
810
Sequence 10
stringlengths
5
10
Sequence
stringlengths
5
1.02k
Combined
stringlengths
136
3.91k
intracellular iron ion homeostasis
extracellular region
heme binding heme transmembrane transporter activity metal ion binding
Oryctolagus cuniculus
3D-structure Direct protein sequencing Disulfide bond Glycoprotein Heme Iron Metal-binding Reference proteome Repeat Secreted Signal Transport
MVKASGIPIA
MVKASGIPIALGVWGLCWSLATVNSVPLTSAHGNVTEGESGTKPEADVIEQCSDGWSFDATTLDDNGTMLFFKDEFVWKSHRGIRELISERWKNFIGPVDAAFRHGHTSVYLIKGDKVWVYTSEKNEKVYPKSLQDEFPGIPFPLDAAVECHRGECQDEGILFFQGNRKWFWDLTTGTKKERSWPAVGNCTSALRWLGRYYCFQGNQFLRFNPVSGEVPPGYPLDVRDYFLSCPGRGHRSSHRNSTQHGHESTRCDPDLVLSAMVSDNHGATYVFSGSHYWRLDTNRDGWHSWPIAHQWPQGPSTVDAAFSWEDKLYLIQ...
intracellular iron ion homeostasis extracellular region heme binding heme transmembrane transporter activity metal ion binding Oryctolagus cuniculus 3D-structure Direct protein sequencing Disulfide bond Glycoprotein Heme Iron Metal-binding Reference proteome Repeat Secreted Signal Transport MVKASGIPIA MVKASGIPIALGVWGLC...
astrocyte cell migration chondroitin sulfate catabolic process dermatan sulfate catabolic process ganglioside catabolic process glycosaminoglycan metabolic process glycosphingolipid metabolic process hyaluronan catabolic process intracellular calcium ion homeostasis lipid storage locomotory behavior lysosome organizati...
acrosomal vesicle; azurophil granule; beta-N-acetylhexosaminidase complex; cortical granule; extracellular space; lysosomal lumen; lysosome; membrane
acetylglucosaminyltransferase activity beta-N-acetylglucosaminidase activity beta-N-acetylhexosaminidase activity carbohydrate binding hexosaminidase activity hydrolase activity identical protein binding N-acetyl-beta-D-galactosaminidase activity protein-containing complex binding
Mus musculus
Cytoplasmic vesicle Disulfide bond Glycoprotein Glycosidase Hydrolase Lipid metabolism Lysosome Reference proteome Signal
MPQSPRSAPG
MPQSPRSAPGLLLLQALVSLVSLALVAPARLQPALWPFPRSVQMFPRLLYISAEDFSIDHSPNSTAGPSCSLLQEAFRRYYNYVFGFYKRHHGPARFRAEPQLQKLLVSITLESECESFPSLSSDETYSLLVQEPVAVLKANSVWGALRGLETFSQLVYQDSFGTFTINESSIADSPRFPHRGILIDTSRHFLPVKTILKTLDAMAFNKFNVLHWHIVDDQSFPYQSTTFPELSNKGSYSLSHVYTPNDVRMVLEYARLRGIRVIPEFDTPGHTQSWGKGQKNLLTPCYNQKTKTQVFGPVDPTVNTTYAFFNTFFKEIS...
astrocyte cell migration chondroitin sulfate catabolic process dermatan sulfate catabolic process ganglioside catabolic process glycosaminoglycan metabolic process glycosphingolipid metabolic process hyaluronan catabolic process intracellular calcium ion homeostasis lipid storage locomotory behavior lysosome organizati...
cobalamin transport cobalt ion transport
extracellular region; extracellular space; specific granule lumen; tertiary granule lumen
cargo receptor ligand activity cobalamin binding molecular sequestering activity
Homo sapiens
3D-structure Cobalt Cobalt transport Disulfide bond Glycoprotein Ion transport Reference proteome Secreted Signal Transport
MRQSHQLPLV
MRQSHQLPLVGLLLFSFIPSQLCEICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTPLTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQTLNTVLTEISQGAFSNPNAAAQVLPALMGKTFLDINKDSSCVSASGNFNISAD...
cobalamin transport cobalt ion transport extracellular region; extracellular space; specific granule lumen; tertiary granule lumen cargo receptor ligand activity cobalamin binding molecular sequestering activity Homo sapiens 3D-structure Cobalt Cobalt transport Disulfide bond Glycoprotein Ion transport Reference proteo...
cobalamin transport cobalt ion transport
external side of plasma membrane; extracellular region; extracellular space; lysosomal lumen; plasma membrane
cargo receptor ligand activity cobalamin binding metal ion binding
Homo sapiens
3D-structure Alternative splicing Cobalt Cobalt transport Direct protein sequencing Disulfide bond Ion transport Metal-binding Reference proteome Secreted Signal Transport
MRHLGAFLFL
MRHLGAFLFLLGVLGALTEMCEIPEMDSHLVEKLGQHLLPWMDRLSLEHLNPSIYVGLRLSSLQAGTKEDLYLHSLKLGYQQCLLGSAFSEDDGDCQGKPSMGQLALYLLALRANCEFVRGHKGDRLVSQLKWFLEDEKRAIGHDHKGHPHTSYYQYGLGILALCLHQKRVHDSVVDKLLYAVEPFHQGHHSVDTAAMAGLAFTCLKRSNFNPGRRQRITMAIRTVREEILKAQTPEGHFGNVYSTPLALQFLMTSPMRGAELGTACLKARVALLASLQDGAFQNALMISQLLPVLNHKTYIDLIFPDCLAPRVMLEPAA...
cobalamin transport cobalt ion transport external side of plasma membrane; extracellular region; extracellular space; lysosomal lumen; plasma membrane cargo receptor ligand activity cobalamin binding metal ion binding Homo sapiens 3D-structure Alternative splicing Cobalt Cobalt transport Direct protein sequencing Disul...
actin filament organization positive regulation of DNA-templated transcription positive regulation of smooth muscle cell differentiation positive regulation of smooth muscle cell migration regulation of cell migration sequestering of actin monomers
cytoplasm; cytoskeleton; cytosol; nucleus
actin monomer binding enzyme binding protein sequestering activity
Mus musculus
3D-structure Acetylation Actin-binding Alternative splicing Cytoplasm Cytoskeleton Isopeptide bond Phosphoprotein Reference proteome Ubl conjugation
MLLPATMSDK
MLLPATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
actin filament organization positive regulation of DNA-templated transcription positive regulation of smooth muscle cell differentiation positive regulation of smooth muscle cell migration regulation of cell migration sequestering of actin monomers cytoplasm; cytoskeleton; cytosol; nucleus actin monomer binding enzyme ...
blood vessel diameter maintenance cellular response to dexamethasone stimulus cellular response to lithium ion cellular response to nerve growth factor stimulus digestive tract development hyperosmotic response liver development negative regulation of gene expression neuropeptide signaling pathway positive regulation o...
axon terminus; extracellular region; neuronal cell body; transport vesicle
neuropeptide hormone activity neuropeptide receptor binding receptor ligand activity
Rattus norvegicus
3D-structure Cleavage on pair of basic residues Cytoplasmic vesicle Direct protein sequencing Reference proteome Secreted Signal Vasoactive
MIGMNLQLVC
MIGMNLQLVCLTLLAFSSWSLCSDSEEDVRALEADLLTNMHASKVSKGSPPSWKMTLLNVCSLINNLNSAAEEAGEMRDDDLVAKRKLPLVLDDFSLEALLTVFQLQKICRSRAFQHWEIIQEDILDHGNEKTEKEEVIKRKIPYILKRQLYENKPRRPYILKRASYYY
blood vessel diameter maintenance cellular response to dexamethasone stimulus cellular response to lithium ion cellular response to nerve growth factor stimulus digestive tract development hyperosmotic response liver development negative regulation of gene expression neuropeptide signaling pathway positive regulation o...
cholesterol biosynthetic process nitric oxide biosynthetic process
endoplasmic reticulum membrane; lipid droplet; mitochondrial membrane; mitochondrial outer membrane; mitochondrion; nitric-oxide synthase complex
ADP binding AMP binding cytochrome-b5 reductase activity, acting on NAD(P)H FAD binding flavin adenine dinucleotide binding NAD binding nitrite reductase (NO-forming) activity
Rattus norvegicus
3D-structure Acetylation Alternative initiation Alternative promoter usage Cholesterol biosynthesis Cholesterol metabolism Cytoplasm Direct protein sequencing Endoplasmic reticulum FAD Flavoprotein Lipid biosynthesis Lipid metabolism Lipoprotein Membrane Mitochondrion Mitochondrion outer membrane Myristate NAD Oxidored...
MGAQLSTLSR
MGAQLSTLSRVVLSPVWFVYSLFMKLFQRSSPAITLENPDIKYPLRLIDKEIISHDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKDTHPKFPAGGKMSQYLENMNIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEELRNEHSSRFKLWYTVDKAPDAWDYSQGFVNEEMIRDHLPPPGEETLILMCGPPPMIQFACLPNLERVGHPKERCFTF
cholesterol biosynthetic process nitric oxide biosynthetic process endoplasmic reticulum membrane; lipid droplet; mitochondrial membrane; mitochondrial outer membrane; mitochondrion; nitric-oxide synthase complex ADP binding AMP binding cytochrome-b5 reductase activity, acting on NAD(P)H FAD binding flavin adenine dinu...
autophagy epithelial cell differentiation negative regulation of gene expression
collagen-containing extracellular matrix; cytoplasm; endoplasmic reticulum membrane; extracellular exosome; membrane; nucleus
calcium ion binding calcium-dependent phospholipid binding calcium-dependent protein binding integrin binding RNA binding
Homo sapiens
Acetylation Alternative splicing Annexin Calcium Calcium/phospholipid-binding Direct protein sequencing Reference proteome Repeat
MSYPGYPPTG
MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPGGYPAPGGYPGAPQPGGAPSYPGVPPGQGFGVPPGGAGFSGYPQPPSQSYGGGPAQVPLPGGFPGGQMPSQYPGGQPTYPSQINTDSFSSYPVFSPVSLDYSSEPATVTQVTQGTIRPAANFDAIRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFE...
autophagy epithelial cell differentiation negative regulation of gene expression collagen-containing extracellular matrix; cytoplasm; endoplasmic reticulum membrane; extracellular exosome; membrane; nucleus calcium ion binding calcium-dependent phospholipid binding calcium-dependent protein binding integrin binding RNA...
chromatin organization protein folding regulation of homoserine biosynthetic process
cytoplasm; mitochondrion; nucleus
macrolide binding peptidyl-prolyl cis-trans isomerase activity
Saccharomyces cerevisiae
3D-structure Acetylation Cytoplasm Direct protein sequencing Isomerase Mitochondrion Phosphoprotein Reference proteome Rotamase
MSEVIEGNVK
MSEVIEGNVKIDRISPGDGATFPKTGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDVGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNSTLVFDVELLKVN
chromatin organization protein folding regulation of homoserine biosynthetic process cytoplasm; mitochondrion; nucleus macrolide binding peptidyl-prolyl cis-trans isomerase activity Saccharomyces cerevisiae 3D-structure Acetylation Cytoplasm Direct protein sequencing Isomerase Mitochondrion Phosphoprotein Reference pr...
chromosome organization chromosome segregation DNA topological change plasmid partitioning response to antibiotic sister chromatid cohesion
chromosome; cytosol; DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) complex
ATP binding DNA binding DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity metal ion binding
Escherichia coli
3D-structure Antibiotic resistance ATP-binding DNA-binding Isomerase Magnesium Metal-binding Nucleotide-binding Reference proteome Topoisomerase
MTQTYNADAI
MTQTYNADAIEVLTGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCYQDGLNDYLAEAVNGLPTLPEKPFIGNFAGDTEAVDWALLWLPEGGELLTESYVNLIPTMQGGTHVNGLRQGLLDAMREFCEYRNILPRGVKLSAEDIWDRCAYVL...
chromosome organization chromosome segregation DNA topological change plasmid partitioning response to antibiotic sister chromatid cohesion chromosome; cytosol; DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) complex ATP binding DNA binding DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) a...
generation of catalytic spliceosome for first transesterification step snoRNA splicing
U2-type catalytic step 1 spliceosome
ATP binding ATP hydrolysis activity ATP-dependent activity, acting on RNA helicase activity RNA binding RNA helicase activity
Saccharomyces cerevisiae
3D-structure Acetylation ATP-binding Hydrolase mRNA processing mRNA splicing Nucleotide-binding Nucleus Reference proteome
MSSITSETGK
MSSITSETGKRRVKRTYEVTRQNDNAVRIEPSSLGEEEDKEAKDKNSALQLKRSRYDPNKVFSNTNQGPEKNNLKGEQLGSQKKSSKYDEKITSNNELTTKKGLLGDSENETKYASSNSKFNVEVTHKIKNAKEIDKINRQRMWEEQQLRNAMAGQSDHPDDITLEGSDKYDYVFDTDAMIDYTNEEDDLLPEEKLQYEARLAQALETEEKRILTIQEARKLLPVHQYKDELLQEIKKNQVLIIMGETGSGKTTQLPQYLVEDGFTDQGKLQIAITQPRRVAATSVAARVADEMNVVLGKEVGYQIRFEDKTTPNKTVLK...
generation of catalytic spliceosome for first transesterification step snoRNA splicing U2-type catalytic step 1 spliceosome ATP binding ATP hydrolysis activity ATP-dependent activity, acting on RNA helicase activity RNA binding RNA helicase activity Saccharomyces cerevisiae 3D-structure Acetylation ATP-binding Hydrola...
autophagy cell death oogenesis positive regulation of transcription by RNA polymerase II regulation of development, heterochronic regulation of transcription by RNA polymerase II salivary gland cell autophagic cell death
nucleus
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity, RNA polymerase II-specific sequence-specific DNA binding
Drosophila melanogaster
Alternative splicing Developmental protein DNA-binding Nucleus Reference proteome Transcription Transcription regulation
MPFIDDALLW
MPFIDDALLWCPDNDGRLVGGLDLGTCIADDSTANGTENLNPSIQSAGNPNNPQQSVGGEILGSVESAGNELNGAAARNVNVVVEPLCGGDSSDELFRSFSESNFEIESLLSDLATVEVKVENEENNNNVITDDDFASVAAAVVANDDLLAKENAQLSAQGLVDSVAASLADSGDAGGQQALLAFGSSSSAASAIAAAAAALCGDLINNNNNNSNSNNNSNGNGNHGGGGGGASSGGGVAGDCATKLEYALMGGQPLAEEPRFVTSAAANPLLVEKLMSKCLNIEKRMDKLSDTEIPIVKQSTSPAPQQQLQQQHHLQQQ...
autophagy cell death oogenesis positive regulation of transcription by RNA polymerase II regulation of development, heterochronic regulation of transcription by RNA polymerase II salivary gland cell autophagic cell death nucleus DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transc...
intracellular zinc ion homeostasis response to cadmium ion zinc ion transmembrane transport
fungal-type vacuole; fungal-type vacuole membrane
zinc ion transmembrane transporter activity
Saccharomyces cerevisiae
Cadmium Cadmium resistance Ion transport Isopeptide bond Membrane Phosphoprotein Reference proteome Repeat Transmembrane Transmembrane helix Transport Ubl conjugation Vacuole Zinc Zinc transport
MITGKELRII
MITGKELRIISLLTLDTVFFLLEITIGYMSHSLALIADSFHMLNDIISLLVALWAVDVAKNRGPDAKYTYGWKRAEILGALINAVFLIALCFSIMIEALQRLIEPQEIQNPRLVLYVGVAGLISNVVGLFLFHDHGSDSLHSHSHGSVESGNNDLDIESNATHSHSHASLPNDNLAIDEDAISSPGPSGQIGEVLPQSVVNRLSNESQPLLNHDDHDHSHESKKPGHRSLNMHGVFLHVLGDALGNIGVIAAALFIWKTEYSWRYYSDPIVSLIITIIIFSSALPLSRRASRILLQATPSTISADQIQREILAVPGVIAV...
intracellular zinc ion homeostasis response to cadmium ion zinc ion transmembrane transport fungal-type vacuole; fungal-type vacuole membrane zinc ion transmembrane transporter activity Saccharomyces cerevisiae Cadmium Cadmium resistance Ion transport Isopeptide bond Membrane Phosphoprotein Reference proteome Repeat T...
cell redox homeostasis cellular response to oxidative stress cellular response to reactive oxygen species hydrogen peroxide catabolic process maternal placenta development mitochondrion organization myeloid cell differentiation negative regulation of apoptotic process negative regulation of neuron apoptotic process pos...
cytoplasm; cytosol; early endosome; intracellular membrane-bounded organelle; mitochondrion; myelin sheath; nucleoplasm; plasma membrane; protein-containing complex
cysteine-type endopeptidase inhibitor activity involved in apoptotic process identical protein binding protein kinase binding thioredoxin peroxidase activity
Mus musculus
Acetylation Antioxidant Cytoplasm Direct protein sequencing Disulfide bond Endosome Lipoprotein Mitochondrion Oxidoreductase Palmitate Peroxidase Phosphoprotein Redox-active center Reference proteome Transit peptide
MAAAAGRLLW
MAAAAGRLLWSSVARHASAISRSISASTVLRPVASRRTCLTDILWSASAQGKSAFSTSSSFHTPAVTQHAPYFKGTAVVNGEFKELSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNITLLSDITKQISRDYGVLLESAGIALRGLFIIDPNGVVKHLSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPANWTPESPTIKPSPTASKEYFEKVHQ
cell redox homeostasis cellular response to oxidative stress cellular response to reactive oxygen species hydrogen peroxide catabolic process maternal placenta development mitochondrion organization myeloid cell differentiation negative regulation of apoptotic process negative regulation of neuron apoptotic process pos...
actin cytoskeleton organization microspike assembly muscle cell development
cell junction; cell projection; cortical actin cytoskeleton; filopodium; plasma membrane; Z disc
actin filament binding calcium ion binding
Gallus gallus
Actin-binding Alternative splicing Calcium Cytoplasm Metal-binding Reference proteome Repeat Ubl conjugation
MNSMNQIETN
MNSMNQIETNMQYTYNYEEDEYMTQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHLSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTIPWLENRTPEKTMQAMQ...
actin cytoskeleton organization microspike assembly muscle cell development cell junction; cell projection; cortical actin cytoskeleton; filopodium; plasma membrane; Z disc actin filament binding calcium ion binding Gallus gallus Actin-binding Alternative splicing Calcium Cytoplasm Metal-binding Reference proteome Repe...
citrate metabolic process tricarboxylic acid cycle
chloroplast; cytosol; mitochondrial matrix; mitochondrion; plant-type cell wall
ATP binding citrate (Si)-synthase activity zinc ion binding
Arabidopsis thaliana
3D-structure Alternative splicing Mitochondrion Reference proteome Transferase Transit peptide Tricarboxylic acid cycle
MVFFRSVSAF
MVFFRSVSAFTRLRSRVQGQQSSLSNSVRWIQMQSSTDLDLKSQLQELIPEQQDRLKKLKSEHGKVQLGNITVDMVIGGMRGMTGLLWETSLLDPEEGIRFRGLSIPECQKVLPTAQSGAEPLPEGLLWLLLTGKVPSKEQVEALSKDLANRAAVPDYVYNAIDALPSTAHPMTQFASGVMALQVQSEFQKAYENGIHKSKFWEPTYEDCLNLIARVPVVAAYVYRRMYKNGDSIPSDKSLDYGANFSHMLGFDDEKVKELMRLYITIHSDHEGGNVSAHTGHLVGSALSDPYLSFAAALNGLAGPLHGLANQEVLLWIK...
citrate metabolic process tricarboxylic acid cycle chloroplast; cytosol; mitochondrial matrix; mitochondrion; plant-type cell wall ATP binding citrate (Si)-synthase activity zinc ion binding Arabidopsis thaliana 3D-structure Alternative splicing Mitochondrion Reference proteome Transferase Transit peptide Tricarboxylic...
gluconeogenesis isoleucine biosynthetic process L-serine catabolic process lipid metabolic process pyruvate biosynthetic process threonine catabolic process
cytosol; mitochondrion
L-serine ammonia-lyase activity L-threonine ammonia-lyase activity protein homodimerization activity pyridoxal phosphate binding
Homo sapiens
3D-structure Cytoplasm Gluconeogenesis Lipid metabolism Lyase Pyridoxal phosphate Reference proteome
MMSGEPLHVK
MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEGNLRTPLPSLVVIVCGGSNISLAQLRALKEQL...
gluconeogenesis isoleucine biosynthetic process L-serine catabolic process lipid metabolic process pyruvate biosynthetic process threonine catabolic process cytosol; mitochondrion L-serine ammonia-lyase activity L-threonine ammonia-lyase activity protein homodimerization activity pyridoxal phosphate binding Homo sapien...
endoplasmic reticulum to Golgi vesicle-mediated transport protein geranylgeranylation protein targeting to membrane
cytosol; Rab-protein geranylgeranyltransferase complex
Rab geranylgeranyltransferase activity small GTPase binding zinc ion binding
Saccharomyces cerevisiae
Metal-binding Prenyltransferase Reference proteome Repeat Transferase Zinc
MSGSLTLLKE
MSGSLTLLKEKHIRYIESLDTKKHNFEYWLTEHLRLNGIYWGLTALCVLDSPETFVKEEVISFVLSCWDDKYGAFAPFPRHDAHLLTTLSAVQILATYDALDVLGKDRKVRLISFIRGNQLEDGSFQGDRFGEVDTRFVYTALSALSILGELTSEVVDPAVDFVLKCYNFDGGFGLCPNAESHAAQAFTCLGALAIANKLDMLSDDQLEEIGWWLCERQLPEGGLNGRPSKLPDVCYSWWVLSSLAIIGRLDWINYEKLTEFILKCQDEKKGGISDRPENEVDVFHTVFGVAGLSLMGYDNLVPIDPIYCMPKSVTSKFK...
endoplasmic reticulum to Golgi vesicle-mediated transport protein geranylgeranylation protein targeting to membrane cytosol; Rab-protein geranylgeranyltransferase complex Rab geranylgeranyltransferase activity small GTPase binding zinc ion binding Saccharomyces cerevisiae Metal-binding Prenyltransferase Reference prot...
lipid metabolic process
cytoplasm
glutathione transferase activity identical protein binding
Gallus gallus
3D-structure Cytoplasm Direct protein sequencing Lipid metabolism Reference proteome Transferase
MVVTLGYWDI
MVVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNLPYLIDGDVKLTQSNAILRYIARKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPDFEKLKPAYLEQLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAYDVLDQQRMFVPDCPELQGNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNKKE
lipid metabolic process cytoplasm glutathione transferase activity identical protein binding Gallus gallus 3D-structure Cytoplasm Direct protein sequencing Lipid metabolism Reference proteome Transferase MVVTLGYWDI MVVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNLPYLIDGDVKLTQSNAILRYIARKHNMCGETEVEKQRVDVLENHLM...
cell adhesion cell-cell adhesion cell-cell signaling immune response-inhibiting signal transduction negative regulation of calcium ion transport negative regulation of cell population proliferation negative regulation of interleukin-1 beta production negative regulation of interleukin-8 production negative regulation o...
cell surface; external side of plasma membrane; Golgi apparatus; nucleoplasm; peroxisome; plasma membrane; specific granule membrane; tertiary granule membrane
carbohydrate binding protein phosphatase binding sialic acid binding signaling receptor activity
Homo sapiens
3D-structure Alternative splicing Cell adhesion Cell membrane Disulfide bond Glycoprotein Immunoglobulin domain Lectin Membrane Peroxisome Phosphoprotein Reference proteome Repeat Signal Transmembrane Transmembrane helix
MPLLLLLPLL
MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFFIVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPT...
cell adhesion cell-cell adhesion cell-cell signaling immune response-inhibiting signal transduction negative regulation of calcium ion transport negative regulation of cell population proliferation negative regulation of interleukin-1 beta production negative regulation of interleukin-8 production negative regulation o...
digestion positive regulation of antibacterial peptide production proteolysis
extracellular space
aspartic-type endopeptidase activity
Homo sapiens
3D-structure Alternative splicing Aspartyl protease Digestion Direct protein sequencing Disulfide bond Hydrolase Protease Reference proteome Secreted Signal Zymogen
MKWMVVVLVC
MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMDAAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSRFNPSESSTYSTNGQTFSLQYGSGSLTGFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVFSVYLSNQQGSSGGAVVFGGVDSSLYTGQIYWAPVTQELYWQIGIEEFLIGGQASGWCSEGCQAIVDTGTSLLTVPQQYMSALLQATGAQEDEYGQFLVNCNSIQNLPSLT...
digestion positive regulation of antibacterial peptide production proteolysis extracellular space aspartic-type endopeptidase activity Homo sapiens 3D-structure Alternative splicing Aspartyl protease Digestion Direct protein sequencing Disulfide bond Hydrolase Protease Reference proteome Secreted Signal Zymogen MKWMVVV...
proteolysis
extracellular exosome; extracellular region; secretory granule
serine-type endopeptidase activity
Homo sapiens
3D-structure Alternative splicing Disulfide bond Glycoprotein Hydrolase Protease Reference proteome Serine protease Signal Zymogen
MWDLVLSIAL
MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
proteolysis extracellular exosome; extracellular region; secretory granule serine-type endopeptidase activity Homo sapiens 3D-structure Alternative splicing Disulfide bond Glycoprotein Hydrolase Protease Reference proteome Serine protease Signal Zymogen MWDLVLSIAL MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLV...
astrocyte development Bergmann glial cell differentiation cellular response to lipopolysaccharide cellular response to muramyl dipeptide cellular response to type II interferon intermediate filament organization intermediate filament-based process lens fiber cell development negative regulation of neuron projection dev...
axon; cell body; cell leading edge; cell projection; cytoplasm; cytoskeleton; cytosol; intermediate filament; intermediate filament cytoskeleton; neuron projection; nuclear matrix; perinuclear region of cytoplasm; peroxisome; phagocytic vesicle; plasma membrane; polysome; ribonucleoprotein complex; type III intermediat...
double-stranded RNA binding identical protein binding keratin filament binding kinase binding molecular adaptor activity protein domain specific binding protein phosphatase 2A binding protein tyrosine kinase binding RNA binding scaffold protein binding structural constituent of cytoskeleton structural constituent of ey...
Mus musculus
Acetylation Cell membrane Coiled coil Cytoplasm Cytoskeleton Direct protein sequencing Glycoprotein Intermediate filament Isopeptide bond Membrane Nucleus Phosphoprotein Reference proteome S-nitrosylation Ubl conjugation
MSTRSVSSSS
MSTRSVSSSSYRRMFGGSGTSSRPSSNRSYVTTSTRTYSLGSALRPSTSRSLYSSSPGGAYVTRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYR...
astrocyte development Bergmann glial cell differentiation cellular response to lipopolysaccharide cellular response to muramyl dipeptide cellular response to type II interferon intermediate filament organization intermediate filament-based process lens fiber cell development negative regulation of neuron projection dev...
anatomical structure development border follicle cell migration cell differentiation cellular response to ecdysone dendrite morphogenesis ecdysone biosynthetic process ecdysone receptor-mediated signaling pathway germ cell development metamorphosis mushroom body development negative regulation of cell differentiation n...
activator ecdysone receptor complex; dendrite; ecdysone receptor holocomplex; nucleus; polytene chromosome
core promoter sequence-specific DNA binding DNA binding hormone binding lipid binding nuclear receptor activity nuclear steroid receptor activity protein heterodimerization activity RNA polymerase II cis-regulatory region sequence-specific DNA binding signaling receptor binding transcription cis-regulatory region bindi...
Drosophila melanogaster
3D-structure DNA-binding Metal-binding Nucleus Phosphoprotein Receptor Reference proteome Transcription Transcription regulation Zinc Zinc-finger
MDNCDQDASF
MDNCDQDASFRLSHIKEEVKPDISQLNDSNNSSFSPKAESPVPFMQAMSMVHVLPGSNSASSNNNSAGDAQMAQAPNSAGGSAAAAVQQQYPPNHPLSGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYACRENRNCIIDKRQRNRCQYCRYQKCLTCGMKREAVQEERQRGARNAAGRLSASGGGSSGPGSVGGSSSQGGGGGGGVSGGMGSGNGSDDFMTNSVSRDFSIERIIEAEQRAETQCGDRALTFLRVGPYSTVQPDYKGAVSALCQVVNKQLFQMVEYARMMPHFAQVPLDDQVILLKAAWIE...
anatomical structure development border follicle cell migration cell differentiation cellular response to ecdysone dendrite morphogenesis ecdysone biosynthetic process ecdysone receptor-mediated signaling pathway germ cell development metamorphosis mushroom body development negative regulation of cell differentiation n...
axonal fasciculation cell fate specification egg-laying behavior neuron differentiation positive regulation of vulval development regulation of cell differentiation regulation of cell migration regulation of transcription by RNA polymerase II
nucleus
DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II transcription regulatory region sequence-specific DNA binding zinc ion binding
Caenorhabditis elegans
Developmental protein DNA-binding Homeobox Isopeptide bond LIM domain Metal-binding Nucleus Reference proteome Repeat Transcription Transcription regulation Ubl conjugation Zinc
MHSSSSFIIT
MHSSSSFIITSLEEEEKKPPAHHLHQQSIEDVGSVTSSATLLLLDSATWMMPSSTTQPHISEISGNECAACAQPILDRYVFTVLGKCWHQSCLRCCDCRAPMSMTCFSRDGLILCKTDFSRRYSQRCAGCDGKLEKEDLVRRARDKVFHIRCFQCSVCQRLLDTGDQLYIMEGNRFVCQSDFQTATKTSTPTSIHRPVSNGSECNSDVEEDNVDACDEVGLDDGEGDCGKDNSDDSNSAKRRGPRTTIKAKQLETLKNAFAATPKPTRHIREQLAAETGLNMRVIQVWFQNRRSKERRMKQLRFGGYRQSRRPRRDDIVD...
axonal fasciculation cell fate specification egg-laying behavior neuron differentiation positive regulation of vulval development regulation of cell differentiation regulation of cell migration regulation of transcription by RNA polymerase II nucleus DNA-binding transcription factor activity DNA-binding transcription f...
acrosome assembly spermatid development
acrosomal vesicle; extracellular region
endopeptidase inhibitor activity serine-type endopeptidase inhibitor activity
Homo sapiens
3D-structure Cytoplasmic vesicle Direct protein sequencing Disulfide bond Protease inhibitor Pyrrolidone carboxylic acid Reference proteome Secreted Serine protease inhibitor Signal
MALSVLRLAL
MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC
acrosome assembly spermatid development acrosomal vesicle; extracellular region endopeptidase inhibitor activity serine-type endopeptidase inhibitor activity Homo sapiens 3D-structure Cytoplasmic vesicle Direct protein sequencing Disulfide bond Protease inhibitor Pyrrolidone carboxylic acid Reference proteome Secreted ...
carbohydrate homeostasis generation of precursor metabolites and energy glucose homeostasis insulin secretion modulation of chemical synaptic transmission neuron differentiation ovarian follicle development regulation of neuronal synaptic plasticity regulation of synaptic plasticity response to cAMP response to cold re...
cytoplasmic vesicle; extracellular space; glutamatergic synapse; Golgi apparatus; neuronal cell body; synapse; transport vesicle
growth factor activity hormone activity neuropeptide hormone activity
Rattus norvegicus
Amidation Cleavage on pair of basic residues Cytoplasmic vesicle Direct protein sequencing Growth factor Phosphoprotein Pyrrolidone carboxylic acid Reference proteome Secreted Signal
MKTFTLPASV
MKTFTLPASVLFCFLLLIRGLGAAPPGRSDVYPPPLGSEHNGQVAEDAVSRPKDDSVPEVRAARNSEPQDQGELFQGVDPRALAAVLLQALDRPASPPAVPAGSQQGTPEEAAEALLTESVRSQTHSLPASEIQASAVAPPRPQTQDNDPEADDRSEELEALASLLQELRDFSPSNAKRQQETAAAETETRTHTLTRVNLESPGPERVWRASWGEFQARVPERAPLPPSVPSQFQARMSENVPLPETHQFGEGVSSPKTHLGETLTPLSKAYQSLSAPFPKVRRLEGSFLGGSEAGERLLQQGLAQVEAGRRQAEATRQA...
carbohydrate homeostasis generation of precursor metabolites and energy glucose homeostasis insulin secretion modulation of chemical synaptic transmission neuron differentiation ovarian follicle development regulation of neuronal synaptic plasticity regulation of synaptic plasticity response to cAMP response to cold re...
chaperone cofactor-dependent protein refolding endoplasmic reticulum unfolded protein response protein refolding ubiquitin-dependent ERAD pathway
cytoplasm; endoplasmic reticulum chaperone complex; endoplasmic reticulum lumen; membrane; nucleus; rough endoplasmic reticulum
ATP binding ATP hydrolysis activity ATP-dependent protein folding chaperone heat shock protein binding protein folding chaperone RNA polymerase II-specific DNA-binding transcription factor binding
Caenorhabditis elegans
3D-structure ATP-binding Chaperone Endoplasmic reticulum Hydrolase Nucleotide-binding Reference proteome Signal Stress response
MKVFSLILIA
MKVFSLILIAFVANAYCDEGASTEKEEKMGTIIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFSGDQGERLIGDAAKNQLTINPENTIFDAKRLIGRFYNEKTVQQDIKHWPFKIVDKSNKPNVEVKVGSETKQFTPEEVSAMVLTKMKQIAESYLGHEVKNAVVTVPAYFNDAQKQATKDAGSIAGLNVVRIINEPTAAAIAYGLDKKDGERNILVFDLGGGTFDVSLLTIDSGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSGKDLRKDNRAVQKLRREVEKAKRALSTQHQTKIEIESLFDGEDF...
chaperone cofactor-dependent protein refolding endoplasmic reticulum unfolded protein response protein refolding ubiquitin-dependent ERAD pathway cytoplasm; endoplasmic reticulum chaperone complex; endoplasmic reticulum lumen; membrane; nucleus; rough endoplasmic reticulum ATP binding ATP hydrolysis activity ATP-depend...
proteolysis
extracellular region
metal ion binding metalloendopeptidase activity toxin activity
Protobothrops flavoviridis
Calcium Cell adhesion impairing toxin Direct protein sequencing Disulfide bond Glycoprotein Hemorrhagic toxin Hemostasis impairing toxin Hydrolase Metal-binding Metalloprotease Platelet aggregation inhibiting toxin Protease Pyrrolidone carboxylic acid Secreted Signal Toxin Zinc Zymogen
MIQVLLVTIC
MIQVLLVTICLAVFPYQGSSIILESGNVNDYEVMYPQKVAALPKGAVQQKYEDTMQYEFKVNGEPVVLHLEKNKGLFSEDYSETHYSPDGREITTNPPVEDHCYYHGRIQNDADSTASISACNGLKGHFKLQGEMYLIEPLKFSDSEAHAVYKYENVEKEEEAPKMCGVTQTNWESDEPIKKASKLVVTAEQQRFPRRYIKLAIVVDHGIVTKHHGNLKKIRKWIYQLVNTINNIYRSLNILVALVYLEIWSKQNKITVQSASNVTLDLFGDWRESVLLKQRSHDCAQLLTTIDFDGPTIGKAYTASMCDPKRSVGIVQD...
proteolysis extracellular region metal ion binding metalloendopeptidase activity toxin activity Protobothrops flavoviridis Calcium Cell adhesion impairing toxin Direct protein sequencing Disulfide bond Glycoprotein Hemorrhagic toxin Hemostasis impairing toxin Hydrolase Metal-binding Metalloprotease Platelet aggregatio...
proteolysis
extracellular region
metal ion binding metalloendopeptidase activity
Protobothrops flavoviridis
3D-structure Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Metal-binding Metalloprotease Protease Pyrrolidone carboxylic acid Secreted Zinc
QRFPQRYIEL
QRFPQRYIELAIVVDHGMYKKYNQNSDKIKVRVHQMVNHINEMYRPLNIAISLNRLQIWSKKDLITVKSASNVTLESFGNWRETVLLKQQNNDCAHLLTATNLNDNTIGLAYKKGMCNPKLSVGLVQDYSPNVFMVAVTMTHELGHNLGMEHDDKDKCKCEACIMSDVISDKPSKLFSDCSKNDYQTFLTKYNPQCILNAP
proteolysis extracellular region metal ion binding metalloendopeptidase activity Protobothrops flavoviridis 3D-structure Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Metal-binding Metalloprotease Protease Pyrrolidone carboxylic acid Secreted Zinc QRFPQRYIEL QRFPQRYIELAIVVDHGMYKKYNQNSDKIKVRVHQMVNHINE...
phosphoenolpyruvate-dependent sugar phosphotransferase system phosphorylation
plasma membrane
D-glucosamine PTS permease activity glucose transmembrane transporter activity kinase activity protein-N(PI)-phosphohistidine-sugar phosphotransferase activity protein-phosphocysteine-sugar phosphotransferase activity
Bacillus subtilis
3D-structure Cell membrane Kinase Membrane Phosphotransferase system Reference proteome Sugar transport Transferase Transmembrane Transmembrane helix Transport
MFKALFGVLQ
MFKALFGVLQKIGRALMLPVAILPAAGILLAIGNAMQNKDMIQVLHFLSNDNVQLVAGVMESAGQIVFDNLPLLFAVGVAIGLANGDGVAGIAAIIGYLVMNVSMSAVLLANGTIPSDSVERAKFFTENHPAYVNMLGIPTLATGVFGGIIVGVLAALLFNRFYTIELPQYLGFFAGKRFVPIVTSISALILGLIMLVIWPPIQHGLNAFSTGLVEANPTLAAFIFGVIERSLIPFGLHHIFYSPFWYEFFSYKSAAGEIIRGDQRIFMAQIKDGVQLTAGTFMTGKYPFMMFGLPAAALAIYHEAKPQNKKLVAGIMGS...
phosphoenolpyruvate-dependent sugar phosphotransferase system phosphorylation plasma membrane D-glucosamine PTS permease activity glucose transmembrane transporter activity kinase activity protein-N(PI)-phosphohistidine-sugar phosphotransferase activity protein-phosphocysteine-sugar phosphotransferase activity Bacillus...
diacylglycerol metabolic process intracellular signal transduction lipid phosphorylation phosphatidic acid biosynthetic process protein kinase C-activating G protein-coupled receptor signaling pathway
cytosol; plasma membrane
alkylglycerol kinase activity ATP binding ATP-dependent diacylglycerol kinase activity calcium ion binding
Sus scrofa
Acetylation ATP-binding Calcium Cytoplasm Direct protein sequencing Kinase Lipid metabolism Metal-binding Nucleotide-binding Reference proteome Repeat Transferase Zinc Zinc-finger
MSKERGLISP
MSKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAEYLQGDAIGYEGFQQFLKIYLEVDSVPSHLSLALFQSFQTSYCSEETVKRDVVCLSDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDRIIIQMMRMAEYLDWDVSELRPILQEMMKEIDYDGSGSVSLAEWLRAGATTVPLLVLLGLEMTLKDNGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQTHVWVRGGCESGRCDRCQKKIRIYHSLVGLHCVWCHLEIHDDCLPAMGHECDC...
diacylglycerol metabolic process intracellular signal transduction lipid phosphorylation phosphatidic acid biosynthetic process protein kinase C-activating G protein-coupled receptor signaling pathway cytosol; plasma membrane alkylglycerol kinase activity ATP binding ATP-dependent diacylglycerol kinase activity calcium...
DNA-templated transcription initiation mRNA transcription by RNA polymerase II positive regulation of transcription initiation by RNA polymerase II RNA polymerase II preinitiation complex assembly spermatogenesis transcription by RNA polymerase II transcription by RNA polymerase III transcription initiation at RNA poly...
chromatin; cytoplasm; euchromatin; female germ cell nucleus; female pronucleus; male germ cell nucleus; male pronucleus; nucleoplasm; nucleus; protein-containing complex; RNA polymerase transcription factor SL1 complex; transcription factor TFIIA complex; transcription factor TFIID complex
aryl hydrocarbon receptor binding core promoter sequence-specific DNA binding DNA-binding transcription factor binding enzyme binding RNA polymerase II cis-regulatory region sequence-specific DNA binding RNA polymerase II core promoter sequence-specific DNA binding RNA polymerase II general transcription initiation fac...
Homo sapiens
3D-structure Alternative splicing Disease variant DNA-binding Host-virus interaction Neurodegeneration Nucleus Reference proteome Repeat Spinocerebellar ataxia Transcription Transcription regulation Triplet repeat expansion
MDQNNSLPPY
MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAE...
DNA-templated transcription initiation mRNA transcription by RNA polymerase II positive regulation of transcription initiation by RNA polymerase II RNA polymerase II preinitiation complex assembly spermatogenesis transcription by RNA polymerase II transcription by RNA polymerase III transcription initiation at RNA poly...
DNA-templated transcription initiation mRNA transcription by RNA polymerase II RNA polymerase II preinitiation complex assembly snRNA transcription by RNA polymerase II snRNA transcription by RNA polymerase III transcription by RNA polymerase II transcription by RNA polymerase III transcription initiation at RNA polyme...
nucleus; transcription factor TFIID complex; transcription factor TFIIIB complex
general transcription initiation factor binding RNA polymerase II cis-regulatory region sequence-specific DNA binding RNA polymerase II general transcription initiation factor activity RNA polymerase III general transcription initiation factor activity RNA polymerase III type 3 promoter sequence-specific DNA binding TF...
Drosophila melanogaster
DNA-binding Nucleus Reference proteome Repeat Transcription
MDQMLSPNFS
MDQMLSPNFSIPSIGTPLHQMEADQQIVANPVYHPPAVSQPDSLMPAPGSSSVQHQQQQQQSDASGGSGLFGHEPSLPLAHKQMQSYQPSASYQQQQQQQQLQSQAPGGGGSTPQSMMQPQTPQSMMAHMMPMSERSVGGSGAGGGGDALSNIHQTMGPSTPMTPATPGSADPGIVPQLQNIVSTVNLCCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDDSRLAARKYARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSYEPELFPGLIYRMVRPRIVLLIFV...
DNA-templated transcription initiation mRNA transcription by RNA polymerase II RNA polymerase II preinitiation complex assembly snRNA transcription by RNA polymerase II snRNA transcription by RNA polymerase III transcription by RNA polymerase II transcription by RNA polymerase III transcription initiation at RNA polyme...
gamma-aminobutyric acid biosynthetic process glutamate catabolic process larval locomotory behavior neuromuscular junction development olfactory learning response to mechanical stimulus synapse assembly
cytoplasm; cytosol
glutamate decarboxylase activity pyridoxal phosphate binding
Drosophila melanogaster
Decarboxylase Lyase Neurotransmitter biosynthesis Pyridoxal phosphate Reference proteome
MSLNPNGYKL
MSLNPNGYKLSERTGKLTAYDLMPTTVTAGPETREFLLKVIDVLLDFVKATNDRNEKVLDFHHPEDMKRLLDLDVPDRALPLQQLIEDCATTLKYQVKTGHPHFFNQLSNGLDLISMAGEWLTATANTNMFTYEIAPVFILMENVVLTKMREIIGWSGGDSILAPGGSISNLYAFLAARHKMFPNYKEHGSVGLPGTLVMFTSDQCHYSIKSCAAVCGLGTDHCIVVPSDEHGKMITSELERLILERKAKGDIPFFVNATAGTTVLGAFDDINTIADICQKYNCWMHIDAAWGGGLLMSRKHRHPRFTGVERADSVTWNP...
gamma-aminobutyric acid biosynthetic process glutamate catabolic process larval locomotory behavior neuromuscular junction development olfactory learning response to mechanical stimulus synapse assembly cytoplasm; cytosol glutamate decarboxylase activity pyridoxal phosphate binding Drosophila melanogaster Decarboxylase...
proteolysis
collagen-containing extracellular matrix; extracellular space
serine-type endopeptidase activity serine-type peptidase activity
Homo sapiens
3D-structure Disulfide bond Glycoprotein Hydrolase Phosphoprotein Protease Reference proteome Secreted Serine protease Signal Zymogen
MLNLLLLALP
MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
proteolysis collagen-containing extracellular matrix; extracellular space serine-type endopeptidase activity serine-type peptidase activity Homo sapiens 3D-structure Disulfide bond Glycoprotein Hydrolase Phosphoprotein Protease Reference proteome Secreted Serine protease Signal Zymogen MLNLLLLALP MLNLLLLALPVLASRAYAAPAP...
chemical synaptic transmission chemical synaptic transmission, postsynaptic chloride transmembrane transport gamma-aminobutyric acid signaling pathway monoatomic ion transmembrane transport regulation of postsynaptic membrane potential synaptic transmission, GABAergic
chloride channel complex; dendrite membrane; GABA-A receptor complex; GABA-ergic synapse; neuron projection; postsynapse; postsynaptic specialization membrane; presynaptic active zone membrane; synapse
GABA-A receptor activity GABA-gated chloride ion channel activity inhibitory extracellular ligand-gated monoatomic ion channel activity ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential transmitter-gated monoatomic ion channel activity involved in regulation of postsy...
Rattus norvegicus
3D-structure Cell membrane Chloride Chloride channel Disulfide bond Glycoprotein Ion channel Ion transport Ligand-gated ion channel Membrane Phosphoprotein Postsynaptic cell membrane Receptor Reference proteome Signal Synapse Transmembrane Transmembrane helix Transport
MITTQMWHFY
MITTQMWHFYVTRVGLLLLISILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLLYTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTKAEVIYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTT...
chemical synaptic transmission chemical synaptic transmission, postsynaptic chloride transmembrane transport gamma-aminobutyric acid signaling pathway monoatomic ion transmembrane transport regulation of postsynaptic membrane potential synaptic transmission, GABAergic chloride channel complex; dendrite membrane; GABA-A...
chloride transmembrane transport gamma-aminobutyric acid signaling pathway regulation of postsynaptic membrane potential synaptic transmission, GABAergic
chloride channel complex; dendrite membrane; GABA-A receptor complex; neuron projection; postsynapse; postsynaptic membrane; synapse
GABA-A receptor activity GABA-gated chloride ion channel activity inhibitory extracellular ligand-gated monoatomic ion channel activity
Bos taurus
Cell membrane Chloride Chloride channel Disulfide bond Glycoprotein Ion channel Ion transport Ligand-gated ion channel Membrane Postsynaptic cell membrane Receptor Reference proteome Signal Synapse Transmembrane Transmembrane helix Transport
MVSAKKVPAI
MVSAKKVPAIAMSFGVSFALLHFLCLAACLNESPGQNQKEEKLCPENFTRILDSLLDGYDNRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLNNMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFPMDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSITGEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHSLPKVSYATAMD...
chloride transmembrane transport gamma-aminobutyric acid signaling pathway regulation of postsynaptic membrane potential synaptic transmission, GABAergic chloride channel complex; dendrite membrane; GABA-A receptor complex; neuron projection; postsynapse; postsynaptic membrane; synapse GABA-A receptor activity GABA-gat...
binding of sperm to zona pellucida prevention of polyspermy
collagen-containing extracellular matrix; egg coat; endoplasmic reticulum; extracellular region; multivesicular body; plasma membrane
acrosin binding identical protein binding structural constituent of egg coat
Mus musculus
3D-structure Cell membrane Cleavage on pair of basic residues Direct protein sequencing Disulfide bond Extracellular matrix Fertilization Glycoprotein Membrane Receptor Reference proteome Secreted Signal Transmembrane Transmembrane helix
MARWQRKASV
MARWQRKASVSSPCGRSIYRFLSLLFTLVTSVNSVSLPQSENPAFPGTLICDKDEVRIEFSSRFDMEKWNPSVVDTLGSEILNCTYALDLERFVLKFPYETCTIKVVGGYQVNIRVGDTTTDVRYKDDMYHFFCPAIQAETHEISEIVVCRRDLISFSFPQLFSRLADENQNVSEMGWIVKIGNGTRAHILPLKDAIVQGFNLLIDSQKVTLHVPANATGIVHYVQESSYLYTVQLELLFSTTGQKIVFSSHAICAPDLSVACNATHMTLTIPEFPGKLESVDFGQWSIPEDQWHANGIDKEATNGLRLNFRKSLLKTKP...
binding of sperm to zona pellucida prevention of polyspermy collagen-containing extracellular matrix; egg coat; endoplasmic reticulum; extracellular region; multivesicular body; plasma membrane acrosin binding identical protein binding structural constituent of egg coat Mus musculus 3D-structure Cell membrane Cleavage ...
cell cycle cell division germ-line stem cell population maintenance germ-line stem-cell niche homeostasis negative regulation of DNA-templated transcription nuclear membrane reassembly oogenesis positive regulation of BMP signaling pathway
centrosome; chromosome; cytoplasm; endomembrane system; nuclear envelope lumen; nuclear inner membrane; nuclear membrane; nuclear periphery; nucleoplasm; spindle pole
DNA-binding transcription factor binding transcription corepressor activity
Drosophila melanogaster
Cell cycle Cell division Chromosome Cytoplasm Cytoskeleton Membrane Mitosis Nucleus Phosphoprotein Reference proteome
MADVDDFDSL
MADVDDFDSLSNAELRAKMLAQGLPNIPVTDSSRKVLVKRLRASIGGQASPAASPKKTNRRETLAPAPGAPSAPAAASTPVDKLDGNKVAPATKARRTITAAEAKEPVRRLPEEAIRRRPDEADRLRSEEPVAARKPTTAPAAQPVQTRRTSTSSGSERKVVEPLRKPETIVEQPASSKRADREENYLKVNSLIVLESDEEEDEQLVQAADLVEQEHAARQKTTKLASSGTTTYEYKSKVVEPPRRQVYEATAAPVLPPSVPSARAQTTSSTRSYDYASNPAPGRYSSFVRTAAQGYVTAEAPPVASYSSSYKRTYANEL...
cell cycle cell division germ-line stem cell population maintenance germ-line stem-cell niche homeostasis negative regulation of DNA-templated transcription nuclear membrane reassembly oogenesis positive regulation of BMP signaling pathway centrosome; chromosome; cytoplasm; endomembrane system; nuclear envelope lumen; ...
animal organ regeneration cell cycle G1/S phase transition cell division cellular response to cocaine cellular response to estradiol stimulus cellular response to hypoxia cellular response to insulin-like growth factor stimulus cellular response to leptin stimulus cellular response to luteinizing hormone stimulus cellu...
cyclin A2-CDK1 complex; cyclin A2-CDK2 complex; cyclin-dependent protein kinase holoenzyme complex; cytoplasm; cytosol; female pronucleus; male pronucleus; nucleoplasm; nucleus
cyclin-dependent protein serine/threonine kinase regulator activity protein domain specific binding protein kinase binding
Homo sapiens
3D-structure Acetylation Cell cycle Cell division Cyclin Cytoplasm Host-virus interaction Mitosis Nucleus Phosphoprotein Reference proteome Ubl conjugation
MLGNSAPGPA
MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFL...
animal organ regeneration cell cycle G1/S phase transition cell division cellular response to cocaine cellular response to estradiol stimulus cellular response to hypoxia cellular response to insulin-like growth factor stimulus cellular response to leptin stimulus cellular response to luteinizing hormone stimulus cellu...
central nervous system development cerebral cortex radially oriented cell migration chemical homeostasis forebrain ventricular zone progenitor cell division metanephric ascending thin limb development metanephric DCT cell differentiation metanephric loop of Henle development metanephric macula densa development metanep...
chromatin; nucleoplasm; nucleus
DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific HMG box domain binding protein homodimerization activity RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific DNA binding
Homo sapiens
Developmental protein Disease variant DNA-binding Homeobox Intellectual disability Neurogenesis Nucleus Reference proteome Transcription Transcription regulation
MATAASNPYL
MATAASNPYLPGNSLLAAGSIVHSDAAGAGGGGGGGGGGGGGGAGGGGGGMQPGSAAVTSGAYRGDPSSVKMVQSDFMQGAMAASNGGHMLSHAHQWVTALPHAAAAAAAAAAAAVEASSPWSGSAVGMAGSPQQPPQPPPPPPQGPDVKGGAGRDDLHAGTALHHRGPPHLGPPPPPPHQGHPGGWGAAAAAAAAAAAAAAAAHLPSMAGGQQPPPQSLLYSQPGGFTVNGMLSAPPGPGGGGGGAGGGAQSLVHPGLVRGDTPELAEHHHHHHHHAHPHPPHPHHAQGPPHHGGGGGGAGPGLNSHDPHSDEDTPTSD...
central nervous system development cerebral cortex radially oriented cell migration chemical homeostasis forebrain ventricular zone progenitor cell division metanephric ascending thin limb development metanephric DCT cell differentiation metanephric loop of Henle development metanephric macula densa development metanep...
cellular response to organic substance cerebral cortex radially oriented cell migration epidermis development forebrain astrocyte development forebrain ventricular zone progenitor cell division hypothalamus cell differentiation myelination in peripheral nervous system negative regulation of gene expression nervous syst...
chromatin; nucleoplasm; transcription regulator complex
DNA binding DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific identical protein binding RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific double-st...
Homo sapiens
3D-structure Activator Alternative initiation Differentiation DNA-binding Homeobox Neurogenesis Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation
MATAASNHYS
MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSHGGGGGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHGPGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPSMGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKN...
cellular response to organic substance cerebral cortex radially oriented cell migration epidermis development forebrain astrocyte development forebrain ventricular zone progenitor cell division hypothalamus cell differentiation myelination in peripheral nervous system negative regulation of gene expression nervous syst...
epidermis development forebrain development glial cell differentiation keratinocyte differentiation myelination myelination in peripheral nervous system negative regulation of DNA-templated transcription negative regulation of transcription by RNA polymerase II positive regulation of DNA-templated transcription positiv...
nucleus; transcription regulator complex
DNA binding DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific DNA-binding transcription repressor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific DNA binding sequence-specific doubl...
Rattus norvegicus
Activator DNA-binding Homeobox Nucleus Reference proteome Repressor Transcription Transcription regulation
MATTAQYLPR
MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAAAERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAGGGSTGRADDGGGGGGFHARLVHQGAAHAGAAWAQGGTAHHLGPAMSPSPGAGGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGGGGAGPGLHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHAGGLHAAAAHLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEET...
epidermis development forebrain development glial cell differentiation keratinocyte differentiation myelination myelination in peripheral nervous system negative regulation of DNA-templated transcription negative regulation of transcription by RNA polymerase II positive regulation of DNA-templated transcription positiv...
cell differentiation multicellular organismal-level water homeostasis regulation of DNA-templated transcription regulation of transcription by RNA polymerase II transdifferentiation
cytoplasm; cytosol; nucleus
DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding
Caenorhabditis elegans
Developmental protein Differentiation DNA-binding Homeobox Nucleus Reference proteome
MLIPSSSSIP
MLIPSSSSIPSSLSASASDSEPSSLNGSGISDQNILPNYHLHHHLINENEMEAANYAQVIKPTCEAFQDWPHTPMLYQQPQLHFMLPQHDWAYPHLAQSLPPPHHLTPSTAAVAAATIASQSSIINQTSVVTSTPSCQIKQEVERPEIIQRLMPPWPPAYQFSCDDSGSVSGAGGPHQPLSDISDDSEQTCPDDLEGFAKQFKQRRIKLGYTQADVGVALGTLYGNIFSQTTICRFEALQLSFKNMCKLKPLLFKWLEEADSTTGSPNSTFEKMTGQAGRKRKKRTSIEVNVKSRLEFHFQSNQKPNAQEITQVAMELQL...
cell differentiation multicellular organismal-level water homeostasis regulation of DNA-templated transcription regulation of transcription by RNA polymerase II transdifferentiation cytoplasm; cytosol; nucleus DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specifi...
neuron development neuron differentiation positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II thermosensory behavior
nucleus
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II transcription regulatory region sequence-specific DNA binding zinc ion binding
Caenorhabditis elegans
Developmental protein Differentiation DNA-binding Homeobox LIM domain Metal-binding Neurogenesis Nucleus Reference proteome Repeat Zinc
MLGHNILTLG
MLGHNILTLGECDELDNHIVMCSTGLLSPQEDFSNVNAGHPNNEEAICSLCDKKIRDRFVSKVNGRCYHSSCLRCSTCKDELGATCFLREDSMYCRAHFYKKFGTKCSSCNEGIVPDHVVRKASNHVYHVECFQCFICKRSLETGEEFYLIADDARLVCKDDYEQARDKHCNELEGDGSNKRPRTTISAKSLETLKQAYQTSSKPARHVREQLASETGLDMRVVQVWFQNRRAKEKRLKKDAGRRWKSSNRAESDSNSPIESINGQSPNYLYLDHPMDDGNESNYLFHSREQTPDKYYRNETPSTDPPPMHMTTPSVLTT...
neuron development neuron differentiation positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II thermosensory behavior nucleus DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity, RNA polymerase II-specif...
B cell activation cell adhesion negative regulation of B cell receptor signaling pathway negative regulation of calcium-mediated signaling negative regulation of immunoglobulin production regulation of B cell proliferation regulation of endocytosis regulation of immune response
cell surface; cytoplasm; early endosome; external side of plasma membrane; extracellular exosome; membrane; neuronal cell body membrane; plasma membrane; recycling endosome
carbohydrate binding CD4 receptor binding IgM binding protein phosphatase binding sialic acid binding signaling receptor binding
Homo sapiens
3D-structure Alternative splicing Cell adhesion Cell membrane Disulfide bond Glycoprotein Immunoglobulin domain Isopeptide bond Lectin Membrane Phosphoprotein Reference proteome Repeat Signal Transmembrane Transmembrane helix
MHLLGPWLLL
MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRS...
B cell activation cell adhesion negative regulation of B cell receptor signaling pathway negative regulation of calcium-mediated signaling negative regulation of immunoglobulin production regulation of B cell proliferation regulation of endocytosis regulation of immune response cell surface; cytoplasm; early endosome; ...
lens development in camera-type eye
plasma membrane
structural constituent of eye lens
Bos taurus
Direct protein sequencing Disulfide bond Eye lens protein Glycoprotein Membrane Phosphoprotein Reference proteome Transmembrane Transmembrane helix
MYSFMGGGLF
MYSFMGGGLFCAWVGTILLVVATATDHWMQYRLSGAFAHQGLWRYCLGTKCYLQTESIAYWNATRAFMILSSLCATSGIIMGIVAFAQQPTFTRLSRPFSAGIMFFASTFFVLLALAIYTGVTVSFLGRRFGDWRFSWSYILGWVALLMTFFAGIFYMCAYRMHECRRLSTPR
lens development in camera-type eye plasma membrane structural constituent of eye lens Bos taurus Direct protein sequencing Disulfide bond Eye lens protein Glycoprotein Membrane Phosphoprotein Reference proteome Transmembrane Transmembrane helix MYSFMGGGLF MYSFMGGGLFCAWVGTILLVVATATDHWMQYRLSGAFAHQGLWRYCLGTKCYLQTESIAYWNA...
adenylate cyclase-activating adrenergic receptor signaling pathway adenylate cyclase-inhibiting dopamine receptor signaling pathway hyaloid vascular plexus regression negative regulation of cytosolic calcium ion concentration negative regulation of lactation negative regulation of prolactin secretion negative regulatio...
glutamatergic synapse; Golgi membrane; plasma membrane
dopamine neurotransmitter receptor activity, coupled via Gi/Go G protein-coupled receptor activity
Bos taurus
Alternative splicing Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Golgi apparatus Lipoprotein Membrane Palmitate Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MDPLNLSWYD
MDPLNLSWYDDDPESRNWSRPFNGSEGKADRPPYNYYAMLLTLLIFVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPMLFGLNNTDQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRANLKAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPD...
adenylate cyclase-activating adrenergic receptor signaling pathway adenylate cyclase-inhibiting dopamine receptor signaling pathway hyaloid vascular plexus regression negative regulation of cytosolic calcium ion concentration negative regulation of lactation negative regulation of prolactin secretion negative regulatio...
in utero embryonic development negative regulation of protein localization to endoplasmic reticulum protein transport
cytoplasm; cytosol; nascent polypeptide-associated complex; nucleus; polysomal ribosome
RNA binding
Homo sapiens
3D-structure Alternative splicing Chaperone Cytoplasm Methylation Nucleus Phosphoprotein Protein transport Reference proteome Transcription Transcription regulation Transport
MRRTGAPAQA
MRRTGAPAQADSRGRGRARGGCPGGEATLSQPPPRGGTRGQEPQMKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN
in utero embryonic development negative regulation of protein localization to endoplasmic reticulum protein transport cytoplasm; cytosol; nascent polypeptide-associated complex; nucleus; polysomal ribosome RNA binding Homo sapiens 3D-structure Alternative splicing Chaperone Cytoplasm Methylation Nucleus Phosphoprotein ...
cellular response to calcium ion leukotriene biosynthetic process leukotriene production involved in inflammatory response lipoxygenase pathway positive regulation of acute inflammatory response protein homotrimerization
endoplasmic reticulum; endoplasmic reticulum membrane; nuclear envelope; nuclear membrane; nucleus
arachidonic acid binding enzyme activator activity enzyme binding glutathione peroxidase activity glutathione transferase activity identical protein binding leukotriene-C4 synthase activity protein-containing complex binding
Rattus norvegicus
Direct protein sequencing Endoplasmic reticulum Leukotriene biosynthesis Membrane Nucleus Reference proteome Transmembrane Transmembrane helix
MDQEAVGNVV
MDQEAVGNVVLLAIVTLISVVQNAFFAHKVELESKAQSGRSFQRTGTLAFERVYTANQNCVDAYPTFLVVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSLAGILNHYLIFFFGSDFENYIRTITTTISPLLLIP
cellular response to calcium ion leukotriene biosynthetic process leukotriene production involved in inflammatory response lipoxygenase pathway positive regulation of acute inflammatory response protein homotrimerization endoplasmic reticulum; endoplasmic reticulum membrane; nuclear envelope; nuclear membrane; nucleus ...
cellular response to calcium ion leukotriene biosynthetic process leukotriene production involved in inflammatory response lipoxygenase pathway positive regulation of acute inflammatory response protein homotrimerization
endoplasmic reticulum; endoplasmic reticulum membrane; membrane; nuclear envelope; nuclear membrane
arachidonate 5-lipoxygenase activity arachidonic acid binding enzyme activator activity enzyme binding glutathione peroxidase activity glutathione transferase activity identical protein binding leukotriene-C4 synthase activity protein-containing complex binding
Homo sapiens
3D-structure Endoplasmic reticulum Leukotriene biosynthesis Membrane Nucleus Reference proteome Transmembrane Transmembrane helix
MDQETVGNVV
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
cellular response to calcium ion leukotriene biosynthetic process leukotriene production involved in inflammatory response lipoxygenase pathway positive regulation of acute inflammatory response protein homotrimerization endoplasmic reticulum; endoplasmic reticulum membrane; membrane; nuclear envelope; nuclear membrane...
astrocyte activation axon regeneration ciliary neurotrophic factor-mediated signaling pathway membrane hyperpolarization muscle organ morphogenesis negative regulation of neuron apoptotic process negative regulation of photoreceptor cell differentiation nervous system development neuron development positive regulation ...
axon; extracellular space; glial cell projection; neuronal cell body; plasma membrane bounded cell projection cytoplasm
ciliary neurotrophic factor receptor binding cytokine activity growth factor activity interleukin-6 receptor binding protein-containing complex binding
Rattus norvegicus
Cytoplasm Developmental protein Differentiation Direct protein sequencing Growth factor Neurogenesis Reference proteome
MAFAEQTPLT
MAFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
astrocyte activation axon regeneration ciliary neurotrophic factor-mediated signaling pathway membrane hyperpolarization muscle organ morphogenesis negative regulation of neuron apoptotic process negative regulation of photoreceptor cell differentiation nervous system development neuron development positive regulation ...
cellular response to glucose starvation central nervous system development dehydroascorbic acid transport glucose import glucose import across plasma membrane glucose transmembrane transport long-chain fatty acid import across plasma membrane photoreceptor cell maintenance protein-containing complex assembly response t...
apical plasma membrane; basolateral plasma membrane; cortical actin cytoskeleton; cytosol; female germ cell nucleus; female pronucleus; glucose transporter complex; Golgi membrane; membrane raft; midbody; photoreceptor inner segment; plasma membrane; presynapse; vesicle
D-glucose transmembrane transporter activity dehydroascorbic acid transmembrane transporter activity glucose transmembrane transporter activity identical protein binding long-chain fatty acid transporter activity protein self-association
Sus scrofa
Acetylation Cell membrane Glycoprotein Membrane Phosphoprotein Reference proteome Sugar transport Transmembrane Transmembrane helix Transport
MEPSSKKLTG
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWLHRYGESISPATLTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFISAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNEELWPLLLSVIFIPALLQCVLLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRDLQEMKEESRQMMREKKVTILELFRSAAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQPVYATIGSGIVNTAF...
cellular response to glucose starvation central nervous system development dehydroascorbic acid transport glucose import glucose import across plasma membrane glucose transmembrane transport long-chain fatty acid import across plasma membrane photoreceptor cell maintenance protein-containing complex assembly response t...
actin filament depolymerization actin filament polymerization actin filament severing actin polymerization or depolymerization barbed-end actin filament capping cell projection assembly central nervous system development cilium assembly
actin cytoskeleton; cytoplasm; cytosol; extracellular region; extracellular space
actin filament binding metal ion binding phosphatidylinositol-4,5-bisphosphate binding
Sus scrofa
Acetylation Actin capping Actin-binding Alternative initiation Calcium Cilium biogenesis/degradation Cytoplasm Cytoskeleton Direct protein sequencing Disulfide bond Metal-binding Phosphoprotein Reference proteome Repeat Secreted Signal
LGALVVALCA
LGALVVALCALSPPARAATASRGAPQARAPQGRVSPMRPSTMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVAVQRLFQVKGRRVVRATEVPVSWESFNRGDCFILDLGNDIYQWCGSNSNRYERLKATQVSKGIRDNERSGRAHVHVSEEDAEPAGMLQVLGPKPTLPEGTEDTVKEDAANRKLAKLYKVSNGAGTMTVSLVADENPFAQGALKSED...
actin filament depolymerization actin filament polymerization actin filament severing actin polymerization or depolymerization barbed-end actin filament capping cell projection assembly central nervous system development cilium assembly actin cytoskeleton; cytoplasm; cytosol; extracellular region; extracellular space a...
acetylcholine receptor signaling pathway adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway calcium-mediated signaling chemical synaptic transmission G protein-coupled acetylcholine receptor signaling pathway G protein-coupled receptor signaling pathway G protein-coupled receptor si...
basal plasma membrane; basolateral plasma membrane; dendrite; endoplasmic reticulum membrane; plasma membrane; postsynaptic membrane; synapse
acetylcholine binding G protein-coupled acetylcholine receptor activity G protein-coupled serotonin receptor activity phosphatidylinositol phospholipase C activity signaling receptor activity
Homo sapiens
3D-structure Cell membrane Disulfide bond Endoplasmic reticulum G-protein coupled receptor Glycoprotein Membrane Phosphoprotein Postsynaptic cell membrane Receptor Reference proteome Synapse Transducer Transmembrane Transmembrane helix
MTLHNNSTTS
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSW...
acetylcholine receptor signaling pathway adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway calcium-mediated signaling chemical synaptic transmission G protein-coupled acetylcholine receptor signaling pathway G protein-coupled receptor signaling pathway G protein-coupled receptor si...
calcium ion homeostasis chloride ion homeostasis hyperosmotic salinity response magnesium ion homeostasis negative regulation of testosterone secretion positive regulation of gene expression positive regulation of oxygen metabolic process positive regulation of P-type sodium:potassium-exchanging transporter activity po...
cytosol; extracellular space
growth hormone receptor binding hormone activity metal ion binding
Oncorhynchus mykiss
Disulfide bond Hormone Metal-binding Secreted Signal Zinc
MGQVFLLMPV
MGQVFLLMPVLLVSCFLGQGAAMENQRLFNIAVNRVQHLHLLAQKMFNDFEGTLLPDERRQLNKIFLLDFCNSDSIVSPIDKQETQKSSVLKLLHISFRLIESWEYPSQTLTISNSLMVRNSNQISEKLSDLKVGINLLIKGSQDGVLSLDDNDSQHLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKYLEANCTL
calcium ion homeostasis chloride ion homeostasis hyperosmotic salinity response magnesium ion homeostasis negative regulation of testosterone secretion positive regulation of gene expression positive regulation of oxygen metabolic process positive regulation of P-type sodium:potassium-exchanging transporter activity po...
aortic valve development cellular response to growth factor stimulus cellular response to lipopolysaccharide extrinsic apoptotic signaling pathway glial cell-neuron signaling immune response inflammatory response intrinsic apoptotic signaling pathway in response to DNA damage negative regulation of cardiac muscle hyper...
extracellular region; membrane; membrane raft; neuronal cell body; perinuclear region of cytoplasm; plasma membrane; specific granule membrane; tumor necrosis factor receptor superfamily complex; varicosity
tumor necrosis factor binding tumor necrosis factor receptor activity ubiquitin protein ligase binding
Homo sapiens
3D-structure Alternative splicing Apoptosis Cell membrane Direct protein sequencing Disulfide bond Glycoprotein Membrane Pharmaceutical Phosphoprotein Receptor Reference proteome Repeat Secreted Signal Transmembrane Transmembrane helix
MAPVAVWAAL
MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKVPHLPADKARGTQGPEQQHLL...
aortic valve development cellular response to growth factor stimulus cellular response to lipopolysaccharide extrinsic apoptotic signaling pathway glial cell-neuron signaling immune response inflammatory response intrinsic apoptotic signaling pathway in response to DNA damage negative regulation of cardiac muscle hyper...
apoptotic process negative regulation of cell population proliferation regulation of cell population proliferation regulation of immature T cell proliferation in thymus
external side of plasma membrane
signaling receptor activity
Mus musculus
3D-structure Cell membrane Direct protein sequencing Disulfide bond Glycoprotein Membrane Receptor Reference proteome Repeat Signal Transmembrane Transmembrane helix
MGNNCYNVVV
MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
apoptotic process negative regulation of cell population proliferation regulation of cell population proliferation regulation of immature T cell proliferation in thymus external side of plasma membrane signaling receptor activity Mus musculus 3D-structure Cell membrane Direct protein sequencing Disulfide bond Glycoprot...
antigen processing and presentation positive regulation of dopamine uptake involved in synaptic transmission protein localization to plasma membrane protein secretion regulation of exocytosis regulation of synaptic vesicle cycle regulation of vesicle size vesicle docking involved in exocytosis
cytoplasm; dopaminergic synapse; endosome; extracellular exosome; Golgi apparatus; perinuclear region of cytoplasm; plasma membrane; synaptic vesicle; synaptic vesicle membrane; vesicle
GDP binding GTP binding GTPase activity myosin V binding
Homo sapiens
3D-structure Acetylation Cell membrane Golgi apparatus GTP-binding Lipoprotein Membrane Methylation Nucleotide-binding Phosphoprotein Prenylation Protein transport Reference proteome Transport
MASVTDGKTG
MASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC
antigen processing and presentation positive regulation of dopamine uptake involved in synaptic transmission protein localization to plasma membrane protein secretion regulation of exocytosis regulation of synaptic vesicle cycle regulation of vesicle size vesicle docking involved in exocytosis cytoplasm; dopaminergic s...
antigen processing and presentation protein transport Rab protein signal transduction regulation of endocytosis vesicle-mediated transport
cytoplasmic vesicle membrane; early endosome membrane; extracellular exosome; insulin-responsive compartment; perinuclear region of cytoplasm; postsynaptic recycling endosome; recycling endosome membrane; vesicle
G protein activity GDP binding GTP binding GTPase activity
Homo sapiens
3D-structure Cytoplasm Endosome GTP-binding Hydrolase Lipoprotein Membrane Methylation Nucleotide-binding Phosphoprotein Prenylation Protein transport Reference proteome Transport
MSQTAMSETY
MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC
antigen processing and presentation protein transport Rab protein signal transduction regulation of endocytosis vesicle-mediated transport cytoplasmic vesicle membrane; early endosome membrane; extracellular exosome; insulin-responsive compartment; perinuclear region of cytoplasm; postsynaptic recycling endosome; recyc...
amyloid-beta clearance by transcytosis canonical Wnt signaling pathway early endosome to late endosome transport endocytosis intracellular protein transport modulation by host of viral process phagocytosis positive regulation of exocytosis receptor internalization regulation of autophagosome assembly regulation of endo...
actin cytoskeleton; axon; axon terminus; clathrin-coated endocytic vesicle membrane; cytoplasm; cytoplasmic side of early endosome membrane; cytosol; dendrite; early endosome; early endosome membrane; early phagosome; endomembrane system; endosome; endosome membrane; extracellular exosome; intracellular membrane-bounde...
G protein activity GDP binding GTP binding GTPase activity
Homo sapiens
3D-structure Alternative splicing Cell membrane Cell projection Cytoplasm Cytoplasmic vesicle Endocytosis Endosome Glycoprotein GTP-binding Hydrolase Lipoprotein Membrane Nucleotide-binding Phagocytosis Phosphoprotein Prenylation Protein transport Reference proteome Transport
MASRGATRPN
MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
amyloid-beta clearance by transcytosis canonical Wnt signaling pathway early endosome to late endosome transport endocytosis intracellular protein transport modulation by host of viral process phagocytosis positive regulation of exocytosis receptor internalization regulation of autophagosome assembly regulation of endo...
antigen processing and presentation early endosome to Golgi transport intra-Golgi vesicle-mediated transport intracellular protein transport localization minus-end-directed organelle transport along microtubule neuron projection development peptidyl-cysteine methylation protein localization to Golgi apparatus protein l...
acrosomal membrane; cytoplasmic vesicle; cytosol; endomembrane system; endoplasmic reticulum membrane; endosome to plasma membrane transport vesicle; extracellular exosome; Golgi apparatus; Golgi membrane; membrane; plasma membrane; secretory granule membrane; trans-Golgi network; trans-Golgi network membrane
GTP binding GTPase activity myosin V binding protein domain specific binding
Homo sapiens
3D-structure Acetylation Alternative splicing Cytoplasmic vesicle Direct protein sequencing ER-Golgi transport Golgi apparatus GTP-binding Host-virus interaction Lipoprotein Membrane Methylation Nucleotide-binding Phosphoprotein Prenylation Protein transport Reference proteome Transport
MSTGGDFGNP
MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSEGGCSC
antigen processing and presentation early endosome to Golgi transport intra-Golgi vesicle-mediated transport intracellular protein transport localization minus-end-directed organelle transport along microtubule neuron projection development peptidyl-cysteine methylation protein localization to Golgi apparatus protein l...
adhesion receptor-mediated virion attachment to host cell disruption of host cell envelope during viral entry viral entry into host cell virion attachment to host cell
virus tail, fiber
ATP binding metal ion binding
Bacillus phage phi29
3D-structure ATP-binding Degradation of host cell envelope components during virus entry Host-virus interaction Late protein Magnesium Metal-binding Nucleotide-binding Reference proteome Repeat Viral attachment to host adhesion receptor Viral attachment to host cell Viral tail fiber protein Viral tail protein Virion Vi...
MSTKPELKRF
MSTKPELKRFEQFGEMMVQLYERYLPTAFDESLTLLEKMNKIIHYLNEIGKVTNELIEEWNKVMEWILNDGLEDLVKETLERWYEEGKFADLVIQVIDELKQFGVSVKTYGAKGDGVTDDIRAFEKAIESGFPVYVPYGTFMVSRGIKLPSNTVLTGAGKRNAVIKFMDSVGRGESLMYNQNVTTGNENIFLSSFTLDGNNKRLGQGISGIGGSRESNLSIRACHNVYIRDIEAVDCTLHGIDITCGGLDYPYLGDGTTAPNPSENIWIENCEATGFGDDGITTHHSQYINILNCYSHDPRLTANCNGFEIDDGSRHVVL...
adhesion receptor-mediated virion attachment to host cell disruption of host cell envelope during viral entry viral entry into host cell virion attachment to host cell virus tail, fiber ATP binding metal ion binding Bacillus phage phi29 3D-structure ATP-binding Degradation of host cell envelope components during virus ...
activation of plasma proteins involved in acute inflammatory response blood coagulation cytokine-mediated signaling pathway positive regulation of angiogenesis positive regulation of endothelial cell proliferation positive regulation of gene expression positive regulation of interleukin-8 production positive regulation...
cell surface; collagen-containing extracellular matrix; extracellular space; membrane; serine-type peptidase complex
cytokine receptor activity phospholipid binding protease binding
Mus musculus
Blood coagulation Disulfide bond Glycoprotein Hemostasis Lipoprotein Membrane Palmitate Reference proteome Signal Transmembrane Transmembrane helix
MAILVRPRLL
MAILVRPRLLAALAPTFLGCLLLQVIAGAGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGETLIIVGAVVLLATIFIILLSISLCKRRKNRAGQKGKNTPSRLA
activation of plasma proteins involved in acute inflammatory response blood coagulation cytokine-mediated signaling pathway positive regulation of angiogenesis positive regulation of endothelial cell proliferation positive regulation of gene expression positive regulation of interleukin-8 production positive regulation...
adenylate cyclase-modulating G protein-coupled receptor signaling pathway asymmetric cell division asymmetric neuroblast division asymmetric protein localization involved in cell fate determination axon ensheathment in central nervous system calcium-mediated signaling cortical actin cytoskeleton organization establishm...
apical cortex; apical plasma membrane; cell cortex; heterotrimeric G-protein complex; plasma membrane
DNA binding G protein-coupled receptor binding G-protein beta/gamma-subunit complex binding GTP binding GTPase activity metal ion binding
Drosophila melanogaster
Cell membrane Differentiation GTP-binding Lipoprotein Magnesium Membrane Metal-binding Myristate Nucleotide-binding Palmitate Reference proteome Transducer
MGCAVSTARD
MGCAVSTARDKEAIERSKNIDRALRAEGERAASEVKLLLLGAGESGKSTIVKQMKIIHDTGYSQEECEEYRRVVFSNTVQSLMVIIRAMGRLKIEFADPSRTDIARQFFTHASAADEGILLPEIVLLMKKLWADGGVQQSFARSREYQLNDSAGYYLNSLDRIAQPNYIPTQQDVLRTRVKTTGIIETHFSCKQLHFKLFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDEEMNRMIESLKLFDSICNSKWFVETSIILFLNKKDLFEEKIKRSPLTICFPEYTGTNTFEEAANYIRMKFENLNKRKDQKEI...
adenylate cyclase-modulating G protein-coupled receptor signaling pathway asymmetric cell division asymmetric neuroblast division asymmetric protein localization involved in cell fate determination axon ensheathment in central nervous system calcium-mediated signaling cortical actin cytoskeleton organization establishm...
adenylate cyclase-activating dopamine receptor signaling pathway behavioral response to cocaine chemical synaptic transmission G protein-coupled receptor signaling pathway imaginal disc-derived wing morphogenesis instar larval or pupal development learning or memory neuromuscular junction development positive regulatio...
basement membrane; heterotrimeric G-protein complex; plasma membrane; synapse
G protein-coupled receptor binding G-protein beta/gamma-subunit complex binding GTP binding GTPase activity metal ion binding
Drosophila melanogaster
Alternative splicing GTP-binding Lipoprotein Magnesium Metal-binding Nucleotide-binding Palmitate Reference proteome Transducer
MGCFGSPTSK
MGCFGSPTSKQSDVNSEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRILHVDGFSDSEKKQKIDDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQDYASSPDFNYPPEFYEHTEELWKDKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESLDLFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKSKLSEYFSEFNKYQTPIDTGDAIMESN...
adenylate cyclase-activating dopamine receptor signaling pathway behavioral response to cocaine chemical synaptic transmission G protein-coupled receptor signaling pathway imaginal disc-derived wing morphogenesis instar larval or pupal development learning or memory neuromuscular junction development positive regulatio...
cell-cell signaling cellular response to nerve growth factor stimulus chemical synaptic transmission detection of abiotic stimulus inflammatory response insemination neuropeptide signaling pathway positive regulation of cytosolic calcium ion concentration response to pain sensory perception of pain tachykinin receptor ...
axon; extracellular region; extracellular space; neuronal cell body; synapse
substance P receptor binding
Homo sapiens
3D-structure Alternative splicing Amidation Cleavage on pair of basic residues Direct protein sequencing Neuropeptide Neurotransmitter Reference proteome Secreted Signal
MKILVALAVF
MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR
cell-cell signaling cellular response to nerve growth factor stimulus chemical synaptic transmission detection of abiotic stimulus inflammatory response insemination neuropeptide signaling pathway positive regulation of cytosolic calcium ion concentration response to pain sensory perception of pain tachykinin receptor ...
adult somatic muscle development dorsal appendage formation dorsal/ventral pattern formation positive regulation of transcription by RNA polymerase II positive regulation of transcription elongation by RNA polymerase II regulation of DNA-templated transcription
cytosol; nucleus
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific metal ion binding RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific DNA binding
Drosophila melanogaster
Alternative splicing DNA-binding Metal-binding Nucleus Reference proteome Repeat Transcription Transcription regulation Zinc Zinc-finger
MIKSTTNPQE
MIKSTTNPQEQRLPRPEDQSPAPPPPPPSSATTSTAAPATPTHQVATVIANMDTLKTAFLPNLSMDPNVHVSPHYCPMCHQQFERPQHVADHMQLCHGITLNAQGAIATLDGGHPQAQQHPKLSHPCFNCDEKFGNAVDLDEHHRLAHQTPAFLSRCLMCSIYGIHSATQQPNEYKCTQCGSICTTAMLAAGQQGFMEQQEAAVTPDDQLPAMAPRDMRLTPEEQHHQQQLQAEHHHQQQHQQQQQQQQQQQELLEQQQREMQEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNKNANGGAIVSHPQVIIKEEPLSL...
adult somatic muscle development dorsal appendage formation dorsal/ventral pattern formation positive regulation of transcription by RNA polymerase II positive regulation of transcription elongation by RNA polymerase II regulation of DNA-templated transcription cytosol; nucleus DNA-binding transcription activator activ...
adult walking behavior cell-cell signaling eating behavior histamine metabolic process hormone-mediated signaling pathway negative regulation of glutamate secretion positive regulation of gamma-aminobutyric acid secretion positive regulation of insulin secretion signal transduction
extracellular region; secretory granule
thyrotropin-releasing hormone activity
Homo sapiens
Amidation Cleavage on pair of basic residues Hormone Reference proteome Repeat Secreted Signal
MPGPWLLLAL
MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQRLQGDQGEHSASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRRSPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE
adult walking behavior cell-cell signaling eating behavior histamine metabolic process hormone-mediated signaling pathway negative regulation of glutamate secretion positive regulation of gamma-aminobutyric acid secretion positive regulation of insulin secretion signal transduction extracellular region; secretory granu...
cell differentiation
cytoplasm; nucleus; plasma membrane
ATP binding
Xenopus laevis
ATP-binding Cell membrane Cytoplasm Developmental protein Differentiation Lipoprotein Membrane Methylation Nucleotide-binding Nucleus Palmitate Phosphoprotein Prenylation Reference proteome Repeat
MSLQQLKRKS
MSLQQLKRKSLRDGWLMDGVVPSPGAEIDSPLFQTESKIQQLEKELESLQMQQLRLENPAAVQPEAKAIQTPFLNGEKIQQGGGQAGDAKEVTAGQANNTHGIIHEEQPTKEDQDMGTVLPIPAPRGKTVPKEDENQANPELKVDMEHQKVELVDLIQECPVENQTVEHVEKNKPHLDQEHTEKNQDGQHGILEFLTQDQQLGNPNLQHLDRYLITEVTVKHFEKNQAHPGQEKNQDEQHGILKYLTQDQQNENPNLGHLDQYLITEITLQSNPLENISVHDQTQSTSDQNMETKLPTDIPQQKESQSEGKIQTKDQGPE...
cell differentiation cytoplasm; nucleus; plasma membrane ATP binding Xenopus laevis ATP-binding Cell membrane Cytoplasm Developmental protein Differentiation Lipoprotein Membrane Methylation Nucleotide-binding Nucleus Palmitate Phosphoprotein Prenylation Reference proteome Repeat MSLQQLKRKS MSLQQLKRKSLRDGWLMDGVVPSPGAEI...
cellular response to UV-A negative regulation of catalytic activity negative regulation of endopeptidase activity negative regulation of membrane protein ectodomain proteolysis positive regulation of cell population proliferation regulation of integrin-mediated signaling pathway response to cytokine response to hormone...
extracellular matrix; extracellular space
cytokine activity growth factor activity metalloendopeptidase inhibitor activity protease binding zinc ion binding
Bos taurus
Direct protein sequencing Disulfide bond Glycoprotein Growth factor Metal-binding Metalloenzyme inhibitor Metalloprotease inhibitor Phosphoprotein Protease inhibitor Reference proteome Secreted Signal Zinc
MAPFAPMASG
MAPFAPMASGILLLLWLTAPSRACTCVPPHPQTAFCNSDVVIRAKFVGTAEVNETALYQRYEIKMTKMFKGFSALRDAPDIRFIYTPAMESVCGYFHRSQNRSEEFLIAGQLSNGHLHITTCSFVAPWNSMSSAQRRGFTKTYAAGCEECTVFPCSSIPCKLQSDTHCLWTDQLLTGSDKGFQSRHLACLPREPGLCTWQSLRAQMA
cellular response to UV-A negative regulation of catalytic activity negative regulation of endopeptidase activity negative regulation of membrane protein ectodomain proteolysis positive regulation of cell population proliferation regulation of integrin-mediated signaling pathway response to cytokine response to hormone...
actin cytoskeleton organization dephosphorylation endoplasmic reticulum unfolded protein response insulin receptor recycling insulin receptor signaling pathway IRE1-mediated unfolded protein response negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway negative regulation of...
cytoplasm; cytoplasmic side of endoplasmic reticulum membrane; early endosome; endoplasmic reticulum; endosome lumen; mitochondrial crista; mitochondrial matrix; plasma membrane; protein-containing complex; sorting endosome
enzyme binding ephrin receptor binding insulin receptor binding non-membrane spanning protein tyrosine phosphatase activity protein kinase binding protein phosphatase 2A binding protein tyrosine phosphatase activity receptor tyrosine kinase binding zinc ion binding
Rattus norvegicus
Acetylation Endoplasmic reticulum Hydrolase Membrane Phosphoprotein Protein phosphatase Reference proteome S-nitrosylation
MEMEKEFEQI
MEMEKEFEQIDKAGNWAAIYQDIRHEASDFPCRIAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRIMEKGSLKCAQYWPQKEEKEMVFDDTNLKLTLISEDVKSYYTVRQLELENLATQEAREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRRFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHVPPPPRPPKRTLEPH...
actin cytoskeleton organization dephosphorylation endoplasmic reticulum unfolded protein response insulin receptor recycling insulin receptor signaling pathway IRE1-mediated unfolded protein response negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway negative regulation of...
behavioral response to nicotine cellular response to nicotine detection of mechanical stimulus involved in sensory perception of pain hippocampus development presynaptic modulation of chemical synaptic transmission regulation of neuronal action potential response to nicotine synaptic transmission, cholinergic
acetylcholine-gated channel complex; dendrite; dopaminergic synapse; neuron projection; neuronal cell body; postsynaptic membrane; presynapse; synapse
acetylcholine binding acetylcholine receptor activity acetylcholine-gated monoatomic cation-selective channel activity protein-containing complex binding
Rattus norvegicus
Cell membrane Disulfide bond Glycoprotein Ion channel Ion transport Ligand-gated ion channel Membrane Postsynaptic cell membrane Receptor Reference proteome Signal Synapse Transmembrane Transmembrane helix Transport
MVQLLAGRWR
MVQLLAGRWRPTGARRGTRGGLPELSSAAKHEDSLFRDLFEDYERWVRPVEHLSDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKIIRVPSDSLWIPDIVLFDNADGRFEGASTKTVVRYNGTVTWTQPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDRTDFFDNGEWEIMSAMGSKGNRTDSCCWYPYITYSFVIKRLPLFYTLFLIIPCIGLSFLTVVVFYLPSNEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAI...
behavioral response to nicotine cellular response to nicotine detection of mechanical stimulus involved in sensory perception of pain hippocampus development presynaptic modulation of chemical synaptic transmission regulation of neuronal action potential response to nicotine synaptic transmission, cholinergic acetylcho...
SRP-dependent cotranslational protein targeting to membrane SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition SRP-dependent cotranslational protein targeting to membrane, translocation
cytosol; endoplasmic reticulum; signal recognition particle, endoplasmic reticulum targeting
7S RNA binding ATP hydrolysis activity endoplasmic reticulum signal peptide binding GTP binding GTPase activator activity GTPase activity
Saccharomyces cerevisiae
Cytoplasm Endoplasmic reticulum GTP-binding GTPase activation Hydrolase Nucleotide-binding Reference proteome Ribonucleoprotein RNA-binding Signal recognition particle
MVLADLGKRI
MVLADLGKRINSAVNNAISNTQDDFTTSVDVMLKGIVTALLESDVNIALVSKLRNNIRSQLLSENRSEKSTTNAQTKKLIQKTVFDELCKLVTCEGSEEKAFVPKKRKTNIIMFVGLQGSGKTTSCTKLAVYYSKRGFKVGLVCADTFRAGAFDQLKQNAIRARIPFYGSYTETDPAKVAEEGINKFKKEKFDIIIVDTSGRHHQEEELFQEMIEISNVIKPNQTIMVLDASIGQAAEQQSKAFKESSDFGAIILTKMDGHARGGGAISAVAATNTPIIFIGTGEHIHDLEKFSPKSFISKLLGIGDIESLFEQLQTVSN...
SRP-dependent cotranslational protein targeting to membrane SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition SRP-dependent cotranslational protein targeting to membrane, translocation cytosol; endoplasmic reticulum; signal recognition particle, endoplasmic reticulum targeting 7S ...
de novo' pyrimidine nucleobase biosynthetic process CDP biosynthetic process nucleotide salvage phosphorylation pyrimidine nucleobase salvage UDP biosynthetic process
cytoplasm; nucleus
ATP binding CMP kinase activity cytidylate kinase activity dCMP kinase activity magnesium ion binding phosphotransferase activity, phosphate group as acceptor UMP kinase activity
Dictyostelium discoideum
3D-structure ATP-binding Cytoplasm Kinase Nucleotide-binding Nucleus Pyrimidine biosynthesis Reference proteome Transferase
MMEKSKPNVV
MMEKSKPNVVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDVENLFKSMGF
de novo' pyrimidine nucleobase biosynthetic process CDP biosynthetic process nucleotide salvage phosphorylation pyrimidine nucleobase salvage UDP biosynthetic process cytoplasm; nucleus ATP binding CMP kinase activity cytidylate kinase activity dCMP kinase activity magnesium ion binding phosphotransferase activity, pho...
proton export across plasma membrane proton transmembrane transport
membrane; plasma membrane; plasmodesma; plastid
ATP binding ATP hydrolysis activity magnesium ion binding P-type proton-exporting transporter activity
Arabidopsis thaliana
ATP-binding Cell membrane Hydrogen ion transport Ion transport Magnesium Membrane Metal-binding Nucleotide-binding Phosphoprotein Reference proteome Translocase Transmembrane Transmembrane helix Transport
MASGLEDIVN
MASGLEDIVNENVDLEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVINSTISFVEENNAGNAAAALMAGLAPKTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPATKGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVGIAIEIVVMYPIQRRHYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAITKRMTAIEE...
proton export across plasma membrane proton transmembrane transport membrane; plasma membrane; plasmodesma; plastid ATP binding ATP hydrolysis activity magnesium ion binding P-type proton-exporting transporter activity Arabidopsis thaliana ATP-binding Cell membrane Hydrogen ion transport Ion transport Magnesium Membran...
glutathione metabolic process
cytoplasm
DDT-dehydrochlorinase activity glutathione peroxidase activity glutathione transferase activity
Drosophila melanogaster
3D-structure Detoxification Direct protein sequencing Lyase Reference proteome Transferase
MVDFYYLPGS
MVDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKVTPGWEENWAGCLEFKKYFE
glutathione metabolic process cytoplasm DDT-dehydrochlorinase activity glutathione peroxidase activity glutathione transferase activity Drosophila melanogaster 3D-structure Detoxification Direct protein sequencing Lyase Reference proteome Transferase MVDFYYLPGS MVDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVD...
DNA-templated transcription initiation nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay positive regulation of translational initiation recruitment of 3'-end processing factors to RNA polymerase II holoenzyme complex RNA-templated transcription transcription by RNA polymerase II transcription e...
cytoplasm; nucleus; P-body; RNA polymerase II, core complex; RPB4-RPB7 complex
nucleotide binding translation initiation factor binding
Saccharomyces cerevisiae
3D-structure Acetylation Cytoplasm DNA-directed RNA polymerase mRNA processing Nucleus Phosphoprotein Reference proteome Transcription
MNVSTSTFQT
MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKKHLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
DNA-templated transcription initiation nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay positive regulation of translational initiation recruitment of 3'-end processing factors to RNA polymerase II holoenzyme complex RNA-templated transcription transcription by RNA polymerase II transcription e...
nucleolar large rRNA transcription by RNA polymerase I ribosome biogenesis RNA-templated transcription termination of RNA polymerase I transcription termination of RNA polymerase III transcription transcription by RNA polymerase I transcription by RNA polymerase II transcription by RNA polymerase III transcription elon...
nucleoplasm; nucleus; RNA polymerase I complex; RNA polymerase II, core complex; RNA polymerase III complex
DNA binding RNA polymerase I activity
Saccharomyces cerevisiae
3D-structure DNA-binding DNA-directed RNA polymerase Nucleus Reference proteome Ribosome biogenesis Transcription
MDQENERNIS
MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
nucleolar large rRNA transcription by RNA polymerase I ribosome biogenesis RNA-templated transcription termination of RNA polymerase I transcription termination of RNA polymerase III transcription transcription by RNA polymerase I transcription by RNA polymerase II transcription by RNA polymerase III transcription elon...
nucleolar large rRNA transcription by RNA polymerase I ribosome biogenesis RNA-templated transcription termination of RNA polymerase I transcription termination of RNA polymerase III transcription transcription by RNA polymerase I transcription by RNA polymerase II transcription by RNA polymerase III transcription elon...
cytoplasm; nucleoplasm; nucleus; RNA polymerase I complex; RNA polymerase II, core complex; RNA polymerase III complex
DNA binding RNA polymerase I activity
Saccharomyces cerevisiae
3D-structure Cytoplasm DNA-directed RNA polymerase Nucleus Phosphoprotein Reference proteome Ribosome biogenesis Transcription
MSDYEEAFND
MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
nucleolar large rRNA transcription by RNA polymerase I ribosome biogenesis RNA-templated transcription termination of RNA polymerase I transcription termination of RNA polymerase III transcription transcription by RNA polymerase I transcription by RNA polymerase II transcription by RNA polymerase III transcription elon...
nucleolar large rRNA transcription by RNA polymerase I ribosome biogenesis RNA-templated transcription termination of RNA polymerase I transcription termination of RNA polymerase III transcription transcription by RNA polymerase I transcription by RNA polymerase II transcription by RNA polymerase III transcription elon...
nucleoplasm; nucleus; RNA polymerase I complex; RNA polymerase II, core complex; RNA polymerase III complex
DNA binding RNA polymerase I activity
Saccharomyces cerevisiae
3D-structure Acetylation DNA-binding DNA-directed RNA polymerase Nucleus Phosphoprotein Reference proteome Ribosome biogenesis Transcription
MSNTLFDDIF
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
nucleolar large rRNA transcription by RNA polymerase I ribosome biogenesis RNA-templated transcription termination of RNA polymerase I transcription termination of RNA polymerase III transcription transcription by RNA polymerase I transcription by RNA polymerase II transcription by RNA polymerase III transcription elon...
attachment of spindle microtubules to kinetochore embryonic development via the syncytial blastoderm G2/M transition of mitotic cell cycle germ-line cyst formation midbody abscission mitotic cell cycle phase transition mitotic chromosome movement towards spindle pole mitotic cytokinesis regulation of chromatin binding ...
chromosome, centromeric region; cyclin-dependent protein kinase holoenzyme complex; cytoplasm; nucleus; spindle midzone
cyclin-dependent protein serine/threonine kinase regulator activity
Drosophila melanogaster
Alternative splicing Cell cycle Cell division Cyclin Mitosis Phosphoprotein Reference proteome
MVGTTLKMRG
MVGTTLKMRGDENASENFKQVQLKKLTVPSMEATTKRAALGDLQNRGISRPIAAKDAAQKDSKDLKLTDALRNAKARVDSHWKKQPLGSTNGNGNGAVPPKVNEGGVSAFLRSNSVRNRVPTKTTVEPTKVTVKSSSSENVNEPTLKREDSNLSKKSLTKLRAALAKPVMGVSGIRREPVAVSRKEAETKKELPETKKDSLEVKKDATRMPLIRGNSAVTTTTSTMPTTMSLSSKRLAGIEDIDANDKENLVLVSEYVNDIYDYLYQVELEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDR...
attachment of spindle microtubules to kinetochore embryonic development via the syncytial blastoderm G2/M transition of mitotic cell cycle germ-line cyst formation midbody abscission mitotic cell cycle phase transition mitotic chromosome movement towards spindle pole mitotic cytokinesis regulation of chromatin binding ...
G protein-coupled receptor internalization signal transduction
membrane; photoreceptor inner segment; photoreceptor outer segment
G protein-coupled receptor binding opsin binding phosphoprotein binding spectrin binding
Mus musculus
3D-structure Cell projection Membrane Phosphoprotein Reference proteome
MAACGKTNKS
MAACGKTNKSHVIFKKVSRDKSVTIYLGKRDYVDHVSQVEPVDGVVLVDPELVKGKKVYVTLTCAFRYGQEDIDVMGLTFRRDLYFSRVQVYPPVGAMSVLTQLQESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDVGKSCGVDFEVKAFASDITDPEEDKIPKKSSVRLLIRKVQHAPPEMGPQPSAEASWQFFMSDKPLNLSVSLSKEIYFHGEPIPVTVTVTNNTDKVVKKIKVSVEQIANVVLYSSDYYVKPVASEETQEKVQPNSTLTKTLVLVPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRT...
G protein-coupled receptor internalization signal transduction membrane; photoreceptor inner segment; photoreceptor outer segment G protein-coupled receptor binding opsin binding phosphoprotein binding spectrin binding Mus musculus 3D-structure Cell projection Membrane Phosphoprotein Reference proteome MAACGKTNKS MAACG...
endonucleolytic cleavage in ITS1 upstream of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) rRNA processing
nucleolus; preribosome, large subunit precursor
ATP binding ATP hydrolysis activity ATP-dependent activity, acting on RNA RNA binding RNA helicase activity
Saccharomyces cerevisiae
ATP-binding Helicase Hydrolase Nucleotide-binding Nucleus Reference proteome Ribosome biogenesis RNA-binding rRNA processing
MTKEEIADKK
MTKEEIADKKRKVVDEEVIEKKKSKKHKKDKKDKKEKKDKKHKKHKKEKKGEKEVEVPEKESEKKPEPTSAVASEFYVQSEALTSLPQSDIDEYFKENEIAVEDSLDLALRPLLSFDYLSLDSSIQAEISKFPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQKKRGIQVLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQRIQLKKSQVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETDASKRQTLMFTATWPKEVRELASTFMNNPIKVSIGNT...
endonucleolytic cleavage in ITS1 upstream of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) rRNA processing nucleolus; preribosome, large subunit precursor ATP binding ATP hydrolysis activity ATP-dependent activity, acting on RNA RNA binding RNA helicase activity Saccharomyces cerevisiae A...
maturation of SSU-rRNA rRNA processing
nucleolus; nucleus; small-subunit processome
ATP binding ATP hydrolysis activity ATP-dependent activity, acting on RNA identical protein binding RNA binding RNA helicase activity
Saccharomyces cerevisiae
ATP-binding Helicase Hydrolase Nucleotide-binding Nucleus Phosphoprotein Reference proteome Ribosome biogenesis RNA-binding rRNA processing
MAKKNRLNTT
MAKKNRLNTTQRKTLRQKEDEYIENLKTKIDEYDPKITKAKFFKDLPISDPTLKGLRESSFIKLTEIQADSIPVSLQGHDVLAAAKTGSGKTLAFLVPVIEKLYREKWTEFDGLGALIISPTRELAMQIYEVLTKIGSHTSFSAGLVIGGKDVKFELERISRINILIGTPGRILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVSTLSPSRQTLLFSATQSQSVADLARLSLTDYKTVGTHDVMDGSVNKEASTPETLQQFYIEVPLADKLDILFSFIKSHLKCKMIVFLSSSKQVHFVYETFRKMQPGISL...
maturation of SSU-rRNA rRNA processing nucleolus; nucleus; small-subunit processome ATP binding ATP hydrolysis activity ATP-dependent activity, acting on RNA identical protein binding RNA binding RNA helicase activity Saccharomyces cerevisiae ATP-binding Helicase Hydrolase Nucleotide-binding Nucleus Phosphoprotein Ref...
mRNA export from nucleus poly(A)+ mRNA export from nucleus protein transport translational termination tRNA export from nucleus
cellular bud tip; cytoplasm; cytoplasmic stress granule; nuclear membrane; nuclear pore cytoplasmic filaments; nucleus
ATP binding ATP hydrolysis activity ATP-dependent activity, acting on RNA RNA binding RNA helicase activity
Saccharomyces cerevisiae
3D-structure ATP-binding Cytoplasm Helicase Hydrolase Membrane mRNA transport Nuclear pore complex Nucleotide-binding Nucleus Phosphoprotein Protein transport Reference proteome RNA-binding Translocation Transport
MSDTKRDPAD
MSDTKRDPADLLASLKIDNEKEDTSEVSTKETVKSQPEKTADSIKPAEKLVPKVEEKKTKQEDSNLISSEYEVKVKLADIQADPNSPLYSAKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFDV...
mRNA export from nucleus poly(A)+ mRNA export from nucleus protein transport translational termination tRNA export from nucleus cellular bud tip; cytoplasm; cytoplasmic stress granule; nuclear membrane; nuclear pore cytoplasmic filaments; nucleus ATP binding ATP hydrolysis activity ATP-dependent activity, acting on RNA...
inositol biosynthetic process inositol metabolic process phosphatidylinositol phosphate biosynthetic process signal transduction
cytoplasm
inositol monophosphate 1-phosphatase activity inositol monophosphate 3-phosphatase activity inositol monophosphate 4-phosphatase activity inositol monophosphate phosphatase activity lithium ion binding magnesium ion binding manganese ion binding
Bos taurus
3D-structure Cytoplasm Direct protein sequencing Hydrolase Lithium Magnesium Metal-binding Phosphoprotein Reference proteome
MADPWQECMD
MADPWQECMDYAVTLAGQAGEVVREALKNEMNIMVKSSPADLVTATDQKVEKMLITSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHGFPFVAVSIGFVVNKKMEFGIVYSCLEDKMYTGRKGKGAFCNGQKLQVSHQEDITKSLLVTELGSSRTPETVRIILSNIERLLCLPIHGIRGVGTAALNMCLVAAGAADAYYEMGIHCWDVAGAGIIVTEAGGVLLDVTGGPFDLMSRRVIASSNKTLAERIAKEIQIIPLQRDDED
inositol biosynthetic process inositol metabolic process phosphatidylinositol phosphate biosynthetic process signal transduction cytoplasm inositol monophosphate 1-phosphatase activity inositol monophosphate 3-phosphatase activity inositol monophosphate 4-phosphatase activity inositol monophosphate phosphatase activity...
DNA replication DNA replication initiation DNA replication, synthesis of RNA primer double-strand break repair
alpha DNA polymerase:primase complex; nuclear envelope; nucleus
4 iron, 4 sulfur cluster binding DNA binding metal ion binding
Saccharomyces cerevisiae
3D-structure 4Fe-4S DNA replication DNA-binding Iron Iron-sulfur Metal-binding Primosome Reference proteome
MFRQSKRRIA
MFRQSKRRIASRKNFSSYDDIVKSELDVGNTNAANQIILSSSSSEEEKKLYARLYESKLSFYDLPPQGEITLEQFEIWAIDRLKILLEIESCLSRNKSIKEIETIIKPQFQKLLPFNTESLEDRKKDYYSHFILRLCFCRSKELREKFVRAETFLFKIRFNMLTSTDQTKFVQSLDLPLLQFISNEEKAELSHQLYQTVSASLQFQLNLNEEHQRKQYFQQEKFIKLPFENVIELVGNRLVFLKDGYAYLPQFQQLNLLSNEFASKLNQELIKTYQYLPRLNEDDRLLPILNHLSSGYTIADFNQQKANQFSENVDDEIN...
DNA replication DNA replication initiation DNA replication, synthesis of RNA primer double-strand break repair alpha DNA polymerase:primase complex; nuclear envelope; nucleus 4 iron, 4 sulfur cluster binding DNA binding metal ion binding Saccharomyces cerevisiae 3D-structure 4Fe-4S DNA replication DNA-binding Iron Iro...
formation of translation preinitiation complex translational initiation
cytoplasm; cytoplasmic stress granule; cytosol; eukaryotic 48S preinitiation complex; eukaryotic translation initiation factor 2 complex; multi-eIF complex; ribosome
ribosome binding RNA binding translation initiation factor activity
Saccharomyces cerevisiae
3D-structure Cytoplasm Initiation factor Phosphoprotein Protein biosynthesis Reference proteome RNA-binding
MSTSHCRFYE
MSTSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKRLTPQAVKIRADVEVSCFSYEGIDAIKDALKSAEDMSTEQMQVKVKLVAAPLYVLTTQALDKQKGIEQLESAIEKITEVITKYGGVCNITMPPKAVTATEDAELQALLESKELDNRSDSEDDEDESDDE
formation of translation preinitiation complex translational initiation cytoplasm; cytoplasmic stress granule; cytosol; eukaryotic 48S preinitiation complex; eukaryotic translation initiation factor 2 complex; multi-eIF complex; ribosome ribosome binding RNA binding translation initiation factor activity Saccharomyces ...
excitatory chemical synaptic transmission gene expression inhibitory chemical synaptic transmission
axon; cytoplasm; synapse
calcium ion binding
Homo sapiens
3D-structure Acetylation Calcium Direct protein sequencing Metal-binding Muscle protein Phosphoprotein Reference proteome Repeat
MSMTDLLNAE
MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
excitatory chemical synaptic transmission gene expression inhibitory chemical synaptic transmission axon; cytoplasm; synapse calcium ion binding Homo sapiens 3D-structure Acetylation Calcium Direct protein sequencing Metal-binding Muscle protein Phosphoprotein Reference proteome Repeat MSMTDLLNAE MSMTDLLNAEDIKKAVGAFSAT...
arachidonic acid secretion defense response to bacterium lipid catabolic process phospholipid metabolic process
extracellular region
calcium ion binding phospholipase A2 activity toxin activity
Bothrops asper
3D-structure Antibiotic Antimicrobial Calcium Direct protein sequencing Disulfide bond Hydrolase Lipid degradation Lipid metabolism Metal-binding Myotoxin Secreted Signal Toxin
MRTLWIMAVL
MRTLWIMAVLLVGVEGSLIEFAKMILEETKRLPFPYYTTYGCYCGWGGQGQPKDATDRCCFVHDCCYGKLSNCKPKTDRYSYSRKSGVIICGEGTPCEKQICECDKAAAVCFRENLRTYKKRYMAYPDLLCKKPAEKC
arachidonic acid secretion defense response to bacterium lipid catabolic process phospholipid metabolic process extracellular region calcium ion binding phospholipase A2 activity toxin activity Bothrops asper 3D-structure Antibiotic Antimicrobial Calcium Direct protein sequencing Disulfide bond Hydrolase Lipid degradat...
cell division chromosome segregation distributive segregation meiotic spindle assembly meiotic spindle organization microtubule bundle formation minus-end directed microtubule sliding mitotic centrosome separation mitotic spindle assembly mitotic spindle elongation mitotic spindle organization mRNA transport regulation...
centrosome; cytosol; meiotic spindle; mitotic spindle microtubule; nucleus; spindle
ATP binding hydrolase activity microtubule binding minus-end-directed microtubule motor activity protein homodimerization activity
Drosophila melanogaster
3D-structure ATP-binding Cell cycle Cell division Coiled coil Cytoplasm Cytoskeleton Hydrolase Meiosis Microtubule Mitosis Motor protein Nucleotide-binding Phosphoprotein Reference proteome
MESRLPKPSG
MESRLPKPSGLKKPQMPIKTVLPTDRIRAGLGGGAAGAGAFNVNANQTYCGNLLPPLSRDLNNLPQVLERRGGGARAASPEPMKLGHRAKLRRSRSACDINELRGNKRTAAAPSLPSIPSKVSRLGGALTVSSQRLVRPAAPSSITATAVKRPPVTRPAPRAAGGAAAKKPAGTGAAASSGAAAAAPKRIAPYDFKARFHDLLEKHKVLKTKYEKQTEDMGELESMPQQLEETQNKLIETESSLKNTQSDNECLQRQVKQHTAKIETITSTLGRTKEELSELQAIHEKVKTEHAALSTEVVHLRQRTEELLRCNEQQAAE...
cell division chromosome segregation distributive segregation meiotic spindle assembly meiotic spindle organization microtubule bundle formation minus-end directed microtubule sliding mitotic centrosome separation mitotic spindle assembly mitotic spindle elongation mitotic spindle organization mRNA transport regulation...
cell division centriole replication G2/M transition of mitotic cell cycle gastrulation Golgi organization histoblast morphogenesis negative regulation of cell size positive regulation of cell population proliferation positive regulation of G2/M transition of mitotic cell cycle positive regulation of G2/MI transition of...
chromosome; cytoplasm; nucleus
protein tyrosine phosphatase activity
Drosophila melanogaster
Cell cycle Cell division Hydrolase Mitosis Phosphoprotein Protein phosphatase Reference proteome
MLWETIVEEN
MLWETIVEENNCSMDCNISNNTSSSSSINKMSGSRRARRSLELMSMDQEELSFYDDDVVPQDQQRSASPELMGLLSPEGSPQRFQIVRQPKILPAMGVSSDHTPARSFRIFNSLSSTCSMESSMDDEYMELFEMESQSQQTALGFPSGLNSLISGQIKEQPAAKSPAGLSMRRPSVRRCLSMTESNTNSTTTPPPKTPETARDCFKRPEPPASANCSPIQSKRHRCAAVEKENCPAPSPLSQVTISHPPPLRKCMSLNDAEIMSALARSENRNEPELIGDFSKAYALPLMEGRHRDLKSISSETVARLLKGEFSDKVASY...
cell division centriole replication G2/M transition of mitotic cell cycle gastrulation Golgi organization histoblast morphogenesis negative regulation of cell size positive regulation of cell population proliferation positive regulation of G2/M transition of mitotic cell cycle positive regulation of G2/MI transition of...
phosphatidylcholine biosynthetic process phosphatidylethanolamine biosynthetic process phosphorylation
cytoplasm
ATP binding choline kinase activity ethanolamine kinase activity
Saccharomyces cerevisiae
ATP-binding Cytoplasm Direct protein sequencing Kinase Lipid biosynthesis Lipid metabolism Nucleotide-binding Phospholipid biosynthesis Phospholipid metabolism Phosphoprotein Reference proteome Transferase
MVQESRPGSV
MVQESRPGSVRSYSVGYQARSRSSSQRRHSLTRQRSSQRLIRTISIESDVSNITDDDDLRAVNEGVAGVQLDVSETANKGPRRASATDVTDSLGSTSSEYIEIPFVKETLDASLPSDYLKQDILNLIQSLKISKWYNNKKIQPVAQDMNLVKISGAMTNAIFKVEYPKLPSLLLRIYGPNIDNIIDREYELQILARLSLKNIGPSLYGCFVNGRFEQFLENSKTLTKDDIRNWKNSQRIARRMKELHVGVPLLSSERKNGSACWQKINQWLRTIEKVDQWVGDPKNIENSLLCENWSKFMDIVDRYHKWLISQEQGIEQV...
phosphatidylcholine biosynthetic process phosphatidylethanolamine biosynthetic process phosphorylation cytoplasm ATP binding choline kinase activity ethanolamine kinase activity Saccharomyces cerevisiae ATP-binding Cytoplasm Direct protein sequencing Kinase Lipid biosynthesis Lipid metabolism Nucleotide-binding Phosph...
cell cycle cell division positive regulation of transcription by RNA polymerase II regulation of cell cycle G1/S phase transition regulation of mitotic cell cycle regulation of transcription by RNA polymerase II
cyclin-dependent protein kinase holoenzyme complex; cytoplasm; nucleus; SCF ubiquitin ligase complex
cyclin-dependent protein serine/threonine kinase activator activity histone binding protein kinase activator activity protein kinase binding ubiquitin binding
Saccharomyces cerevisiae
3D-structure Cell cycle Cell division Reference proteome
MYHHYHAFQG
MYHHYHAFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFNSEVGTLRILTEDEWRGLGITQSLGWEHYECHAPEPHILLFKRPLNYEAELRAATAAAQQQQQQQQQQQQQQQQHQTQSISNDMQVPPQIS
cell cycle cell division positive regulation of transcription by RNA polymerase II regulation of cell cycle G1/S phase transition regulation of mitotic cell cycle regulation of transcription by RNA polymerase II cyclin-dependent protein kinase holoenzyme complex; cytoplasm; nucleus; SCF ubiquitin ligase complex cyclin-...
endocytosis negative regulation of exocytosis regulation of neuronal synaptic plasticity regulation of opioid receptor signaling pathway
chromaffin granule membrane; clathrin-coated vesicle; neuron projection; presynaptic active zone; synaptic vesicle membrane
GTPase binding identical protein binding
Bos taurus
Calcium Cytoplasmic vesicle Glycoprotein Membrane Phosphoprotein Reference proteome Repeat Synapse Synaptosome Transmembrane Transmembrane helix Ubl conjugation
MLLLADMDVV
MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTKSDLNIEVEFEYPFRLHEVYFEAPTCQGDPKKIFLVGNYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKGMHVCHQPGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGQAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASSGGGGYGPQGDYGQQGYGPQGAPTSFSNQM
endocytosis negative regulation of exocytosis regulation of neuronal synaptic plasticity regulation of opioid receptor signaling pathway chromaffin granule membrane; clathrin-coated vesicle; neuron projection; presynaptic active zone; synaptic vesicle membrane GTPase binding identical protein binding Bos taurus Calcium...
calcium-mediated signaling cell surface receptor signaling pathway eosinophil degranulation establishment of localization in cell leukotriene biosynthetic process mast cell degranulation positive regulation of calcium-mediated signaling positive regulation of granulocyte macrophage colony-stimulating factor production ...
cell surface; external side of plasma membrane; membrane raft; plasma membrane
high-affinity IgE receptor activity IgE binding IgE receptor activity transmembrane signaling receptor activity
Mus musculus
Cell membrane Disulfide bond Glycoprotein IgE-binding protein Immunoglobulin domain Membrane Receptor Reference proteome Repeat Signal Transmembrane Transmembrane helix
MVTGRSAQLC
MVTGRSAQLCLALLFMSLDVILTATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT
calcium-mediated signaling cell surface receptor signaling pathway eosinophil degranulation establishment of localization in cell leukotriene biosynthetic process mast cell degranulation positive regulation of calcium-mediated signaling positive regulation of granulocyte macrophage colony-stimulating factor production ...
cell surface receptor signaling pathway Fc-epsilon receptor signaling pathway immune response positive regulation of mast cell degranulation protein kinase C-activating G protein-coupled receptor signaling pathway regulation of release of sequestered calcium ion into cytosol signal transduction
endosome; external side of plasma membrane; Fc-epsilon receptor I complex; membrane raft; plasma membrane
IgE binding phosphoprotein binding protein kinase binding SH2 domain binding
Mus musculus
Disulfide bond IgE-binding protein Membrane Phosphoprotein Receptor Reference proteome Transmembrane Transmembrane helix
MDTENRSRAD
MDTENRSRADLALPNPQESSSAPDIELLEASPAKAAPPKQTWRTFLKKELEFLGATQILVGLICLCFGTIVCSVLYVSDFDEEVLLLYKLGYPFWGAVLFVLSGFLSIISERKNTLYLVRGSLGANIVSSIAAGTGIAMLILNLTNNFAYMNNCKNVTEDDGCFVASFTTELVLMMLFLTILAFCSAVLFTIYRIGQELESKKVPDDRLYEELNVYSPIYSELEDKGETSSPVDS
cell surface receptor signaling pathway Fc-epsilon receptor signaling pathway immune response positive regulation of mast cell degranulation protein kinase C-activating G protein-coupled receptor signaling pathway regulation of release of sequestered calcium ion into cytosol signal transduction endosome; external side ...
fatty acid biosynthetic process secondary metabolite biosynthetic process
cytoplasm
3-oxoacyl- synthase activity acyltransferase activity
Pseudomonas aeruginosa
3D-structure Acyltransferase Cytoplasm Reference proteome Transferase
MGNPILAGLG
MGNPILAGLGFSLPKRQVSNHDLVGRINTSDEFIVERTGVRTRYHVEPEQAVSALMVPAARQAIEAAGLLPEDIDLLLVNTLSPDHHDPSQACLIQPLLGLRHIPVLDIRAQCSGLLYGLQMARGQILAGLARHVLVVCGEVLSKRMDCSDRGRNLSILLGDGAGAVVVSAGESLEDGLLDLRLGADGNYFDLLMTAAPGSASPTFLDENVLREGGGEFLMRGRPMFEHASQTLVRIAGEMLAAHELTLDDIDHVICHQPNLRILDAVQEQLGIPQHKFAVTVDRLGNMASASTPVTLAMFWPDIQPGQRVLVLTYGSGA...
fatty acid biosynthetic process secondary metabolite biosynthetic process cytoplasm 3-oxoacyl- synthase activity acyltransferase activity Pseudomonas aeruginosa 3D-structure Acyltransferase Cytoplasm Reference proteome Transferase MGNPILAGLG MGNPILAGLGFSLPKRQVSNHDLVGRINTSDEFIVERTGVRTRYHVEPEQAVSALMVPAARQAIEAAGLLPEDIDLLL...