Biological Process
stringlengths
7
1.01k
Cellular Component
stringlengths
6
867
Molecular Function
stringlengths
11
871
Organism
stringlengths
8
73
Keywords
stringlengths
1
810
Sequence 10
stringlengths
5
10
Sequence
stringlengths
5
1.02k
Combined
stringlengths
136
3.91k
oocyte development
extracellular space
hormone activity serine-type endopeptidase inhibitor activity
Aedes aegypti
Direct protein sequencing Hormone Reference proteome Secreted Signal
MNKIIAALVL
MNKIIAALVLFTAVIGALADYPAPPPPPPKPYHAPPPPPYHAPPHHAPAPLHPVVHTYPVKAPAAKCGANLLVGCAPSVAHVPCVPVHPHPPPPAHY
oocyte development extracellular space hormone activity serine-type endopeptidase inhibitor activity Aedes aegypti Direct protein sequencing Hormone Reference proteome Secreted Signal MNKIIAALVL MNKIIAALVLFTAVIGALADYPAPPPPPPKPYHAPPPPPYHAPPHHAPAPLHPVVHTYPVKAPAAKCGANLLVGCAPSVAHVPCVPVHPHPPPPAHY
localization negative regulation of transcription by RNA polymerase II negative regulation of transcription elongation by RNA polymerase II positive regulation of ERK1 and ERK2 cascade positive regulation of protein modification process positive regulation of transcription by RNA polymerase II
chromatin; NELF complex; nuclear body; nucleoplasm; nucleus; plasma membrane
chromatin binding mRNA binding RNA binding
Mus musculus
ADP-ribosylation Alternative splicing Chromosome Coiled coil Isopeptide bond Nucleus Phosphoprotein Reference proteome Repeat Repressor RNA-binding Transcription Transcription regulation Ubl conjugation
MLVIPPGLSE
MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSGPASQGGVKRSLSEQPVVDTATATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSMSADEDLQEPSRRPQRKSLYESFVSSSDRLRELGQDGEEAEAPGAGDGPPRGFDWSYEEHGSARSSASPPRSRSRDRSHDRSRDRDRDKERDRDRDRDRDRDRDKDKDRDRDRDRDKERDRDRDRDRDRERDREGPFRRSDSFPERRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELN...
localization negative regulation of transcription by RNA polymerase II negative regulation of transcription elongation by RNA polymerase II positive regulation of ERK1 and ERK2 cascade positive regulation of protein modification process positive regulation of transcription by RNA polymerase II chromatin; NELF complex; ...
cardiac muscle contraction heart contraction heart development intracellular calcium ion homeostasis negative regulation of ATP-dependent activity regulation of cardiac muscle contraction by calcium ion signaling regulation of smooth muscle contraction regulation of systemic arterial blood pressure by ischemic conditio...
cardiac myofibril; cardiac Troponin complex; cytosol; sarcomere; troponin complex
actin binding actin filament binding calcium channel inhibitor activity calcium-dependent protein binding protein domain specific binding protein kinase binding troponin C binding troponin T binding
Homo sapiens
3D-structure Acetylation Actin-binding Cardiomyopathy Direct protein sequencing Disease variant Muscle protein Phosphoprotein Reference proteome
MADGSSDAAR
MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES
cardiac muscle contraction heart contraction heart development intracellular calcium ion homeostasis negative regulation of ATP-dependent activity regulation of cardiac muscle contraction by calcium ion signaling regulation of smooth muscle contraction regulation of systemic arterial blood pressure by ischemic conditio...
B cell activation B cell differentiation B cell receptor signaling pathway calcium ion import into cytosol cell surface receptor signaling pathway positive regulation of calcium ion import across plasma membrane protein tetramerization response to bacterium store-operated calcium entry
cell surface; external side of plasma membrane; nucleoplasm; plasma membrane; plasma membrane raft
epidermal growth factor receptor binding identical protein binding immunoglobulin binding
Mus musculus
B-cell activation Cell membrane Lipoprotein Membrane Palmitate Phosphoprotein Reference proteome Transmembrane Transmembrane helix
MSGPFPAEPT
MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
B cell activation B cell differentiation B cell receptor signaling pathway calcium ion import into cytosol cell surface receptor signaling pathway positive regulation of calcium ion import across plasma membrane protein tetramerization response to bacterium store-operated calcium entry cell surface; external side of pl...
amino acid metabolic process cysteine biosynthetic process fatty acid metabolic process glutamate metabolic process glutathione biosynthetic process glutathione catabolic process leukotriene D4 biosynthetic process leukotriene metabolic process peptide modification proteolysis regulation of immune system process regula...
extracellular exosome; extracellular space; plasma membrane
glutathione hydrolase activity leukotriene C4 gamma-glutamyl transferase activity leukotriene-C(4) hydrolase peptidyltransferase activity
Homo sapiens
3D-structure Acyltransferase Alternative promoter usage Alternative splicing Cell membrane Direct protein sequencing Disease variant Disulfide bond Glutathione biosynthesis Glycoprotein Hydrolase Intellectual disability Lipid metabolism Membrane Protease Reference proteome Sialic acid Signal-anchor Transferase Transmem...
MKKKLVVLGL
MKKKLVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAPLSGPVLALILNILKGYNFSRESVESPEQKGLTYHRIVEAF...
amino acid metabolic process cysteine biosynthetic process fatty acid metabolic process glutamate metabolic process glutathione biosynthetic process glutathione catabolic process leukotriene D4 biosynthetic process leukotriene metabolic process peptide modification proteolysis regulation of immune system process regula...
apoptotic process DNA repair DNA topological change embryonic organ development hair cell differentiation nucleotide-excision repair nucleotide-excision repair, DNA duplex unwinding positive regulation of apoptotic process protein localization regulation of mitotic cell cycle phase transition response to hypoxia respon...
nucleoplasm; nucleotide-excision repair factor 3 complex; nucleus; transcription factor TFIID complex; transcription factor TFIIH core complex; transcription factor TFIIH holo complex; transcription preinitiation complex
3'-5' DNA helicase activity ATP binding ATP hydrolysis activity damaged DNA binding DNA binding promoter-specific chromatin binding
Homo sapiens
3D-structure ATP-binding Cockayne syndrome Deafness Disease variant DNA damage DNA repair DNA-binding Dwarfism Helicase Host-virus interaction Hydrolase Ichthyosis Nucleotide-binding Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation Xeroderma pigmentosum
MGKRDRADRD
MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQ...
apoptotic process DNA repair DNA topological change embryonic organ development hair cell differentiation nucleotide-excision repair nucleotide-excision repair, DNA duplex unwinding positive regulation of apoptotic process protein localization regulation of mitotic cell cycle phase transition response to hypoxia respon...
DNA damage response donor selection maturation of SSU-rRNA nucleolar large rRNA transcription by RNA polymerase I phosphorylation regulation of cell cycle regulation of ribosomal protein gene transcription by RNA polymerase II regulation of transcription by RNA polymerase I regulation of transcription by RNA polymerase...
CURI complex; cytosol; nucleolus; nucleoplasm; nucleus; protein kinase CK2 complex; small-subunit processome; UTP-C complex
ATP binding protein serine kinase activity protein serine/threonine kinase activity
Saccharomyces cerevisiae
ATP-binding Direct protein sequencing Kinase Nucleotide-binding Reference proteome Serine/threonine-protein kinase Transferase
MPLPPSTLNQ
MPLPPSTLNQKSNRVYSVARVYKNACEERPQEYWDYEQGVTIDWGKISNYEIINKIGRGKYSEVFSGRCIVNNQKCVIKVLKPVKMKKIYRELKILTNLTGGPNVVGLYDIVQDADSKIPALIFEEIKNVDFRTLYPTFKLPDIQYYFTQLLIALDYCHSMGIMHRDVKPQNVMIDPTERKLRLIDWGLAEFYHPGVDYNVRVASRYHKGPELLVNLNQYDYSLDLWSVGCMLAAIVFKKEPFFKGSSNPDQLVKIATVLGTKELLGYLGKYGLHLPSEYDNIMRDFTKKSWTHFITSETKLAVPEVVDLIDNLLRYDHQ...
DNA damage response donor selection maturation of SSU-rRNA nucleolar large rRNA transcription by RNA polymerase I phosphorylation regulation of cell cycle regulation of ribosomal protein gene transcription by RNA polymerase II regulation of transcription by RNA polymerase I regulation of transcription by RNA polymerase...
proton export across plasma membrane proton transmembrane transport regulation of intracellular pH
membrane; plasma membrane
ATP binding ATP hydrolysis activity magnesium ion binding P-type proton-exporting transporter activity
Arabidopsis thaliana
3D-structure Acetylation Alternative splicing ATP-binding Cell membrane Hydrogen ion transport Ion transport Magnesium Membrane Metal-binding Nucleotide-binding Phosphoprotein Reference proteome Translocase Transmembrane Transmembrane helix Transport
MSSLEDIKNE
MSSLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFLGFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEM...
proton export across plasma membrane proton transmembrane transport regulation of intracellular pH membrane; plasma membrane ATP binding ATP hydrolysis activity magnesium ion binding P-type proton-exporting transporter activity Arabidopsis thaliana 3D-structure Acetylation Alternative splicing ATP-binding Cell membrane...
proton motive force-driven ATP synthesis
mitochondrial proton-transporting ATP synthase complex; mitochondrial proton-transporting ATP synthase, catalytic core; plasma membrane; proton-transporting ATP synthase complex, catalytic core F(1)
ADP binding ATP binding proton-transporting ATP synthase activity, rotational mechanism
Bos taurus
3D-structure Acetylation ATP synthesis ATP-binding Cell membrane CF(1) Direct protein sequencing Glycoprotein Hydrogen ion transport Ion transport Membrane Methylation Mitochondrion Mitochondrion inner membrane Nucleotide-binding Phosphoprotein Pyrrolidone carboxylic acid Reference proteome Transit peptide Transport
MLSVRVAAAV
MLSVRVAAAVARALPRRAGLVSKNALGSSFIAARNLHASNSRLQKTGTAEVSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVA...
proton motive force-driven ATP synthesis mitochondrial proton-transporting ATP synthase complex; mitochondrial proton-transporting ATP synthase, catalytic core; plasma membrane; proton-transporting ATP synthase complex, catalytic core F(1) ADP binding ATP binding proton-transporting ATP synthase activity, rotational me...
adaptive immune response antibacterial innate immune response autophagy cellular response to amino acid starvation cellular response to starvation embryonic placenta development humoral immune response lysosome localization lysosome organization positive regulation of autophagy positive regulation of DNA-templated tran...
chromatin; cytoplasm; cytosol; lysosomal membrane; nucleus
DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific enzyme binding protein dimerization activity RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific double-stranded DNA binding transcription cis-regulatory region binding
Homo sapiens
3D-structure Activator Adaptive immunity Alternative splicing Autophagy Cytoplasm DNA-binding Immunity Lysosome Membrane Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation Ubl conjugation
MASRIGLRMQ
MASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQQLGGPPTPAINTPVHFQSPPPVPGEVLKVQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPAASPGVRAGHVLSSSAGNSAPNSPMAMLHIGSNPERELDDVIDNIMRLDDVLGYINPEMQMPNTLPLSSSHLNVYSSDPQVTASLVGVTSSSCPADLTQKRELTDAESRALAKERQKKDNHNLIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQELE...
adaptive immune response antibacterial innate immune response autophagy cellular response to amino acid starvation cellular response to starvation embryonic placenta development humoral immune response lysosome localization lysosome organization positive regulation of autophagy positive regulation of DNA-templated tran...
cellular response to brain-derived neurotrophic factor stimulus cellular response to glycine cerebral cortex development chemical synaptic transmission establishment of protein localization ionotropic glutamate receptor signaling pathway modulation of chemical synaptic transmission positive regulation of synaptic trans...
AMPA glutamate receptor complex; asymmetric synapse; axon; cell surface; dendrite; dendrite cytoplasm; dendrite membrane; dendritic shaft; dendritic spine; dendritic spine head; dendritic spine neck; endoplasmic reticulum; endoplasmic reticulum membrane; glutamatergic synapse; growth cone; ionotropic glutamate receptor...
AMPA glutamate receptor activity amyloid-beta binding cytoskeletal protein binding extracellularly glutamate-gated ion channel activity glutamate receptor binding glutamate-gated receptor activity identical protein binding immunoglobulin binding ionotropic glutamate receptor binding kainate selective glutamate receptor...
Rattus norvegicus
3D-structure Alternative splicing Cell membrane Disulfide bond Endoplasmic reticulum Glycoprotein Ion channel Ion transport Ligand-gated ion channel Lipoprotein Membrane Palmitate Phosphoprotein Postsynaptic cell membrane Receptor Reference proteome RNA editing Signal Synapse Transmembrane Transmembrane helix Transport...
MQKIMHISVL
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRIE...
cellular response to brain-derived neurotrophic factor stimulus cellular response to glycine cerebral cortex development chemical synaptic transmission establishment of protein localization ionotropic glutamate receptor signaling pathway modulation of chemical synaptic transmission positive regulation of synaptic trans...
chemical synaptic transmission chemical synaptic transmission, postsynaptic modulation of chemical synaptic transmission monoatomic ion transmembrane transport regulation of postsynaptic membrane potential regulation of receptor recycling response to fungicide response to lithium ion synaptic transmission, glutamatergi...
AMPA glutamate receptor complex; asymmetric synapse; dendrite; dendritic shaft; dendritic spine; glutamatergic synapse; ionotropic glutamate receptor complex; membrane; neuronal cell body; parallel fiber to Purkinje cell synapse; perikaryon; plasma membrane; postsynaptic density; postsynaptic density membrane; postsyna...
AMPA glutamate receptor activity amyloid-beta binding glutamate-gated receptor activity ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
Rattus norvegicus
3D-structure Alternative splicing Cell membrane Disulfide bond Glycoprotein Ion channel Ion transport Ligand-gated ion channel Lipoprotein Membrane Palmitate Phosphoprotein Postsynaptic cell membrane Receptor Reference proteome Signal Synapse Transmembrane Transmembrane helix Transport
MGQSVLRAVF
MGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGALHTSFVTPSFPTDADVQFVIQMRPALKGAILSLLSYYKWEKFVYLYDTERGFSVLQAIMEAAVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYMLANLGFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRR...
chemical synaptic transmission chemical synaptic transmission, postsynaptic modulation of chemical synaptic transmission monoatomic ion transmembrane transport regulation of postsynaptic membrane potential regulation of receptor recycling response to fungicide response to lithium ion synaptic transmission, glutamatergi...
chemical synaptic transmission modulation of chemical synaptic transmission negative regulation of smooth muscle cell apoptotic process positive regulation of synaptic transmission, glutamatergic regulation of synapse structure or activity response to fungicide synaptic transmission, glutamatergic
AMPA glutamate receptor complex; dendrite; dendritic spine; glutamatergic synapse; ionotropic glutamate receptor complex; kainate selective glutamate receptor complex; neuronal cell body; plasma membrane; postsynaptic density; postsynaptic density membrane; presynaptic active zone membrane; synapse; terminal bouton
AMPA glutamate receptor activity glutamate-gated receptor activity identical protein binding ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
Rattus norvegicus
3D-structure Alternative splicing Cell membrane Cell projection Direct protein sequencing Disulfide bond Glycoprotein Ion channel Ion transport Ligand-gated ion channel Lipoprotein Membrane Palmitate Phosphoprotein Postsynaptic cell membrane Receptor Reference proteome Signal Synapse Transmembrane Transmembrane helix T...
MRIICRQIVL
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKI...
chemical synaptic transmission modulation of chemical synaptic transmission negative regulation of smooth muscle cell apoptotic process positive regulation of synaptic transmission, glutamatergic regulation of synapse structure or activity response to fungicide synaptic transmission, glutamatergic AMPA glutamate recept...
membrane fusion involved in viral entry into host cell viral entry into host cell virion attachment to host cell
host cell endosome membrane; host cell plasma membrane; membrane; viral envelope; virion membrane
structural molecule activity
Simian immunodeficiency virus
3D-structure Apoptosis Cleavage on pair of basic residues Coiled coil Disulfide bond Fusion of virus membrane with host membrane Glycoprotein Host cell membrane Host endosome Host membrane Host-virus interaction Lipoprotein Membrane Palmitate Reference proteome Signal Transmembrane Transmembrane helix Viral attachment ...
MGCLGNQLLI
MGCLGNQLLIALLLLSASGIYCVQYVTVFYGIPAWRNATVPLFCATKNRDTWGTTQCLPDNGDYSELAINVTEAFDAWDNTVTEQAIEDVWNLFETSIKPCVKLTPLCITMRCNKSETDRWGLTGTPAPTTTQTTTTQASTTPTSPITAKVVNDSDPCIKINNCTGLEQEPMVSCKFNMTGLKRDKKREYNETWYSRDLVCEQNSNETDSKCYMNHCNTSVIQESCDKHYWDAIRFRYCAPPGYALLRCNDSNYSGFAPNCTKVVVSSCTRMMETQTSTWFGFNGTRAENRTYIYWHGRSNRTIISLNKYYNLTMRCRRP...
membrane fusion involved in viral entry into host cell viral entry into host cell virion attachment to host cell host cell endosome membrane; host cell plasma membrane; membrane; viral envelope; virion membrane structural molecule activity Simian immunodeficiency virus 3D-structure Apoptosis Cleavage on pair of basic...
viral budding via host ESCRT complex
host cell cytoplasm; host cell nucleus; host cell plasma membrane; membrane; viral nucleocapsid
RNA binding structural molecule activity zinc ion binding
Simian immunodeficiency virus
Capsid protein Host cell membrane Host cytoplasm Host membrane Host nucleus Host-virus interaction Lipoprotein Membrane Metal-binding Myristate Phosphoprotein Reference proteome Repeat Ribosomal frameshifting RNA-binding Viral budding Viral budding via the host ESCRT complexes Viral nucleoprotein Viral release from hos...
MGARNSVLSG
MGARNSVLSGKKADELEKIRLRPGGKKRYQLKHIVWAANELDRFGLAESLLENKEGCQKILSVLAPLVPTGSENLKSLYNTVCVLWCIHAEEKVKHTEEAKQIVQRHLVVETGTADKMPATSRPTAPPSGKGGNYPVQQIGGNYTHLPLSPRTLNAWVKLIEEKKFGAEVVPGFQALSEGCTPYDINQMLNCVGEHQAAMQIIREIINEEAADWDLQHPQPGPIPPGQLREPRGSDIAGTTSTVDEQIQWMYRQQNPIPVGNIYRRWIQLGLQKCVRMYNPTNILDVKQGPKEPFQSYVDRFYKSLRAEQTDPAVKNWMT...
viral budding via host ESCRT complex host cell cytoplasm; host cell nucleus; host cell plasma membrane; membrane; viral nucleocapsid RNA binding structural molecule activity zinc ion binding Simian immunodeficiency virus Capsid protein Host cell membrane Host cytoplasm Host membrane Host nucleus Host-virus interactio...
calcium ion transmembrane transport positive regulation of muscle contraction regulation of calcium ion transmembrane transport via high voltage-gated calcium channel
L-type voltage-gated calcium channel complex; plasma membrane; sarcolemma; T-tubule
calcium channel regulator activity voltage-gated calcium channel activity
Oryctolagus cuniculus
3D-structure Calcium Calcium channel Calcium transport Cell membrane Direct protein sequencing Disulfide bond Glycoprotein Ion channel Ion transport Membrane Reference proteome Transmembrane Transmembrane helix Transport Voltage-gated channel
MSPTEAPKVR
MSPTEAPKVRVTLFCILVGIVLAMTAVVSDHWAVLSPHMENHNTTCEAAHFGLWRICTKRIALGEDRSCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAISVFSLGFLIMGTICALMAFRKKRDYLLRPASMFYVFAGLCLFVSLEVMRQSVKRMIDSEDTVWIEYYYSWSFACACAAFVLLFLGGISLLLFSLPRMPQNPWESCMDAEPEH
calcium ion transmembrane transport positive regulation of muscle contraction regulation of calcium ion transmembrane transport via high voltage-gated calcium channel L-type voltage-gated calcium channel complex; plasma membrane; sarcolemma; T-tubule calcium channel regulator activity voltage-gated calcium channel acti...
carbohydrate metabolic process fucosylation L-fucose catabolic process lipid metabolic process olfactory bulb development oligosaccharide biosynthetic process positive regulation of cell-matrix adhesion positive regulation of endothelial cell migration positive regulation of endothelial cell-matrix adhesion via fibrone...
Golgi apparatus; Golgi cisterna membrane; Golgi membrane; membrane; plasma membrane
alpha-(1,2)-fucosyltransferase activity fucosyltransferase activity galactoside 2-alpha-L-fucosyltransferase activity
Homo sapiens
Blood group antigen Glycoprotein Glycosyltransferase Golgi apparatus Lipid metabolism Membrane Reference proteome Signal-anchor Transferase Transmembrane Transmembrane helix
MWLRSHRQLC
MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGG...
carbohydrate metabolic process fucosylation L-fucose catabolic process lipid metabolic process olfactory bulb development oligosaccharide biosynthetic process positive regulation of cell-matrix adhesion positive regulation of endothelial cell migration positive regulation of endothelial cell-matrix adhesion via fibrone...
anterograde axonal transport axonal transport of mitochondrion axonogenesis cerebral cortex development hippocampus development intermediate filament bundle assembly intermediate filament organization intermediate filament polymerization or depolymerization locomotion microtubule cytoskeleton organization motor neuron ...
axon; axon cytoplasm; cholinergic synapse; cytoplasm; cytosol; growth cone; intermediate filament; neurofilament; neuromuscular junction; neuron projection; postsynaptic intermediate filament cytoskeleton; presynaptic intermediate filament cytoskeleton; Schaffer collateral - CA1 synapse
identical protein binding phospholipase binding protein domain specific binding protein-containing complex binding protein-macromolecule adaptor activity structural constituent of cytoskeleton structural constituent of postsynaptic intermediate filament cytoskeleton
Rattus norvegicus
Acetylation Cell projection Coiled coil Cytoplasm Cytoskeleton Direct protein sequencing Glycoprotein Intermediate filament Methylation Phosphoprotein Reference proteome Ubl conjugation
MSSFSYEPYF
MSSFSYEPYFSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEAELLVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNEKQALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEIAFLKKVHEEEIAELQAQIQYAQISVEMDVSSKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRAAKDEVSESRRLLKAKTLEI...
anterograde axonal transport axonal transport of mitochondrion axonogenesis cerebral cortex development hippocampus development intermediate filament bundle assembly intermediate filament organization intermediate filament polymerization or depolymerization locomotion microtubule cytoskeleton organization motor neuron ...
adaptive immune response humoral immune response lysosome organization negative regulation of cold-induced thermogenesis positive regulation of brown fat cell differentiation positive regulation of cell adhesion positive regulation of DNA-templated transcription positive regulation of transcription by RNA polymerase II...
chromatin; cytoplasm; cytosol; lysosomal membrane; nucleoplasm; nucleus
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific protein dimerization activity RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific double-stranded D...
Homo sapiens
3D-structure Activator Adaptive immunity Alternative splicing Chromosomal rearrangement Cytoplasm Disease variant DNA-binding Immunity Intellectual disability Isopeptide bond Lysosome Membrane Methylation Nucleus Phosphoprotein Proto-oncogene Reference proteome Transcription Transcription regulation Ubl conjugation
MSHAAEPARD
MSHAAEPARDGVEASAEGPRAVFVLLEERRPADSAQLLSLNSLLPESGIVADIELENVLDPDSFYELKSQPLPLRSSLPISLQATPATPATLSASSSAGGSRTPAMSSSSSSRVLLRQQLMRAQAQEQERRERREQAAAAPFPSPAPASPAISVVGVSAGGHTLSRPPPAQVPREVLKVQTHLENPTRYHLQQARRQQVKQYLSTTLGPKLASQALTPPPGPASAQPLPAPEAAHTTGPTGSAPNSPMALLTIGSSSEKEIDDVIDEIISLESSYNDEMLSYLPGGTTGLQLPSTLPVSGNLLDVYSSQGVATPAITVSN...
adaptive immune response humoral immune response lysosome organization negative regulation of cold-induced thermogenesis positive regulation of brown fat cell differentiation positive regulation of cell adhesion positive regulation of DNA-templated transcription positive regulation of transcription by RNA polymerase II...
adherens junction organization blood vessel morphogenesis brain development calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules cell morphogenesis cell-cell adhesion cell-cell adhesion mediated by cadherin cell-cell junction assembly glial cell differentiation homophilic cell adhesion via p...
adherens junction; apical part of cell; catenin complex; cell junction; cell surface; cell-cell junction; cytoplasm; desmosome; intercalated disc; lamellipodium; neuron projection; plasma membrane; postsynaptic density; presynapse; sarcolemma
cadherin binding calcium ion binding
Bos taurus
Calcium Cell adhesion Cell junction Cell membrane Cleavage on pair of basic residues Glycoprotein Membrane Metal-binding Phosphoprotein Reference proteome Repeat Signal Transmembrane Transmembrane helix
MCRIVGAPRT
MCRIVGAPRTLLPLLAALLQASVDASGEISLCKTGFPEDVYSAVLSRDVLEGQPLLNVKFSNCNGKRKVQYESSEPADFKVDEDGMVYAVRSFPLSSEHSKFLIYAQDKETQEKWQVAVKLSLKPALPEDSVKESREIEEIVFPRQVTKHNGYLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAVDINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRILSQAPSTPSPNM...
adherens junction organization blood vessel morphogenesis brain development calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules cell morphogenesis cell-cell adhesion cell-cell adhesion mediated by cadherin cell-cell junction assembly glial cell differentiation homophilic cell adhesion via p...
blood coagulation proteolysis zymogen activation
extracellular space
calcium ion binding endopeptidase activity serine-type endopeptidase activity
Canis lupus familiaris
Blood coagulation Calcium Cleavage on pair of basic residues Disease variant Disulfide bond EGF-like domain Gamma-carboxyglutamic acid Glycoprotein Hemophilia Hemostasis Hydrolase Hydroxylation Magnesium Metal-binding Phosphoprotein Protease Reference proteome Repeat Secreted Serine protease Signal Sulfation Zymogen
MAEASGLVTV
MAEASGLVTVCLLGYLLSAECAVFLDRENATKILSRPKRYNSGKLEEFVRGNLERECIEEKCSFEEAREVFENTEKTTEFWKQYVDGDQCESNPCLNDGVCKDDINSYECWCRAGFEGKNCELDVTCNIKNGRCKQFCKLGPDNKVVCSCTTGYQLAEDQRSCEPAVPFPCGRVSVPHISMTRTRAETLFSNMDYENSTEVEKILDNVTQPLNDFTRVVGGKDAKPGQFPWQVLLNGKVDAFCGGSIINEKWVVTAAHCIEPDVKITIVAGEHNTEKREHTEQKRNVIRTILHHSYNATINKYNHDIALLELDEPLTLNS...
blood coagulation proteolysis zymogen activation extracellular space calcium ion binding endopeptidase activity serine-type endopeptidase activity Canis lupus familiaris Blood coagulation Calcium Cleavage on pair of basic residues Disease variant Disulfide bond EGF-like domain Gamma-carboxyglutamic acid Glycoprotein H...
cell wall organization cellular response to xenobiotic stimulus negative regulation of transcription from RNA polymerase II promoter by a nonfermentable carbon source positive regulation of transcription by RNA polymerase II positive regulation of transcription from RNA polymerase II promoter by a nonfermentable carbon...
cytoplasm; nucleus
DNA-binding transcription activator activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding RNA polymerase II transcription regulatory region sequence-specific DNA binding sequence-specific DNA binding zinc ion binding
Saccharomyces cerevisiae
Cell wall biogenesis/degradation Cytoplasm DNA-binding Metal-binding Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation Zinc
MSANSGVKRA
MSANSGVKRASKAFKTCLFCKRSHVVCDKQRPCSRCVKRDIAHLCREDDIAVPNEMPSQHESSPNDNNIQGKYANKAHTGIPSDYQNEPVNKSGSTYGEELSPKLDSSLVNDTTSLLLPQQPVFVSENVGSEFSSLNEFLSMLENPLLTQTSLSSSSASNVHLENGSQTTQSPLEYQNDNRRDEIGVARQENRSPTIMSGSSNSISKGDKQDQEKEESRILANANENSAPTPKEQFFLTAADPSTEMTPEHRLKLVINAKLEAGLLKPYNYAKGYARLQDYMDKYMNQSSKQRILKPLSTIRPAFRTIARSLKDVDLVLV...
cell wall organization cellular response to xenobiotic stimulus negative regulation of transcription from RNA polymerase II promoter by a nonfermentable carbon source positive regulation of transcription by RNA polymerase II positive regulation of transcription from RNA polymerase II promoter by a nonfermentable carbon...
suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I suppression by virus of host antigen processing and presentation of peptide antigen via MHC class II suppression by virus of host autophagy
extracellular region; host cell Golgi membrane; host cell plasma membrane; membrane; virion component
GTP binding SH3 domain binding
Human immunodeficiency virus type 1 group M subtype B
AIDS Apoptosis Early protein Host cell membrane Host Golgi apparatus Host membrane Host-virus interaction Inhibition of host adaptive immune response by virus Inhibition of host autophagy by virus Inhibition of host MHC class I molecule presentation by virus Inhibition of host MHC class II molecule presentation by viru...
MGGKWSKSKM
MGGKWSKSKMGWPAVRERMKRAEPAADGVGAASRDLEKHGALTSSNTAATNADCAWLEAQEDEEVGFPVKPQVPLRPMTYKAALDLSHFLKEKGGLEGLVYSQKRQDILDLWIYHTQGYFPDWQNYTPGPGVRFPLTFGWCFKLVPVEPEKVEEANEGENNSLLHPMSLHGMEDPEKEVLVWKFDSHLAFRHMARELHPEYYKDC
suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I suppression by virus of host antigen processing and presentation of peptide antigen via MHC class II suppression by virus of host autophagy extracellular region; host cell Golgi membrane; host cell plasma membrane; membr...
suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I suppression by virus of host antigen processing and presentation of peptide antigen via MHC class II suppression by virus of host autophagy
extracellular region; host cell Golgi membrane; host cell plasma membrane; membrane; virion component
GTP binding SH3 domain binding
Human immunodeficiency virus type 1 group M subtype B
AIDS Apoptosis Early protein Host cell membrane Host Golgi apparatus Host membrane Host-virus interaction Inhibition of host adaptive immune response by virus Inhibition of host autophagy by virus Inhibition of host MHC class I molecule presentation by virus Inhibition of host MHC class II molecule presentation by viru...
MGGKWSKRMS
MGGKWSKRMSGWSAVRERMKRAEPAEPAADGVGAVSRDLEKHGAITSSNTAANNADCAWLEAQEDEDVGFPVRPQVPLRPMTYKAALDLSHFLKEKGGLEGLIYSQKRQDILDLWIHHTQGYFPDWQNYTPGPGIRYPLTFGWCFKLVPVDPDYVEEANAGENNSLLHPMSQHGMDDPEKEVLVWRFDSRLAFHHMARELHPEYYKDC
suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I suppression by virus of host antigen processing and presentation of peptide antigen via MHC class II suppression by virus of host autophagy extracellular region; host cell Golgi membrane; host cell plasma membrane; membr...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane fusion of virus membrane with host plasma membrane positive regulation of establishment of T cell polarity positive regulation of plasma membrane raft polarization positive regulation of receptor clustering viral p...
host cell endosome membrane; host cell plasma membrane; membrane; viral envelope; virion membrane
structural molecule activity
Human immunodeficiency virus type 1 group M subtype B
3D-structure AIDS Apoptosis Clathrin-mediated endocytosis of virus by host Cleavage on pair of basic residues Coiled coil Disulfide bond Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Host cell membrane Host endosome Host membrane Host-virus interaction Li...
MRARETRKNY
MRARETRKNYQCLWRWGTMLLGMLMICSAAENLWVTVYYGVPVWKDATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLGNVTENFNMWKNNMVDQMHEDIVSLWDQSLKPCVKLTPLCVTLNCTDYLGNATNTNNSSGGTVEKEEIKNCSFNITTGIRDKVQKAYAYFYKLDVVPIDDDNTNTSYRLIHCNSSVITQTCPKVSFEPIPIHYCAPAGFAILKCNNKKFSGKGQCTNVSTVQCTHGIKPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTILVQLNVSVEINCTRPNNNRRRRITSGPGKVLYTTG...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane fusion of virus membrane with host plasma membrane positive regulation of establishment of T cell polarity positive regulation of plasma membrane raft polarization positive regulation of receptor clustering viral p...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane fusion of virus membrane with host plasma membrane positive regulation of establishment of T cell polarity positive regulation of plasma membrane raft polarization positive regulation of receptor clustering viral p...
host cell endosome membrane; host cell plasma membrane; membrane; viral envelope; virion membrane
structural molecule activity
Human immunodeficiency virus type 1 group M subtype B
3D-structure AIDS Apoptosis Clathrin-mediated endocytosis of virus by host Cleavage on pair of basic residues Coiled coil Disulfide bond Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Host cell membrane Host endosome Host membrane Host-virus interaction Li...
MRVKGIRKNY
MRVKGIRKNYQHLWRGGTLLLGMLMICSAVEKLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEIVLENVTENFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLHCTNLKNATNTKSSNWKEMDRGEIKNCSFKVTTSIRNKMQKEYALFYKLDVVPIDNDNTSYKLINCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNDKKFNGSGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEGVVIRSENFTDNAKTIIVQLKESVEINCTRPNNNTRKSITIGPGRAFYATGDII...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane fusion of virus membrane with host plasma membrane positive regulation of establishment of T cell polarity positive regulation of plasma membrane raft polarization positive regulation of receptor clustering viral p...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane fusion of virus membrane with host plasma membrane positive regulation of establishment of T cell polarity positive regulation of plasma membrane raft polarization positive regulation of receptor clustering viral p...
host cell endosome membrane; host cell plasma membrane; membrane; viral envelope; virion membrane
structural molecule activity
Human immunodeficiency virus type 1 group M subtype B
3D-structure AIDS Apoptosis Clathrin-mediated endocytosis of virus by host Cleavage on pair of basic residues Coiled coil Disulfide bond Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Host cell membrane Host endosome Host membrane Host-virus interaction Li...
MRVKEKYQHL
MRVKEKYQHLWRWGWKWGIMLLGILMICSATENLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVCATHACVPTDPNPQEVILVNVTENFDMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVNLKCTDLKNDTNTNSSNGRMIMEKGEIKNCSFNISTSIRNKVQKEYAFFYKLDIRPIDNTTYRLISCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNDKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEGVIRSANFTDNAKTIIVQLNTSVEINCTRPNNNTRKSIRIQRGPGRAFVTIGK...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane fusion of virus membrane with host plasma membrane positive regulation of establishment of T cell polarity positive regulation of plasma membrane raft polarization positive regulation of receptor clustering viral p...
DNA-templated transcription modulation by virus of host chromatin organization negative regulation of peptidyl-threonine phosphorylation positive regulation of transcription elongation by RNA polymerase II positive regulation of viral transcription suppression by virus of host translation initiation suppression by viru...
extracellular region; host cell cytoplasm; host cell nucleolus
actinin binding cyclin binding metal ion binding protein domain specific binding protein serine/threonine phosphatase inhibitor activity RNA-binding transcription regulator activity trans-activation response element binding
Human immunodeficiency virus type 1 group M subtype B
Acetylation Activator AIDS Alternative splicing Apoptosis Host cytoplasm Host nucleus Host-virus interaction Inhibition of host innate immune response by virus Inhibition of host interferon signaling pathway by virus Isopeptide bond Metal-binding Methylation Modulation of host chromatin by virus Modulation of host PP1 ...
MEPVDPNLEP
MEPVDPNLEPWKHPGSQPRTACTNCYCKKCCFHCQVCFITKGLGISYGRKKRRQRQRAPDSSQNHQDSLSKQPSSQPRGDPTGPKESKKEVERETETDPLD
DNA-templated transcription modulation by virus of host chromatin organization negative regulation of peptidyl-threonine phosphorylation positive regulation of transcription elongation by RNA polymerase II positive regulation of viral transcription suppression by virus of host translation initiation suppression by viru...
DNA-templated transcription modulation by virus of host chromatin organization negative regulation of peptidyl-threonine phosphorylation positive regulation of transcription elongation by RNA polymerase II positive regulation of viral transcription suppression by virus of host translation initiation suppression by viru...
extracellular region; host cell cytoplasm; host cell nucleolus
actinin binding cyclin binding metal ion binding protein domain specific binding protein serine/threonine phosphatase inhibitor activity RNA-binding transcription regulator activity trans-activation response element binding
Human immunodeficiency virus type 1 group M subtype B
Acetylation Activator AIDS Alternative splicing Apoptosis Host cytoplasm Host nucleus Host-virus interaction Inhibition of host innate immune response by virus Inhibition of host interferon signaling pathway by virus Isopeptide bond Metal-binding Methylation Modulation of host chromatin by virus Modulation of host PP1 ...
MEPVDPRLEP
MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKGLGISYGRKKRRQRRRAPPDSEVHQVSLPKQPASQPQGDPTGPKESKKKVERETETDPVH
DNA-templated transcription modulation by virus of host chromatin organization negative regulation of peptidyl-threonine phosphorylation positive regulation of transcription elongation by RNA polymerase II positive regulation of viral transcription suppression by virus of host translation initiation suppression by viru...
viral entry into host cell virion attachment to host cell
host cell plasma membrane; membrane; viral envelope; virion membrane
structural molecule activity
Bovine immunodeficiency virus
Cleavage on pair of basic residues Coiled coil Disulfide bond Glycoprotein Host cell membrane Host membrane Host-virus interaction Membrane Transmembrane Transmembrane helix Viral attachment to host cell Viral envelope protein Virion Virus entry into host cell
MDQDLDGAER
MDQDLDGAERGERGGGSEELLQEEINEGRLTAREALQTWINNGEIHPWVLAGMLSMGVGMLLGVYCQLPDTLIWILMFQLCLYWGLGETSRELDKDSWQWVRSVFIIAILGTLTMAGTALADDDQSTLIPNITKIPTKDTEPGCTYPWILILLILAFILGILGIILVLRRSNSEDILAARDTIDWWLSANQEIPPKFAFPIILISSPLAGIIGYYVMERHLEIFKKGCQICGSLSSMWGMLLEEIGRWLARREWNVSRVMVILLISFSWGMYVNRVNASGSHVAMVTSPPGYRIVNDTSQAPWYCFSSAPIPTCSSSQWG...
viral entry into host cell virion attachment to host cell host cell plasma membrane; membrane; viral envelope; virion membrane structural molecule activity Bovine immunodeficiency virus Cleavage on pair of basic residues Coiled coil Disulfide bond Glycoprotein Host cell membrane Host membrane Host-virus interaction M...
microtubule-dependent intracellular transport of viral material towards nucleus viral budding via host ESCRT complex viral entry into host cell
host cell; viral nucleocapsid
nucleic acid binding structural constituent of virion zinc ion binding
Bovine immunodeficiency virus
Capsid protein Cytoplasmic inwards viral transport Host-virus interaction Metal-binding Microtubular inwards viral transport Repeat Ribosomal frameshifting Viral budding Viral budding via the host ESCRT complexes Viral matrix protein Viral nucleoprotein Viral release from host cell Virion Virion maturation Virus entry ...
MKRRELEKKL
MKRRELEKKLRKVRVTPQQDKYYTIGNLQWAIRMINLMGIKCVCDEECSAAEVALIITQFSALDLENSPIRGKEEVAIKNTLKVFWSLLAGYKPESTETALGYWEAFTYREREARADKEGEIKSIYPSLTQNTQNKKQTSNQTNTQSLPAITTQDGTPRFDPDLMKQLKIWSDATERNGVDLHAVNILGVITANLVQEEIKLLLNSTPKWRLDVQLIESKVREKENAHRTWKQHHPEAPKTDEIIGKGLSSAEQATLISVECRETFRQWVLQAAMEVAQAKHATPGPINIHQGPKEPYTDFINRLVAALEGMAAPETTKE...
microtubule-dependent intracellular transport of viral material towards nucleus viral budding via host ESCRT complex viral entry into host cell host cell; viral nucleocapsid nucleic acid binding structural constituent of virion zinc ion binding Bovine immunodeficiency virus Capsid protein Cytoplasmic inwards viral tr...
copper ion import denitrification pathway
membrane; periplasmic space
calcium ion binding copper ion binding cytochrome-c oxidase activity nitrous-oxide reductase activity
Stutzerimonas stutzeri
3D-structure Calcium Copper Direct protein sequencing Metal-binding Oxidoreductase Periplasm Signal
MSDKDSKNTP
MSDKDSKNTPQVPEKLGLSRRGFLGASAVTGAAVAATALGGAVMTRESWAQAVKESKQKIHVGPGELDDYYGFWSGGHQGEVRVLGVPSMRELMRIPVFNVDSATGWGLTNESRHIMGDSAKFLNGDCHHPHISMTDGKYDGKYLFINDKANSRVARIRLDIMKCDKMITVPNVQAIHGLRLQKVPHTKYVFANAEFIIPHPNDGKVFDLQDENSYTMYNAIDAETMEMAFQVIVDGNLDNTDADYTGRFAAATCYNSEKAFDLGGMMRNERDWVVVFDIHAVEAAVKAGDFITLGDSKTPVLDGRKKDGKDSKFTRYVP...
copper ion import denitrification pathway membrane; periplasmic space calcium ion binding copper ion binding cytochrome-c oxidase activity nitrous-oxide reductase activity Stutzerimonas stutzeri 3D-structure Calcium Copper Direct protein sequencing Metal-binding Oxidoreductase Periplasm Signal MSDKDSKNTP MSDKDSKNTPQVPE...
glycogen metabolic process UDP-glucose metabolic process
cytoplasm
UTP:glucose-1-phosphate uridylyltransferase activity
Solanum tuberosum
Acetylation Cytoplasm Direct protein sequencing Magnesium Nucleotidyltransferase Reference proteome Transferase
MATATTLSPA
MATATTLSPADAEKLNNLKSAVAGLNQISENEKSGFINLVGRYLSGEAQHIDWSKIQTPTDEVVVPYDKLAPLSEDPAETKKLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRNGLTFLDLIVKQIEALNAKFGCSVPLLLMNSFNTHDDTLKIVEKYANSNIDIHTFNQSQYPRLVTEDFAPLPCKGNSGKDGWYPPGHGDVFPSLMNSGKLDALLAKGKEYVFVANSDNLGAIVDLKILNHLILNKNEYCMEVTPKTLADVKGGTLISYEGKVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLSAIKRLVEADAL...
glycogen metabolic process UDP-glucose metabolic process cytoplasm UTP:glucose-1-phosphate uridylyltransferase activity Solanum tuberosum Acetylation Cytoplasm Direct protein sequencing Magnesium Nucleotidyltransferase Reference proteome Transferase MATATTLSPA MATATTLSPADAEKLNNLKSAVAGLNQISENEKSGFINLVGRYLSGEAQHIDWSKIQTP...
angiogenesis animal organ morphogenesis branch elongation involved in ureteric bud branching cell differentiation epicardial cell to mesenchymal cell transition fibroblast growth factor receptor signaling pathway lung development mesonephric epithelium development positive regulation of angiogenesis positive regulation...
cell cortex; cytoplasm; cytosol; extracellular region; extracellular space; nucleus
fibroblast growth factor receptor binding growth factor activity heparin binding integrin binding S100 protein binding
Gallus gallus
Angiogenesis Cytoplasm Developmental protein Differentiation Direct protein sequencing Growth factor Heparin-binding Mitogen Nucleus Reference proteome Secreted
MAEGEITTFT
MAEGEITTFTALTERFGLPLGNYKKPKLLYCSNGGHFLRILPDGKVDGTRDRSDQHIQLQLSAEDVGEVYIKSTASGQYLAMDTNGLLYGSQLPGEECLFLERLEENHYNTYISKKHADKNWFVGLKKNGNSKLGPRTHYGQKAILFLPLPVSAD
angiogenesis animal organ morphogenesis branch elongation involved in ureteric bud branching cell differentiation epicardial cell to mesenchymal cell transition fibroblast growth factor receptor signaling pathway lung development mesonephric epithelium development positive regulation of angiogenesis positive regulation...
leukotriene biosynthetic process peptide catabolic process proteolysis
cytoplasm
aminopeptidase activity epoxide hydrolase activity leukotriene-A4 hydrolase activity metallopeptidase activity tripeptide aminopeptidase activity zinc ion binding
Cavia porcellus
Acetylation Cytoplasm Direct protein sequencing Hydrolase Leukotriene biosynthesis Metal-binding Metalloprotease Phosphoprotein Protease Reference proteome Zinc
MPEVVDTCSL
MPEVVDTCSLASPATVCRTKHLHLRCSVDFTRRALTGVAALTIQSQEDNLRSLILDTKDLTIEKVVINGQEVKYALGEKQSYKGSPMEISLPIALSKNQEVVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAFLPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGEAPDPADPSRKIYKFSQKVPIPCYLIALVVGALESRKIGPRTLVWSEKEQVDKSAYEFSETESMLKIAEDLGGPYVWGQYDRLVLPPSFSYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHTWTGNLVTNKTWDHFWLNEG...
leukotriene biosynthetic process peptide catabolic process proteolysis cytoplasm aminopeptidase activity epoxide hydrolase activity leukotriene-A4 hydrolase activity metallopeptidase activity tripeptide aminopeptidase activity zinc ion binding Cavia porcellus Acetylation Cytoplasm Direct protein sequencing Hydrolase Le...
positive regulation by host of viral process positive regulation of viral life cycle
AnxA2-p11 complex; basement membrane; collagen-containing extracellular matrix; cytoplasm; endosome; extracellular space; melanosome; nucleus; plasma membrane; vesicle
calcium channel activity calcium ion binding calcium-dependent phospholipid binding cytoskeletal protein binding phosphatidylinositol-4,5-bisphosphate binding phosphatidylserine binding phospholipase A2 inhibitor activity protease binding S100 protein binding virion binding
Sus scrofa
Acetylation Annexin Basement membrane Calcium Calcium/phospholipid-binding Direct protein sequencing Extracellular matrix Isopeptide bond Phosphoprotein Reference proteome Repeat Secreted Ubl conjugation
MSTVHEILCK
MSTVHEILCKLSLEGDHSTPASAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERYKSYSPYDMLESIKKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIXIMVSRSEVDMLKIRSEFKRKYGKSLYNYIQ...
positive regulation by host of viral process positive regulation of viral life cycle AnxA2-p11 complex; basement membrane; collagen-containing extracellular matrix; cytoplasm; endosome; extracellular space; melanosome; nucleus; plasma membrane; vesicle calcium channel activity calcium ion binding calcium-dependent phos...
dopaminergic neuron differentiation embryonic brain development hindbrain development midbrain development negative regulation of neuron apoptotic process neuron development neuron differentiation positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II
chromatin; fibrillar center; nucleolus; nucleoplasm; nucleus
DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific double-stranded DNA binding
Homo sapiens
Autism Autism spectrum disorder Developmental protein DNA-binding Homeobox Nucleus Reference proteome
MEENDPKPGE
MEENDPKPGEAAAAVEGQRQPESSPGGGSGGGGGSSPGEADTGRRRALMLPAVLQAPGNHQHPHRITNFFIDNILRPEFGRRKDAGTCCAGAGGGRGGGAGGEGGASGAEGGGGAGGSEQLLGSGSREPRQNPPCAPGAGGPLPAAGSDSPGDGEGGSKTLSLHGGAKKGGDPGGPLDGSLKARGLGGGDLSVSSDSDSSQAGANLGAQPMLWPAWVYCTRYSDRPSSGPRSRKPKKKNPNKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYN...
dopaminergic neuron differentiation embryonic brain development hindbrain development midbrain development negative regulation of neuron apoptotic process neuron development neuron differentiation positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II chromatin; fibri...
cellular response to leukemia inhibitory factor polyamine metabolic process spermidine biosynthetic process
cytosol
identical protein binding protein homodimerization activity spermidine synthase activity
Homo sapiens
3D-structure Acetylation Polyamine biosynthesis Reference proteome Spermidine biosynthesis Transferase
MEPGPDGPAA
MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS
cellular response to leukemia inhibitory factor polyamine metabolic process spermidine biosynthetic process cytosol identical protein binding protein homodimerization activity spermidine synthase activity Homo sapiens 3D-structure Acetylation Polyamine biosynthesis Reference proteome Spermidine biosynthesis Transferase...
pyridoxal phosphate biosynthetic process pyridoxine biosynthetic process
cytoplasm
4-hydroxythreonine-4-phosphate dehydrogenase activity cobalt ion binding identical protein binding magnesium ion binding NAD binding protein homodimerization activity zinc ion binding
Escherichia coli
3D-structure Cobalt Cytoplasm Magnesium Metal-binding NAD NADP Oxidoreductase Pyridoxine biosynthesis Reference proteome Zinc
MVKTQRVVIT
MVKTQRVVITPGEPAGIGPDLVVQLAQREWPVELVVCADATLLTNRAAMLGLPLTLRPYSPNSPAQPQTAGTLTLLPVALRAPVTAGQLAVENGHYVVETLARACDGCLNGEFAALITGPVHKGVINDAGIPFTGHTEFFEERSQAKKVVMMLATEELRVALATTHLPLRDIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEEIDTIIPVLNELRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRGVNITLGLPFIRTSVDHGTALELAGRGKADVGSFITALNL...
pyridoxal phosphate biosynthetic process pyridoxine biosynthetic process cytoplasm 4-hydroxythreonine-4-phosphate dehydrogenase activity cobalt ion binding identical protein binding magnesium ion binding NAD binding protein homodimerization activity zinc ion binding Escherichia coli 3D-structure Cobalt Cytoplasm Magnes...
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway adenylate cyclase-modulating G protein-coupled receptor signaling pathway G protein-coupled serotonin receptor signaling pathway negative regulation of insulin secretion
cell body; dendrite; heterotrimeric G-protein complex; plasma membrane
adenylate cyclase inhibitor activity G protein-coupled receptor binding G protein-coupled serotonin receptor binding G-protein beta/gamma-subunit complex binding GTP binding GTPase activity metal ion binding
Rattus norvegicus
GTP-binding Lipoprotein Magnesium Membrane Metal-binding Myristate Nucleotide-binding Palmitate Reference proteome Transducer
MGCRQSSEEK
MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGGFNLEACKEYKPLIIYNAIDSLTRIIRALAALKIDFHNPDRAYDAVQLFALTGPAESKGEITPELLGVMRRLWADPGAQACFGRSSEYHLEDNAAYYLNDLERIAAPDYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQTSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLSEKIRRIPLSVCFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEI...
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway adenylate cyclase-modulating G protein-coupled receptor signaling pathway G protein-coupled serotonin receptor signaling pathway negative regulation of insulin secretion cell body; dendrite; heterotrimeric G-protein complex; plasma membrane adeny...
ATP biosynthetic process flagellated sperm motility lactate biosynthetic process from pyruvate lactate metabolic process lactate oxidation pyruvate catabolic process pyruvate metabolic process
cilium; cytoplasm; cytosol; mitochondrion; motile cilium
L-lactate dehydrogenase activity
Rattus norvegicus
Cytoplasm Direct protein sequencing NAD Oxidoreductase Reference proteome
MSTVKEQLIQ
MSTVKEQLIQNLAPDEKQSRCKITVVGVGNVGMACAISILLKGLADELALVDADENKLKGEALDLLHGSLFLSTPKIVFGKDYSVSANSKLVIITAGARMVSGESRLALLQRNVTSMKAIVPGVIQNSPDCKIMIVTNPVDILTYVVWKISGLPVSSVIGSGCNLDSARFRYLIGEKLGVNPSSCHGWVLGEHGDSSVPIWSGVNIAGVTLKSLNPAIGSDSDKEQWKTVHKQVVDGGYEVLNLKGYTSWAIALSVTDIAASILKNLKRVHAVTTLVKGLYGIKEEIFLSIPCVLGQSGITDLVKVNMNTEEEALFKKSC...
ATP biosynthetic process flagellated sperm motility lactate biosynthetic process from pyruvate lactate metabolic process lactate oxidation pyruvate catabolic process pyruvate metabolic process cilium; cytoplasm; cytosol; mitochondrion; motile cilium L-lactate dehydrogenase activity Rattus norvegicus Cytoplasm Direct pr...
endoplasmic reticulum organization positive regulation of release of sequestered calcium ion into cytosol positive regulation of store-operated calcium channel activity protein polymerization regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum regulation of sequestering of calcium io...
endoplasmic reticulum; I band; mitochondrial matrix; myofibril; sarcolemma; sarcoplasmic reticulum; sarcoplasmic reticulum lumen; sarcoplasmic reticulum membrane; T-tubule; terminal cisterna; terminal cisterna lumen; Z disc
calcium ion binding identical protein binding
Rattus norvegicus
Calcium Direct protein sequencing Endoplasmic reticulum Glycoprotein Membrane Metal-binding Mitochondrion Muscle protein Phosphoprotein Reference proteome Sarcoplasmic reticulum Signal
MRATDRMGAR
MRATDRMGARAVSKLRLALLFVLVLGTPRSGVQGEDGLDFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLTEEDSVYVFKGDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDEIKLIGYFKSKDSEHYKAYEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVSFVEEHRRSTLRKLKPESMYETWEDDLDGIHIVAFAEEADPDGYEFLETLKAVAQDNTENPDLSIIW...
endoplasmic reticulum organization positive regulation of release of sequestered calcium ion into cytosol positive regulation of store-operated calcium channel activity protein polymerization regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum regulation of sequestering of calcium io...
amino acid metabolic process ethanolamine catabolic process
ethanolamine ammonia-lyase complex; ethanolamine degradation polyhedral organelle
cobalamin binding ethanolamine ammonia-lyase activity
Escherichia coli
3D-structure Bacterial microcompartment Cobalamin Cobalt Direct protein sequencing Lyase Reference proteome
MDQKQIEEIV
MDQKQIEEIVRSVMASMGQAAPAPSEAKCATTNCAAPVTSESCALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR
amino acid metabolic process ethanolamine catabolic process ethanolamine ammonia-lyase complex; ethanolamine degradation polyhedral organelle cobalamin binding ethanolamine ammonia-lyase activity Escherichia coli 3D-structure Bacterial microcompartment Cobalamin Cobalt Direct protein sequencing Lyase Reference proteome...
cellular response to dexamethasone stimulus cellular response to follicle-stimulating hormone stimulus cellular response to luteinizing hormone stimulus negative regulation of proteolysis plasminogen activation platelet-derived growth factor receptor signaling pathway prevention of polyspermy proteolysis regulation of ...
apical part of cell; cell surface; cytoplasm; extracellular space; glutamatergic synapse; neuronal dense core vesicle; perisynaptic space; postsynapse; Schaffer collateral - CA1 synapse; secretory granule; serine protease inhibitor complex; synapse
phosphoprotein binding serine-type endopeptidase activity signaling receptor binding
Rattus norvegicus
Cleavage on pair of basic residues Disulfide bond EGF-like domain Glycoprotein Hydrolase Kringle Plasminogen activation Protease Reference proteome Repeat Secreted Serine protease Signal Zymogen
MKGELLCVLL
MKGELLCVLLLCGVAFTLPDQGIHRRFRRGARSYRATCRDEQTQTTYQQHQSWLRPMLRGNRVEYCRCNSGLAQCHSVPVRSCSEPRCFNGGTCQQALYFSDFVCQCPDGFVGKRCDIDTRATCFEGQGITYRGTWSTAENGAECINWNSSALSQKPYSARRPNAIKLGLGNHNYCRNPDRDVKPWCYVFKAGKYTTEFCSTPACPKGPTEDCYVGKGVTYRGTHSFTTSKASCLPWNSMILIGKTYTAWRANSQALGLGRHNYCRNPDGDAKPWCHVMKDRKLTWEYCDMSPCSTCGLRQYKQPQFRIKGGLFTDITSH...
cellular response to dexamethasone stimulus cellular response to follicle-stimulating hormone stimulus cellular response to luteinizing hormone stimulus negative regulation of proteolysis plasminogen activation platelet-derived growth factor receptor signaling pathway prevention of polyspermy proteolysis regulation of ...
cellular response to organic cyclic compound cellular response to xenobiotic stimulus response to bacterium
cytoplasm; cytosol; intercellular bridge
enzyme binding glutathione binding glutathione transferase activity protein homodimerization activity
Mus musculus
Cytoplasm Direct protein sequencing Isopeptide bond Reference proteome Transferase Ubl conjugation
MPMTLGYWNT
MPMTLGYWNTRGLTHSIRLLLEYTDSSYEEKRYVMGDAPNFDRSQWLSEKFNLGLDFPNLPYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDTLENQVMDTRIQLMIVCCSPDFEKQKPEFLKAIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRFLPRPVFTKIAQWGTD
cellular response to organic cyclic compound cellular response to xenobiotic stimulus response to bacterium cytoplasm; cytosol; intercellular bridge enzyme binding glutathione binding glutathione transferase activity protein homodimerization activity Mus musculus Cytoplasm Direct protein sequencing Isopeptide bond Refe...
negative regulation of serotonin secretion phenylethylamine catabolic process positive regulation of dopamine metabolic process response to aluminum ion response to corticosterone response to ethanol response to lipopolysaccharide response to selenium ion response to steroid hormone response to toxic substance response...
dendrite; mitochondrial outer membrane; mitochondrion; neuronal cell body
aliphatic amine oxidase activity flavin adenine dinucleotide binding identical protein binding monoamine oxidase activity phenethylamine:oxygen oxidoreductase (deaminating) activity primary amine oxidase activity
Rattus norvegicus
Acetylation FAD Flavoprotein Membrane Mitochondrion Mitochondrion outer membrane Oxidoreductase Reference proteome Transmembrane Transmembrane helix
MSNKCDVIVV
MSNKCDVIVVGGGISGMAAAKLLHDCGLSVVVLEARDRVGGRTYTIRNKNVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEVERLIHFVKGKSYAFRGPFPPVWNPITYLDYNNLWRTMDEMGQEIPSDAPWKAPLAEEWDYMTMKELLDKICWTNSTKQIATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQERKFIGGSGQVSERIKDILGDRVKLERPVIHIDQTGENVVVKTLNHEIYEAKYVISAIPPVLGMKIHHSPPLPILRNQLITRVPLGSVIKCMVYYKEPFWRKKDFCGTMVIEGE...
negative regulation of serotonin secretion phenylethylamine catabolic process positive regulation of dopamine metabolic process response to aluminum ion response to corticosterone response to ethanol response to lipopolysaccharide response to selenium ion response to steroid hormone response to toxic substance response...
proton export across plasma membrane proton transmembrane transport regulation of intracellular pH
cell periphery; mitochondrion; plasma membrane
ATP binding ATP hydrolysis activity metal ion binding P-type proton-exporting transporter activity
Saccharomyces cerevisiae
ATP-binding Cell membrane Hydrogen ion transport Ion transport Magnesium Membrane Metal-binding Nucleotide-binding Reference proteome Translocase Transmembrane Transmembrane helix Transport
MSSTEAKQYK
MSSTEAKQYKEKPSKEYLHASDGDDPANNSAASSSSSSSTSTSASSSAAAVPRKAAAASAADDSDSDEDIDQLIDELQSNYGEGDESGEEEVRTDGVHAGQRVVPEKDLSTDPAYGLTSDEVARRRKKYGLNQMAEENESLIVKFLMFFVGPIQFVMEAAAILAAGLSDWVDVGVICALLLLNASVGFIQEFQAGSIVDELKKTLANTATVIRDGQLIEIPANEVVPGEILQLESGTIAPADGRIVTEDCFLQIDQSAITGESLAAEKHYGDEVFSSSTVKTGEAFMVVTATGDNTFVGRAAALVGQASGVEGHFTEVLN...
proton export across plasma membrane proton transmembrane transport regulation of intracellular pH cell periphery; mitochondrion; plasma membrane ATP binding ATP hydrolysis activity metal ion binding P-type proton-exporting transporter activity Saccharomyces cerevisiae ATP-binding Cell membrane Hydrogen ion transport ...
exocyst assembly exocyst localization exocytosis Golgi to plasma membrane transport protein transport Rho protein signal transduction vesicle docking involved in exocytosis
cellular bud neck; cellular bud tip; cytoplasm; exocyst; incipient cellular bud site; mating projection tip; plasma membrane; prospore membrane; transport vesicle
phosphatidylinositol-4,5-bisphosphate binding small GTPase binding
Saccharomyces cerevisiae
3D-structure Cytoplasmic vesicle Direct protein sequencing Exocytosis Protein transport Reference proteome Transport
MPAEIDIDEA
MPAEIDIDEADVLVLSQELQKTSKLTFEINKSLKKIAATSNQSSQLFTPILARNNVLTTLQRNIESTLNSVASVKDLANEASKYEIILQKGINQVGLKQYTQVVHKLDDMLEDIQSGQANREENSEFHGILTHLEQLIKRSEAQLRVYFISILNSIKPFDPQINITKKMPFPYYEDQQLGALSWILDYFHGNSEGSIIQDILVGERSKLILKCMAFLEPFAKEISTAKNAPYEKGSSGMNSYTEALLGFIANEKSLVDDLYSQYTESKPHVLSQILSPLISAYAKLFGANLKIVRSNLENFGFFSFELVESINDVKKSLR...
exocyst assembly exocyst localization exocytosis Golgi to plasma membrane transport protein transport Rho protein signal transduction vesicle docking involved in exocytosis cellular bud neck; cellular bud tip; cytoplasm; exocyst; incipient cellular bud site; mating projection tip; plasma membrane; prospore membrane; tr...
cGMP biosynthetic process cGMP-mediated signaling nitric oxide mediated signal transduction nitric oxide-cGMP-mediated signaling pathway positive regulation of nitric oxide mediated signal transduction regulation of blood pressure relaxation of vascular associated smooth muscle response to herbicide response to organic...
GABA-ergic synapse; glutamatergic synapse; guanylate cyclase complex, soluble; protein-containing complex; synapse
GTP binding guanylate cyclase activity heme binding ion binding protein-containing complex binding
Rattus norvegicus
cGMP biosynthesis Cytoplasm Direct protein sequencing GTP-binding Lyase Nucleotide-binding Phosphoprotein Reference proteome
MFCRKFKDLK
MFCRKFKDLKITGECPFSLLAPGQVPTEPIEEVAGVSESCQATLPTCQEFAENAEGSHPQRKTSRNRVYLHTLAESIGKLIFPEFERLNLALQRTLAKHKIKENRNSSEKEDLERIIAEEAIAAGVPVEVLKDSLGEELFKICYEEDEHILGVVGGTLKDFLNSFSTLLKQSSHCQEAERRGRLEDASILCLDKDQDFLNVYYFFPKRTTALLLPGIIKAAARILYESHVEVSLMPPCFRSECTEFVNQPYLLYSVHVKSTKPSLSPGKPQSSLVIPTSLFCKTFPFHFMLDRDLAILQLGNGIRRLVNKRDFQGKPNFE...
cGMP biosynthetic process cGMP-mediated signaling nitric oxide mediated signal transduction nitric oxide-cGMP-mediated signaling pathway positive regulation of nitric oxide mediated signal transduction regulation of blood pressure relaxation of vascular associated smooth muscle response to herbicide response to organic...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane fusion of virus membrane with host plasma membrane viral budding from plasma membrane virion attachment to host cell
host cell plasma membrane; membrane; viral envelope; virion membrane
host cell surface receptor binding
Influenza A virus
Clathrin- and caveolin-independent endocytosis of virus by host Clathrin-mediated endocytosis of virus by host Disulfide bond Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Hemagglutinin Host cell membrane Host membrane Host-virus interaction Lipoprotein M...
MLSIVVLLLL
MLSIVVLLLLIAESSSQNYTGNPVICMGHHAVANGTMVKTLTDDQVEVVTAQELVESQILPELCPSPLRLVDGQTCDIVNGALGSPGCDHLNGAEWDVFIERPSAVDTCYPFDVPDYQSLRSILANNGKFEFIAEEFQWNTVKQNGKSGACKRANVNDFFNRLNWLVKSDGNAYPLQNLTKINNGDYARLYIWGVHHPSTDTEQTNLYKNNPGRVTVSTKTSQTSVVPNIGSRPLVRGQSGRISFYWTIVEPGDLIVFNTIGNLIAPRGHYKLDSQKKSTILNTAVPIGSCVSKCHTDKGSLSTTKPFQNISRIAIGDCP...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane fusion of virus membrane with host plasma membrane viral budding from plasma membrane virion attachment to host cell host cell plasma membrane; membrane; viral envelope; virion membrane host cell surface receptor b...
aerobic phenol-containing compound catabolic process
extrachromosomal circular DNA
2 iron, 2 sulfur cluster binding metal ion binding phenol 2-monooxygenase activity
Pseudomonas sp.
2Fe-2S Aromatic hydrocarbons catabolism Direct protein sequencing Electron transport FAD Flavoprotein Iron Iron-sulfur Metal-binding Monooxygenase NAD Oxidoreductase Plasmid Transport
MSYNVTIEPT
MSYNVTIEPTGEVIEVEDGQTILQAALRQGVWLPFACGHGTCATCKVQVVEGEVDIGEASPFALMDIERDERKVLACCAIPLSDLVIEADVDADPDFLGHPVEDYRGVVSALVDLSPTIKGLHIKLDRPMPFQAGQYVNLALPGIDGTRAFSLANPPSRNDEVELHVRLVEGGAATGFIHKQLKVGDAVELSGPYGQFFVRDSQAGDLIFIAGGSGLSSPQSMILDLLERGDTRRITLFQGARNRAELYNCELFEELAARHPNFSYVPALNQANDDPEWQGFKGFVHDAAKAHFDGRFGGQKAYLCGPPPMIDAAITTLM...
aerobic phenol-containing compound catabolic process extrachromosomal circular DNA 2 iron, 2 sulfur cluster binding metal ion binding phenol 2-monooxygenase activity Pseudomonas sp. 2Fe-2S Aromatic hydrocarbons catabolism Direct protein sequencing Electron transport FAD Flavoprotein Iron Iron-sulfur Metal-binding Monoo...
cytokine-mediated signaling pathway endocytosis growth hormone receptor signaling pathway positive regulation of peptidyl-tyrosine phosphorylation positive regulation of receptor signaling pathway via JAK-STAT
cytosol; external side of plasma membrane; extracellular region; growth hormone receptor complex
cytokine binding growth factor binding growth hormone receptor activity peptide hormone binding
Sus scrofa
Cell membrane Disulfide bond Endocytosis Glycoprotein Membrane Phosphoprotein Receptor Reference proteome Secreted Signal Transmembrane Transmembrane helix Ubl conjugation
MDLWQLLLTL
MDLWQLLLTLAVAGSSDAFSGSEATPAVLVRASQSLQRVHPGLETNSSGKPKFTKCRSPELETFSCHWTDGVRHGLQSPGSIQLFYIRRSTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTSNGGTVDQKCFSVEEIVQPDPPIGLNWTLLNISLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRNSEKYGEFSEVLYVTLPQMSPFACEEDFRFPWFLIIIFGIFGLTVILFLLIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLE...
cytokine-mediated signaling pathway endocytosis growth hormone receptor signaling pathway positive regulation of peptidyl-tyrosine phosphorylation positive regulation of receptor signaling pathway via JAK-STAT cytosol; external side of plasma membrane; extracellular region; growth hormone receptor complex cytokine bind...
apoptotic process cell cycle cerebral cortex development double-strand break repair liver regeneration negative regulation of apoptotic signaling pathway negative regulation of ubiquitin-dependent protein catabolic process peptidyl-serine phosphorylation positive regulation of protein targeting to mitochondrion regulat...
acrosomal vesicle; chromatin; cytosol; nucleoplasm; nucleus; protein kinase CK2 complex
ATP binding protein serine kinase activity protein serine/threonine kinase activity
Homo sapiens
3D-structure Acetylation Apoptosis ATP-binding Cell cycle Cytoplasm Kinase Nucleotide-binding Nucleus Phosphoprotein Reference proteome Serine/threonine-protein kinase Transcription Transcription regulation Transferase Wnt signaling pathway
MPGPAAGSRA
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAM...
apoptotic process cell cycle cerebral cortex development double-strand break repair liver regeneration negative regulation of apoptotic signaling pathway negative regulation of ubiquitin-dependent protein catabolic process peptidyl-serine phosphorylation positive regulation of protein targeting to mitochondrion regulat...
anatomical structure development cell differentiation hormone-mediated signaling pathway mRNA transcription by RNA polymerase II negative regulation of transcription by RNA polymerase II peroxisome proliferator activated receptor signaling pathway positive regulation of bone mineralization positive regulation of choles...
chromatin; cytosol; mitochondrion; nucleoplasm; nucleus; receptor complex; RNA polymerase II transcription regulator complex; transcription regulator complex
DNA binding domain binding DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific double-stranded DNA binding enzyme binding identical protein binding ion binding LBD domain binding nuclear receptor activity nuclear receptor binding nuclear steroid receptor activ...
Homo sapiens
3D-structure Acetylation Alternative splicing Cytoplasm DNA-binding Host-virus interaction Isopeptide bond Metal-binding Mitochondrion Nucleus Phosphoprotein Receptor Reference proteome Transcription Transcription regulation Ubl conjugation Zinc Zinc-finger
MDTKHFLPLD
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAV...
anatomical structure development cell differentiation hormone-mediated signaling pathway mRNA transcription by RNA polymerase II negative regulation of transcription by RNA polymerase II peroxisome proliferator activated receptor signaling pathway positive regulation of bone mineralization positive regulation of choles...
adenylate cyclase-activating G protein-coupled receptor signaling pathway cellular response to fatty acid cellular response to glucose stimulus cellular response to oxidative stress CTP biosynthetic process GTP biosynthetic process integrin-mediated signaling pathway negative regulation of apoptotic process negative re...
cell periphery; cytoplasm; lamellipodium; mitochondrial membrane; nucleus; perinuclear region of cytoplasm; ruffle
ATP binding DNA binding enzyme binding fatty acid binding G-quadruplex DNA binding GDP binding heterocyclic compound binding identical protein binding intermediate filament binding metal ion binding nucleoside diphosphate kinase activity protein histidine kinase activity protein serine/threonine kinase activity transcr...
Rattus norvegicus
ATP-binding Cell projection Cytoplasm Direct protein sequencing DNA-binding Kinase Magnesium Metal-binding Nucleotide metabolism Nucleotide-binding Nucleus Reference proteome Transcription Transcription regulation Transferase
MANLERTFIA
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFKPEELIDYKSCAHDWVYE
adenylate cyclase-activating G protein-coupled receptor signaling pathway cellular response to fatty acid cellular response to glucose stimulus cellular response to oxidative stress CTP biosynthetic process GTP biosynthetic process integrin-mediated signaling pathway negative regulation of apoptotic process negative re...
(R)-carnitine transport amino acid transport choline transport ethanolamine transport glycine betaine transport
cell periphery; endoplasmic reticulum; membrane
(R)-carnitine transmembrane transporter activity choline transmembrane transporter activity ethanolamine transmembrane transporter activity
Saccharomyces cerevisiae
Amino-acid transport Glycoprotein Membrane Phosphoprotein Reference proteome Transmembrane Transmembrane helix Transport
MSIRNDNASG
MSIRNDNASGGYMQPDQSSNASMHKRDLRVEEEIKPLDDMDSKGAVAADGEVHLRKSFSLWSILGVGFGLTNSWFGISTSMVAGISSGGPMMIVYGIIIVALISICIGTSLGELSSAYPHAGGQFWWSLKLAPPKYKRFAAYMCGSFAYAGSVFTSASTTLSVATEVVGMYALTHPEFIPKRWHIFVCFELLHLFLMFFNCYGKSLPIISSSSLYISLLSFFTITITVLACSHGKFNDAKFVFATFNNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIMGTVAIGFVTSFCYVIAMFFSIQDLD...
(R)-carnitine transport amino acid transport choline transport ethanolamine transport glycine betaine transport cell periphery; endoplasmic reticulum; membrane (R)-carnitine transmembrane transporter activity choline transmembrane transporter activity ethanolamine transmembrane transporter activity Saccharomyces cerevi...
trehalose catabolic process
membrane; plasma membrane; side of membrane
alpha,alpha-trehalase activity
Oryctolagus cuniculus
Cell membrane Direct protein sequencing Disulfide bond Glycoprotein Glycosidase GPI-anchor Hydrolase Lipoprotein Membrane Reference proteome Signal
MPGSTWELHL
MPGSTWELHLLLLLGLGLGSEQALPPPCESQIYCHGELLHQVQMARLYPDDKQFVDMPLSTAPDQVLQSFAELAATYNNTVPREQLEKFVQEHFQAVGQELESWTPGDWKESPQFLQKISDPKLRAWAEQLHLLWKKLGKKIKPEVLSQPERFSLIYSQHPFIVPGGRFVEFYYWDSYWVMEGLLLSEMAETVKGMLQNFLDLVTAYGHIPNGGRVYYLQRSQPPLLTLMMDRYVAHTGDLAFLRENIETLALELDFWAENRTISVSSGGNSHTLNRYHVPYGGPRPESYSKDTELAHTLPEGSWETLWAELKAGAESGW...
trehalose catabolic process membrane; plasma membrane; side of membrane alpha,alpha-trehalase activity Oryctolagus cuniculus Cell membrane Direct protein sequencing Disulfide bond Glycoprotein Glycosidase GPI-anchor Hydrolase Lipoprotein Membrane Reference proteome Signal MPGSTWELHL MPGSTWELHLLLLLGLGLGSEQALPPPCESQIYCHG...
hyaluronan metabolic process
blood microparticle; collagen-containing extracellular matrix; endoplasmic reticulum lumen; extracellular exosome; extracellular region
endopeptidase inhibitor activity hyaluronic acid binding serine-type endopeptidase inhibitor activity
Homo sapiens
Direct protein sequencing Disulfide bond Gamma-carboxyglutamic acid Glycoprotein Phosphoprotein Protease inhibitor Proteoglycan Reference proteome Secreted Serine protease inhibitor Signal
MKRLTCFFIC
MKRLTCFFICFFLSEVSGFEIPINGLSEFVDYEDLVELAPGKFQLVAENRRYQRSLPGESEEMMEEVDQVTLYSYKVQSTITSRMATTMIQSKVVNNSPQPQNVVFDVQIPKGAFISNFSMTVDGKTFRSSIKEKTVGRALYAQARAKGKTAGLVRSSALDMENFRTEVNVLPGAKVQFELHYQEVKWRKLGSYEHRIYLQPGRLAKHLEVDVWVIEPQGLRFLHVPDTFEGHFDGVPVISKGQQKAHVSFKPTVAQQRICPNCRETAVDGELVVLYDVKREEKAGELEVFNGYFVHFFAPDNLDPIPKNILFVIDVSGS...
hyaluronan metabolic process blood microparticle; collagen-containing extracellular matrix; endoplasmic reticulum lumen; extracellular exosome; extracellular region endopeptidase inhibitor activity hyaluronic acid binding serine-type endopeptidase inhibitor activity Homo sapiens Direct protein sequencing Disulfide bond...
phosphorylation reductive pentose-phosphate cycle response to cold
chloroplast; stromule; supramolecular complex
ATP binding disordered domain specific binding enzyme binding phosphoribulokinase activity protein homodimerization activity
Chlamydomonas reinhardtii
3D-structure ATP-binding Calvin cycle Chloroplast Direct protein sequencing Disulfide bond Kinase Nucleotide-binding Photosynthesis Plastid Transferase Transit peptide
MAFTMRAPAP
MAFTMRAPAPRATAQSRVTANRARRSLVVRADKDKTVVIGLAADSGCGKSTFMRRMTSIFGGVPKPPAGGNPDSNTLISDMTTVICLDDYHCLDRNGRKVKGVTALAPEAQNFDLMYNQVKALKEGKSVDKPIYNHVSGLIDAPEKIESPPILVIEGLHPFYDKRVAELLDFKIYLDISDDIKFAWKIQRDMAERGHSLESIKSSIAARKPDFDAYIDPQKKDADMIIQVLPTQLVPDDKGQYLRVRLIMKEGSKMFDPVYLFDEGSTISWIPCGRKLTCSFPGIKMFYGPDTWYGQEVSVLEMDGQFDKLEELIYVESH...
phosphorylation reductive pentose-phosphate cycle response to cold chloroplast; stromule; supramolecular complex ATP binding disordered domain specific binding enzyme binding phosphoribulokinase activity protein homodimerization activity Chlamydomonas reinhardtii 3D-structure ATP-binding Calvin cycle Chloroplast Direct...
hyaluronan metabolic process
blood microparticle; collagen-containing extracellular matrix; extracellular exosome; extracellular region
calcium ion binding carbohydrate binding hyaluronic acid binding serine-type endopeptidase inhibitor activity
Homo sapiens
3D-structure Alternative splicing Direct protein sequencing Disulfide bond Glycoprotein Phosphoprotein Protease inhibitor Proteoglycan Reference proteome Secreted Serine protease inhibitor Signal
MDGAMGPRGL
MDGAMGPRGLLLCMYLVSLLILQAMPALGSATGRSKSSEKRQAVDTAVDGVFIRSLKVNCKVTSRFAHYVVTSQVVNTANEAREVAFDLEIPKTAFISDFAVTADGNAFIGDIKDKVTAWKQYRKAAISGENAGLVRASGRTMEQFTIHLTVNPQSKVTFQLTYEEVLKRNHMQYEIVIKVKPKQLVHHFEIDVDIFEPQGISKLDAQASFLPKELAAQTIKKSFSGKKGHVLFRPTVSQQQSCPTCSTSLLNGHFKVTYDVSRDKICDLLVANNHFAHFFAPQNLTNMNKNVVFVIDISGSMRGQKVKQTKEALLKILG...
hyaluronan metabolic process blood microparticle; collagen-containing extracellular matrix; extracellular exosome; extracellular region calcium ion binding carbohydrate binding hyaluronic acid binding serine-type endopeptidase inhibitor activity Homo sapiens 3D-structure Alternative splicing Direct protein sequencing D...
ceramide catabolic process intestinal cholesterol absorption lipid metabolic process pancreatic juice secretion
cytoplasm; extracellular exosome; extracellular region; extracellular space
acetylesterase activity catalytic activity heparin binding hydrolase activity retinyl-palmitate esterase activity sterol esterase activity triglyceride lipase activity
Homo sapiens
3D-structure Alternative splicing Diabetes mellitus Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Lipid degradation Lipid metabolism Reference proteome Repeat Secreted Serine esterase Signal
MGRLQLVVLG
MGRLQLVVLGLTCCWAVASAAKLGAVYTEGGFVEGVNKKLGLLGDSVDIFKGIPFAAPTKALENPQPHPGWQGTLKAKNFKKRCLQATITQDSTYGDEDCLYLNIWVPQGRKQVSRDLPVMIWIYGGAFLMGSGHGANFLNNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNYGLRDQHMAIAWVKRNIAAFGGDPNNITLFGESAGGASVSLQTLSPYNKGLIRRAISQSGVALSPWVIQKNPLFWAKKVAEKVGCPVGDAARMAQCLKVTDPRALTLAYKVPLAGLEYPMLHYVGFVPVIDGDFIPADP...
ceramide catabolic process intestinal cholesterol absorption lipid metabolic process pancreatic juice secretion cytoplasm; extracellular exosome; extracellular region; extracellular space acetylesterase activity catalytic activity heparin binding hydrolase activity retinyl-palmitate esterase activity sterol esterase ac...
CDP-choline pathway phosphatidylcholine biosynthetic process
cytosol; endoplasmic reticulum; endoplasmic reticulum membrane; extrinsic component of membrane; glycogen granule; nuclear envelope; nucleus
calmodulin binding choline-phosphate cytidylyltransferase activity identical protein binding lipid binding molecular function inhibitor activity phosphatidylcholine binding protein homodimerization activity
Rattus norvegicus
3D-structure Acetylation Cytoplasm Direct protein sequencing Endoplasmic reticulum Lipid biosynthesis Lipid metabolism Membrane Nucleotidyltransferase Nucleus Phospholipid biosynthesis Phospholipid metabolism Phosphoprotein Reference proteome Repeat Transferase Ubl conjugation
MDAQSSAKVN
MDAQSSAKVNSRKRRKEVPGPNGATEEDGIPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEACRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKKYHLQERVDKVKKKVKDVEEKSKEFVQKVEEKSIDLIQKWEEKSREFIGSFLEMFGPEGALKHMLKEGKGRMLQAISPKQSP...
CDP-choline pathway phosphatidylcholine biosynthetic process cytosol; endoplasmic reticulum; endoplasmic reticulum membrane; extrinsic component of membrane; glycogen granule; nuclear envelope; nucleus calmodulin binding choline-phosphate cytidylyltransferase activity identical protein binding lipid binding molecular f...
ethanol oxidation fatty acid omega-oxidation formaldehyde catabolic process
cytosol
alcohol dehydrogenase activity, zinc-dependent S-(hydroxymethyl)glutathione dehydrogenase activity S-(hydroxymethyl)glutathione dehydrogenase NAD activity S-(hydroxymethyl)glutathione dehydrogenase NADP activity zinc ion binding
Equus caballus
Acetylation Cytoplasm Direct protein sequencing Lipid metabolism Metal-binding NAD Oxidoreductase Phosphoprotein Reference proteome Zinc
MSAEVIKCKA
MSAEVIKCKAAVAWEAGKPVSIEEVEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGSFPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPQTNLCQKIRTTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGVSTGYGAAVNTAKVEPGSTCAIFGLGGVGLAVIMGCKVAGASRIIGVDINKDKFAKAKEFGASECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFG...
ethanol oxidation fatty acid omega-oxidation formaldehyde catabolic process cytosol alcohol dehydrogenase activity, zinc-dependent S-(hydroxymethyl)glutathione dehydrogenase activity S-(hydroxymethyl)glutathione dehydrogenase NAD activity S-(hydroxymethyl)glutathione dehydrogenase NADP activity zinc ion binding Equus c...
glucose metabolic process reductive pentose-phosphate cycle
chloroplast
glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) activity NAD binding NADP binding
Spinacia oleracea
3D-structure Calvin cycle Chloroplast Direct protein sequencing NADP Oxidoreductase Plastid Reference proteome Transit peptide
MASNMLSIAN
MASNMLSIANPSLRVYNKGFSEFSGLHTSSLPFGRKGSDDLMAFVSFQTNAVGGKRSSQNGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFA...
glucose metabolic process reductive pentose-phosphate cycle chloroplast glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) activity NAD binding NADP binding Spinacia oleracea 3D-structure Calvin cycle Chloroplast Direct protein sequencing NADP Oxidoreductase Plastid Reference proteome Transit peptide MA...
cellular response to fibroblast growth factor stimulus cellular response to interleukin-1 cellular response to lipopolysaccharide cellular response to tumor necrosis factor embryonic digestive tract development immune response induction of positive chemotaxis inflammatory response intracellular signal transduction nega...
extracellular space
chemokine activity heparin binding interleukin-8 receptor binding
Oryctolagus cuniculus
Chemotaxis Citrullination Cytokine Direct protein sequencing Disulfide bond Inflammatory response Reference proteome Secreted Signal
MNSKLAVALL
MNSKLAVALLATFLLSLTLCEAAVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVDGRELCLDPKEKWVQKVVQIFLKRAEQQES
cellular response to fibroblast growth factor stimulus cellular response to interleukin-1 cellular response to lipopolysaccharide cellular response to tumor necrosis factor embryonic digestive tract development immune response induction of positive chemotaxis inflammatory response intracellular signal transduction nega...
antimicrobial humoral immune response mediated by antimicrobial peptide cellular response to lipopolysaccharide chemokine-mediated signaling pathway chemotaxis inflammatory response neutrophil chemotaxis response to molecule of bacterial origin
extracellular region; extracellular space
chemokine activity CXCR chemokine receptor binding
Homo sapiens
3D-structure Chemotaxis Cytokine Direct protein sequencing Disulfide bond Inflammatory response Pharmaceutical Reference proteome Secreted Signal
MARATLSAAP
MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
antimicrobial humoral immune response mediated by antimicrobial peptide cellular response to lipopolysaccharide chemokine-mediated signaling pathway chemotaxis inflammatory response neutrophil chemotaxis response to molecule of bacterial origin extracellular region; extracellular space chemokine activity CXCR chemokine...
antimicrobial humoral immune response mediated by antimicrobial peptide cellular response to lipopolysaccharide chemokine-mediated signaling pathway inflammatory response neutrophil chemotaxis
extracellular region; extracellular space
chemokine activity CXCR chemokine receptor binding
Homo sapiens
Chemotaxis Cytokine Direct protein sequencing Disulfide bond Inflammatory response Reference proteome Secreted Signal
MAHATLSAAP
MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
antimicrobial humoral immune response mediated by antimicrobial peptide cellular response to lipopolysaccharide chemokine-mediated signaling pathway inflammatory response neutrophil chemotaxis extracellular region; extracellular space chemokine activity CXCR chemokine receptor binding Homo sapiens Chemotaxis Cytokine D...
cellular defense response innate immune response phagocytosis respiratory burst superoxide anion generation superoxide metabolic process
acrosomal vesicle; cytosol; membrane; NADPH oxidase complex; phagolysosome; plasma membrane
electron transfer activity small GTPase binding superoxide-generating NAD(P)H oxidase activity superoxide-generating NADPH oxidase activator activity
Homo sapiens
3D-structure Alternative splicing Chronic granulomatous disease Cytoplasm Disease variant Phosphoprotein Reference proteome Repeat SH3 domain TPR repeat
MSLVEAISLW
MSLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGKLFRPNERQVAQLAKKDYLGKATVVASVVDQDSFSGFAPLQPQAAEPPPRPKTPEIFRALEGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVELRIHPQQQPQEESSPQSDIPAP...
cellular defense response innate immune response phagocytosis respiratory burst superoxide anion generation superoxide metabolic process acrosomal vesicle; cytosol; membrane; NADPH oxidase complex; phagolysosome; plasma membrane electron transfer activity small GTPase binding superoxide-generating NAD(P)H oxidase activ...
articular cartilage development bone development
extracellular matrix; extracellular region
growth factor activity
Bos taurus
Direct protein sequencing Disulfide bond Extracellular matrix Glycoprotein Growth factor Leucine-rich repeat Proteoglycan Reference proteome Repeat Secreted Signal
MKTLQSTLLL
MKTLQSTLLLFLFVPLIKPAPPSQQDSRIIYDYGTDNLEETFFSQDYEDKYLDGKSTKEKETMIIVPDEKSFQLQKDETITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELTLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANTFKKLHNLSFLYLDHNALESVPLNLPESLRVIHLQFNNITSITDDTFCKANDTSYIRDRIEEIRLEGNPVILGKHPNSFICLKRLPIGSYI
articular cartilage development bone development extracellular matrix; extracellular region growth factor activity Bos taurus Direct protein sequencing Disulfide bond Extracellular matrix Glycoprotein Growth factor Leucine-rich repeat Proteoglycan Reference proteome Repeat Secreted Signal MKTLQSTLLL MKTLQSTLLLFLFVPLIKP...
positive regulation of transcription by RNA polymerase II regulation of endoplasmic reticulum unfolded protein response regulation of transcription by RNA polymerase II response to cadmium ion response to heat response to singlet oxygen
cytoplasm; nucleus; RNA polymerase II transcription regulator complex
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity molecular adaptor activity transcription cis-regulatory region binding
Saccharomyces cerevisiae
3D-structure Activator Cadmium resistance Cytoplasm Disulfide bond DNA-binding Nucleus Oxidation Phosphoprotein Reference proteome Repeat Transcription Transcription regulation
MSVSTAKRSL
MSVSTAKRSLDVVSPGSLAEFEGSKSRHDEIENEHRRTGTRDGEDSEQPKKKGSKTSKKQDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLITLVNELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNFTFQYPLDNDNDNDNSKNVGKQLPSPNDPSHSAPMPINQTQKKLSDATDSSSATLDSLSNSNDVLNNTPNSSTSMDWLDNVIYTNRFVSGDDGSNSKTKNLDSNMFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPKK...
positive regulation of transcription by RNA polymerase II regulation of endoplasmic reticulum unfolded protein response regulation of transcription by RNA polymerase II response to cadmium ion response to heat response to singlet oxygen cytoplasm; nucleus; RNA polymerase II transcription regulator complex DNA-binding t...
de novo' protein folding chaperone-mediated protein complex assembly mitochondrial unfolded protein response protein folding protein import into mitochondrial intermembrane space protein maturation protein refolding protein stabilization
cytosol; mitochondrial inner membrane; mitochondrial intermembrane space; mitochondrial matrix; mitochondrial nucleoid; mitochondrion
ATP binding ATP hydrolysis activity ATP-dependent protein folding chaperone DNA replication origin binding protein-folding chaperone binding single-stranded DNA binding unfolded protein binding
Saccharomyces cerevisiae
ATP-binding Chaperone Direct protein sequencing Mitochondrion Nucleotide-binding Phosphoprotein Reference proteome Stress response Transit peptide
MLRSSVVRSR
MLRSSVVRSRATLRPLLRRAYSSHKELKFGVEGRASLLKGVETLAEAVAATLGPKGRNVLIEQPFGPPKITKDGVTVAKSIVLKDKFENMGAKLLQEVASKTNEAAGDGTTSATVLGRAIFTESVKNVAAGCNPMDLRRGSQVAVEKVIEFLSANKKEITTSEEIAQVATISANGDSHVGKLLASAMEKVGKEGVITIREGRTLEDELEVTEGMRFDRGFISPYFITDPKSSKVEFEKPLLLLSEKKISSIQDILPALEISNQSRRPLLIIAEDVDGEALAACILNKLRGQVKVCAVKAPGFGDNRKNTIGDIAVLTGGT...
de novo' protein folding chaperone-mediated protein complex assembly mitochondrial unfolded protein response protein folding protein import into mitochondrial intermembrane space protein maturation protein refolding protein stabilization cytosol; mitochondrial inner membrane; mitochondrial intermembrane space; mitochon...
ameloblast differentiation BMP signaling pathway cell differentiation female gonad development gamete generation hair follicle morphogenesis hematopoietic progenitor cell differentiation keratinocyte proliferation negative regulation of activin receptor signaling pathway negative regulation of epithelial cell different...
cytoplasm; extracellular region; extracellular space; nucleus
activin binding activin receptor antagonist activity heparan sulfate proteoglycan binding
Homo sapiens
3D-structure Alternative splicing Direct protein sequencing Disulfide bond Glycoprotein Reference proteome Repeat Secreted Signal
MVRARHQPGG
MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSIS...
ameloblast differentiation BMP signaling pathway cell differentiation female gonad development gamete generation hair follicle morphogenesis hematopoietic progenitor cell differentiation keratinocyte proliferation negative regulation of activin receptor signaling pathway negative regulation of epithelial cell different...
base-excision repair cytoplasmic translation nucleic acid metabolic process ribosome biogenesis
cytosol; cytosolic large ribosomal subunit; cytosolic ribosome; nuclear matrix; nucleoplasm; ribosome
calcium ion binding class II DNA-(apurinic or apyrimidinic site) endonuclease activity DNA-(apurinic or apyrimidinic site) endonuclease activity endonuclease activity large ribosomal subunit rRNA binding magnesium ion binding structural constituent of ribosome
Drosophila melanogaster
Cytoplasm DNA damage DNA repair Hydrolase Nucleus Phosphoprotein Reference proteome Ribonucleoprotein Ribosomal protein
MVRENKAAWK
MVRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMMRKAIRGHLENNPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPLHVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLIVNQVYDSGSIFSPEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPHSIANGFKNLLAIAATTEVEFKEATTIKEYIKDPSKFAAAASASAAPAAGGATEKKEEAKKPESESEEEDDDMGFGLFD
base-excision repair cytoplasmic translation nucleic acid metabolic process ribosome biogenesis cytosol; cytosolic large ribosomal subunit; cytosolic ribosome; nuclear matrix; nucleoplasm; ribosome calcium ion binding class II DNA-(apurinic or apyrimidinic site) endonuclease activity DNA-(apurinic or apyrimidinic site)...
bidirectional double-stranded viral DNA replication DNA-templated viral transcription perturbation by virus of host G0/G1 transition checkpoint perturbation by virus of host G1/S transition checkpoint regulation of DNA-templated transcription
host cell nucleus
DNA binding metal ion binding
Human cytomegalovirus
3D-structure Activator DNA-binding Early protein G0/G1 host cell cycle checkpoint dysregulation by virus G1/S host cell cycle checkpoint dysregulation by virus Host nucleus Host-virus interaction Isopeptide bond Metal-binding Modulation of host cell cycle by virus Phosphoprotein Reference proteome Transcription Transcr...
MESSAKRKMD
MESSAKRKMDPDNPDEGPSSKVPRPETPVTKATTFLQTMLRKEVNSQLSLGDPLFPELAEESLKTFEQVTEDCNENPEKDVLAELGDILAQAVNHAGIDSSSTGPTLTTHSCSVSSAPLNKPTPTSVAVTNTPLPGASATPELSPRKKPRKTTRPFKVIIKPPVPPAPIMLPLIKQEDIKPEPDFTIQYRNKIIDTAGCIVISDSEEEQGEEVETRGATASSPSTGSGTPRVTSPTHPLSQMNHPPLPDPLGRPDEDSSSSSSSSCSSASDSESESEEMKCSSGGGASVTSSHHGRGGFGGAASSSLLSCGHQSSGGAST...
bidirectional double-stranded viral DNA replication DNA-templated viral transcription perturbation by virus of host G0/G1 transition checkpoint perturbation by virus of host G1/S transition checkpoint regulation of DNA-templated transcription host cell nucleus DNA binding metal ion binding Human cytomegalovirus 3D-st...
enterobactin biosynthetic process siderophore metabolic process
enterobactin synthetase complex; membrane
holo- synthase activity magnesium ion binding
Escherichia coli
Enterobactin biosynthesis Magnesium Membrane Metal-binding Reference proteome Transferase
MKTTHTSLPF
MKTTHTSLPFAGHTLHFVEFDPANFCEQDLLWLPHYAQLQHAGRKRKTEHLAGRIAAVYALREYGYKCVPAIGELRQPVWPAEVYGSISHCGTTALAVVSRQPIGIDIEEIFSVQTARELTDNIITPAEHERLADCGLAFSLALTLAFSAKESAFKASEIQTDAGFLDYQIISWNKQQVIIHRENEMFAVHWQIKEKIVITLCQHD
enterobactin biosynthetic process siderophore metabolic process enterobactin synthetase complex; membrane holo- synthase activity magnesium ion binding Escherichia coli Enterobactin biosynthesis Magnesium Membrane Metal-binding Reference proteome Transferase MKTTHTSLPF MKTTHTSLPFAGHTLHFVEFDPANFCEQDLLWLPHYAQLQHAGRKRKTEH...
dephosphorylation glucose catabolic process
outer membrane-bounded periplasmic space
3-phytase activity glucose-1-phosphatase activity sugar-phosphatase activity
Escherichia coli
3D-structure Direct protein sequencing Hydrolase Periplasm Reference proteome Signal
MNKTLIAAAV
MNKTLIAAAVAGIVLLASNAQAQTVPEGYQLQQVLMMSRHNLRAPLANNGSVLEQSTPNKWPEWDVPGGQLTTKGGVLEVYMGHYMREWLAEQGMVKSGECPPPYTVYAYANSLQRTVATAQFFITGAFPGCDIPVHHQEKMGTMDPTFNPVITDDSAAFSEQAVAAMEKELSKLQLTDSYQLLEKIVNYKDSPACKEKQQCSLVDGKNTFSAKYQQEPGVSGPLKVGNSLVDAFTLQYYEGFPMDQVAWGEIKSDQQWKVLSKLKNGYQDSLFTSPEVARNVAKPLVSYIDKALVTDRTSAPKITVLVGHDSNIASLLT...
dephosphorylation glucose catabolic process outer membrane-bounded periplasmic space 3-phytase activity glucose-1-phosphatase activity sugar-phosphatase activity Escherichia coli 3D-structure Direct protein sequencing Hydrolase Periplasm Reference proteome Signal MNKTLIAAAV MNKTLIAAAVAGIVLLASNAQAQTVPEGYQLQQVLMMSRHNLRAP...
bacteriocin transport cell cycle cell division cellular response to bacteriocin protein import regulation of membrane invagination viral entry into host cell
cell division site; membrane; plasma membrane
disordered domain specific binding protein domain specific binding toxin transmembrane transporter activity virion binding
Escherichia coli
3D-structure Cell cycle Cell division Cell inner membrane Cell membrane Disulfide bond Membrane Reference proteome Repeat Transmembrane Transmembrane helix
MSKATEQNDK
MSKATEQNDKLKRAIIISAVLHVILFAALIWSSFDENIEASAGGGGGSSIDAVMVDSGAVVEQYKRMQSQESSAKRSDEQRKMKEQQAAEELREKQAAEQERLKQLEKERLAAQEQKKQAEEAAKQAELKQKQAEEAAAKAAADAKAKAEADAKAAEEAAKKAAADAKKKAEAEAAKAAAEAQKKAEAAAAALKKKAEAAEAAAAEARKKAATEAAEKAKAEAEKKAAAEKAAADKKAAAEKAAADKKAAEKAAAEKAAADKKAAAEKAAADKKAAAAKAAAEKAAAAKAAAEADDIFGELSSGKNAPKTGGGAKGNNAS...
bacteriocin transport cell cycle cell division cellular response to bacteriocin protein import regulation of membrane invagination viral entry into host cell cell division site; membrane; plasma membrane disordered domain specific binding protein domain specific binding toxin transmembrane transporter activity virion b...
endocytosis growth hormone receptor signaling pathway positive regulation of tyrosine phosphorylation of STAT protein
endosome lumen; extracellular space; membrane; plasma membrane
cytokine receptor activity peptide hormone binding proline-rich region binding
Oryctolagus cuniculus
Cell membrane Direct protein sequencing Disulfide bond Endocytosis Glycoprotein Membrane Phosphoprotein Receptor Reference proteome Secreted Signal Transmembrane Transmembrane helix Ubl conjugation
MDLWQLLLTV
MDLWQLLLTVALAGSSDAFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFPWFLIIIFGIFGLTVMLFVFIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLE...
endocytosis growth hormone receptor signaling pathway positive regulation of tyrosine phosphorylation of STAT protein endosome lumen; extracellular space; membrane; plasma membrane cytokine receptor activity peptide hormone binding proline-rich region binding Oryctolagus cuniculus Cell membrane Direct protein sequencin...
cellular response to cAMP cellular response to Thyroid stimulating hormone cytoplasmic translation positive regulation of translation regulation of translation translational elongation
cytoplasm; cytosolic large ribosomal subunit; cytosolic ribosome; synapse
protein kinase activator activity ribonucleoprotein complex binding structural constituent of ribosome
Rattus norvegicus
Acetylation Isopeptide bond Phosphoprotein Reference proteome Ribonucleoprotein Ribosomal protein Ubl conjugation
MASVSELACI
MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAPAAGAAPAGGPAPSAAAAPAEEKKVEAKKEESEESEDDMGFGLFD
cellular response to cAMP cellular response to Thyroid stimulating hormone cytoplasmic translation positive regulation of translation regulation of translation translational elongation cytoplasm; cytosolic large ribosomal subunit; cytosolic ribosome; synapse protein kinase activator activity ribonucleoprotein complex b...
cellular response to cAMP cellular response to interleukin-4 cellular response to phorbol 13-acetate 12-myristate cellular response to Thyroid stimulating hormone cytoplasmic translation lactation response to selenium ion ribosome biogenesis translation at postsynapse translation at presynapse
cytoplasm; cytoplasmic ribonucleoprotein granule; cytosolic large ribosomal subunit; cytosolic ribosome; dendrite; nucleus; postsynapse; postsynaptic density; presynapse; ribonucleoprotein complex; ribosome; synapse
large ribosomal subunit rRNA binding peptide binding structural constituent of ribosome
Rattus norvegicus
Cytoplasm Direct protein sequencing Isopeptide bond Nucleus Phosphoprotein Reference proteome Ribonucleoprotein Ribosomal protein Ubl conjugation
MPREDRATWK
MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLIIQQVFDNGSIYSPEVLDITEQALHTRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETDYTFPLAEKVKAFLADPSAFAAAAPVAAATTAAPAAAAAPAKVEAKEESEESDEDMGFGLFD
cellular response to cAMP cellular response to interleukin-4 cellular response to phorbol 13-acetate 12-myristate cellular response to Thyroid stimulating hormone cytoplasmic translation lactation response to selenium ion ribosome biogenesis translation at postsynapse translation at presynapse cytoplasm; cytoplasmic ri...
negative regulation of translational elongation primary metabolic process
chloroplast stroma; cytosolic small ribosomal subunit
ribosomal small subunit binding rRNA binding
Spinacia oleracea
3D-structure Chloroplast Direct protein sequencing Plastid Reference proteome RNA-binding rRNA-binding Transit peptide Translation regulation
MATLCTSAIN
MATLCTSAINMNPNLTNSLSNSINLSSTPTNLSSLRSTFTNSCSLGLNVAVKSVQISRNKPNVVCMSWDGPLSSVKLILQGRNLEVSDNVRSHVEDKVGKSVAKHSHLVREVDVRLSARGGDLSKGPKLRRCEVTLFTKRHGVIRAEEDAESLYSSIDLVSSIIQRKLRKIKDKVSDHGRHMKGFNRSKVRDPEPVRITREEVLEEVESAPAPVSVEDDDFIEEVVRTKYFDMPPLTITEAVEQLENVDHDFYAFRNEETGDINILYKRKEGGYGLIIPKDGKTEKLESLPVQTDKQPSFAE
negative regulation of translational elongation primary metabolic process chloroplast stroma; cytosolic small ribosomal subunit ribosomal small subunit binding rRNA binding Spinacia oleracea 3D-structure Chloroplast Direct protein sequencing Plastid Reference proteome RNA-binding rRNA-binding Transit peptide Translatio...
2-oxoglutarate metabolic process tricarboxylic acid cycle
mitochondrial alpha-ketoglutarate dehydrogenase complex; mitochondrial nucleoid; mitochondrial oxoglutarate dehydrogenase complex; mitochondrial ribosome; mitochondrion
structural constituent of ribosome
Saccharomyces cerevisiae
Alternative initiation Direct protein sequencing Mitochondrion Reference proteome Transit peptide
MIATPIRLAK
MIATPIRLAKSAYEPMIKFVGTRHPLVKHATEVVVHPCATNGMLPGSKECIPVSKFMENYKPFRVVPIKHSANAGLSSSKTSVFVNRPLQKDELASIFELPARFRYKPINEHELESINSGGAW
2-oxoglutarate metabolic process tricarboxylic acid cycle mitochondrial alpha-ketoglutarate dehydrogenase complex; mitochondrial nucleoid; mitochondrial oxoglutarate dehydrogenase complex; mitochondrial ribosome; mitochondrion structural constituent of ribosome Saccharomyces cerevisiae Alternative initiation Direct pr...
antibacterial humoral response copulation innate immune response peptide cross-linking
cornified envelope; cytosol; extracellular matrix; extracellular region; extracellular space
endopeptidase inhibitor activity serine-type endopeptidase inhibitor activity structural constituent of skin epidermis
Homo sapiens
3D-structure Direct protein sequencing Disulfide bond Protease inhibitor Reference proteome Repeat Secreted Serine protease inhibitor Signal
MRASSFLIVV
MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
antibacterial humoral response copulation innate immune response peptide cross-linking cornified envelope; cytosol; extracellular matrix; extracellular region; extracellular space endopeptidase inhibitor activity serine-type endopeptidase inhibitor activity structural constituent of skin epidermis Homo sapiens 3D-struc...
associative learning behavioral fear response chemical synaptic transmission chloride transmembrane transport cochlea development gamma-aminobutyric acid signaling pathway inner ear receptor cell development innervation neuron development regulation of postsynaptic membrane potential synaptic transmission, GABAergic
cell body; chloride channel complex; cytosol; dendrite; dendrite membrane; GABA-A receptor complex; GABA-ergic synapse; neuron projection; neuronal cell body membrane; nucleoplasm; postsynapse; postsynaptic membrane; postsynaptic specialization membrane; presynaptic membrane; receptor complex; synapse
chloride channel activity GABA receptor binding GABA-A receptor activity GABA-gated chloride ion channel activity inhibitory extracellular ligand-gated monoatomic ion channel activity ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential transmitter-gated monoatomic ion c...
Rattus norvegicus
Cell membrane Chloride Chloride channel Disulfide bond Glycoprotein Ion channel Ion transport Isopeptide bond Ligand-gated ion channel Membrane Postsynaptic cell membrane Receptor Reference proteome Signal Synapse Transmembrane Transmembrane helix Transport Ubl conjugation
MDNGMLSRFI
MDNGMLSRFIMTKTLLVFCISMTLSSHFGFSQMPTSSVQDETNDNITIFTRILDGLLDGYDNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPLNNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDFPMDAHACPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAM...
associative learning behavioral fear response chemical synaptic transmission chloride transmembrane transport cochlea development gamma-aminobutyric acid signaling pathway inner ear receptor cell development innervation neuron development regulation of postsynaptic membrane potential synaptic transmission, GABAergic ce...
angiogenesis cell differentiation chemotaxis dTMP catabolic process mitochondrial genome maintenance pyrimidine nucleobase metabolic process pyrimidine nucleoside metabolic process regulation of gastric motility regulation of myelination regulation of transmission of nerve impulse
cytosol
1,4-alpha-oligoglucan phosphorylase activity growth factor activity protein homodimerization activity pyrimidine-nucleoside phosphorylase activity thymidine phosphorylase activity
Homo sapiens
3D-structure Alternative splicing Angiogenesis Chemotaxis Developmental protein Differentiation Direct protein sequencing Disease variant Glycosyltransferase Growth factor Neuropathy Phosphoprotein Primary mitochondrial disease Progressive external ophthalmoplegia Reference proteome Repeat Transferase
MAALMTPGTG
MAALMTPGTGAPPAPGDFSGEGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQAGCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAAVFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPPDLRDLVTTLGGALLWLSGHA...
angiogenesis cell differentiation chemotaxis dTMP catabolic process mitochondrial genome maintenance pyrimidine nucleobase metabolic process pyrimidine nucleoside metabolic process regulation of gastric motility regulation of myelination regulation of transmission of nerve impulse cytosol 1,4-alpha-oligoglucan phosphor...
apoptotic process cellular response to interleukin-7 chemotaxis cytoskeleton organization defense response signal transduction
plasma membrane
actin binding
Mus musculus
Acetylation Alternative splicing Cell membrane Direct protein sequencing Membrane Phosphoprotein Reference proteome
MAEAAIDPRC
MAEAAIDPRCEEQEELHAEDSEGLTTQWREEDEEEAAREQRQRERERQLQDQDKDKEDDGGHSLEQPGQQTLISLKSSELDEDEGFGDWSQKPEPRQQFWGNEGTAEGTEPSQSERPEEKQTEESSHQAKVHLEESNLSYREPDPEDAVGGSGEAEEHLIRHQVRTPSPLALEDTVELSSPPLSPTTKLADRTESLNRSIKKSNSVKKSQPTLPISTIDERLQQYTQATESSGRTPKLSRQPSIELPSMAVASTKTLWETGEVQSQSASKTPSCQDIVAGDMSKKSLWEQKGGSKISSTIKSTPSGKRYKFVATGHGKYE...
apoptotic process cellular response to interleukin-7 chemotaxis cytoskeleton organization defense response signal transduction plasma membrane actin binding Mus musculus Acetylation Alternative splicing Cell membrane Direct protein sequencing Membrane Phosphoprotein Reference proteome MAEAAIDPRC MAEAAIDPRCEEQEELHAEDSEG...
electron transport chain mitochondrial electron transport, cytochrome c to oxygen mitochondrial electron transport, ubiquinol to cytochrome c
mitochondrial intermembrane space; respirasome
electron transfer activity heme binding metal ion binding
Caenorhabditis elegans
Acetylation Direct protein sequencing Electron transport Heme Iron Metal-binding Mitochondrion Reference proteome Respiratory chain Transport
MSDIPAGDYE
MSDIPAGDYEKGKKVYKQRCLQCHVVDSTATKTGPTLHGVIGRTSGTVSGFDYSAANKNKGVVWTKETLFEYLLNPKKYIPGTKMVFAGLKKADERADLIKYIEVESAKSL
electron transport chain mitochondrial electron transport, cytochrome c to oxygen mitochondrial electron transport, ubiquinol to cytochrome c mitochondrial intermembrane space; respirasome electron transfer activity heme binding metal ion binding Caenorhabditis elegansAcetylation Direct protein sequencing Electron tran...
intracellular sequestering of iron ion iron ion transport
chloroplast; cytoplasm
ferric iron binding ferrous iron binding ferroxidase activity
Glycine max
Chloroplast Direct protein sequencing Iron Iron storage Metal-binding Oxidoreductase Plastid Reference proteome Transit peptide
MALAPSKVST
MALAPSKVSTFSGFSPKPSVGGAQKNPTCSVSLSFLNEKLGSRNLRVCASTVPLTGVIFEPFEEVKKSELAVPTAPQVSLARQNYADECESAINEQINVEYNASYVYHSLFAYFDRDNVALKGFAKFFKESSEEEREHAEKLMKYQNTRGGRVVLHPIKNAPSEFEHVEKGDALYAMELALSLEKLVNEKLLNVHSVADRNNDPQMADFIESEFLSEQVESIKKISEYVAQLRRVGKGHGVWHFDQRLLD
intracellular sequestering of iron ion iron ion transport chloroplast; cytoplasm ferric iron binding ferrous iron binding ferroxidase activity Glycine max Chloroplast Direct protein sequencing Iron Iron storage Metal-binding Oxidoreductase Plastid Reference proteome Transit peptide MALAPSKVST MALAPSKVSTFSGFSPKPSVGGAQK...
complement activation, classical pathway complement activation, lectin pathway defense response to Gram-positive bacterium killing by host of symbiont cells positive regulation of phagocytosis protein homotrimerization surfactant homeostasis
collagen trimer; extracellular space; multivesicular body
calcium ion binding calcium-dependent carbohydrate binding calcium-dependent protein binding identical protein binding mannose binding oligosaccharide binding phosphatidylinositol-4-phosphate binding polysaccharide binding protease binding protein homodimerization activity
Rattus norvegicus
3D-structure Calcium Collagen Complement activation lectin pathway Complement pathway Direct protein sequencing Disulfide bond Glycoprotein Hydroxylation Immunity Innate immunity Lectin Mannose-binding Metal-binding Reference proteome Repeat Secreted Signal
MLLLPLLVLL
MLLLPLLVLLCVVSVSSSGSQTCEETLKTCSVIACGRDGRDGPKGEKGEPGQGLRGLQGPPGKLGPPGSVGAPGSQGPKGQKGDRGDSRAIEVKLANMEAEINTLKSKLELTNKLHAFSMGKKSGKKFFVTNHERMPFSKVKALCSELRGTVAIPRNAEENKAIQEVAKTSAFLGITDEVTEGQFMYVTGGRLTYSNWKKDEPNDHGSGEDCVTIVDNGLWNDISCQASHTAVCEFPA
complement activation, classical pathway complement activation, lectin pathway defense response to Gram-positive bacterium killing by host of symbiont cells positive regulation of phagocytosis protein homotrimerization surfactant homeostasis collagen trimer; extracellular space; multivesicular body calcium ion binding ...
aldehyde catabolic process ethanol catabolic process regulation of dopamine biosynthetic process regulation of serotonin biosynthetic process
mitochondrial matrix; mitochondrion
aldehyde dehydrogenase (NAD+) activity carboxylesterase activity glyceraldehyde-3-phosphate dehydrogenase (NAD+) (non-phosphorylating) activity NAD binding nitroglycerin reductase activity phenylacetaldehyde dehydrogenase activity
Bos taurus
3D-structure Acetylation Direct protein sequencing Mitochondrion NAD Oxidoreductase Reference proteome Transit peptide
MLRAVALAAA
MLRAVALAAARLGPRQGRRLLSAATQAVPTPNQQPEVLYNQIFINNEWHDAVSKKTFPTVNPSTGDVICHVAEGDKADVDRAVKAARAAFQLGSPWRRMDASERGRLLNRLADLIERDRTYLAALETLDNGKPYIISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDYFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNVIPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGKSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQ...
aldehyde catabolic process ethanol catabolic process regulation of dopamine biosynthetic process regulation of serotonin biosynthetic process mitochondrial matrix; mitochondrion aldehyde dehydrogenase (NAD+) activity carboxylesterase activity glyceraldehyde-3-phosphate dehydrogenase (NAD+) (non-phosphorylating) activit...
activation of protein kinase B activity angiogenesis animal organ morphogenesis branch elongation involved in ureteric bud branching cell differentiation cellular response to heat fibroblast growth factor receptor signaling pathway lung development mesonephric epithelium development positive regulation of angiogenesis ...
cell cortex; cytoplasm; cytosol; extracellular region; extracellular space; nucleus
fibroblast growth factor receptor binding growth factor activity heparin binding integrin binding S100 protein binding
Sus scrofa
Acetylation Angiogenesis Cytoplasm Developmental protein Differentiation Direct protein sequencing Growth factor Heparin-binding Mitogen Nucleus Phosphoprotein Reference proteome Secreted
MAEGEITTFT
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTSGLLYGSQTPSEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
activation of protein kinase B activity angiogenesis animal organ morphogenesis branch elongation involved in ureteric bud branching cell differentiation cellular response to heat fibroblast growth factor receptor signaling pathway lung development mesonephric epithelium development positive regulation of angiogenesis ...
citrate metabolic process tricarboxylic acid cycle
cytosol; mitochondrion
3 iron, 4 sulfur cluster binding 4 iron, 4 sulfur cluster binding aconitate hydratase activity ferrous iron binding iron ion binding
Bos taurus
3D-structure 4Fe-4S Acetylation Direct protein sequencing Iron Iron-sulfur Lyase Metal-binding Mitochondrion Phosphoprotein Reference proteome Transit peptide Tricarboxylic acid cycle
MAPYSLLVSR
MAPYSLLVSRLQKALGARQYHVASVLCQRAKVAMSHFEPNEYIRYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLAD...
citrate metabolic process tricarboxylic acid cycle cytosol; mitochondrion 3 iron, 4 sulfur cluster binding 4 iron, 4 sulfur cluster binding aconitate hydratase activity ferrous iron binding iron ion binding Bos taurus 3D-structure 4Fe-4S Acetylation Direct protein sequencing Iron Iron-sulfur Lyase Metal-binding Mitocho...
analia development antennal development determination of ventral identity genital disc development imaginal disc-derived appendage morphogenesis imaginal disc-derived leg morphogenesis imaginal disc-derived male genitalia development imaginal disc-derived wing margin morphogenesis leg disc proximal/distal pattern forma...
nucleus
DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding
Drosophila melanogaster
Alternative splicing Developmental protein DNA-binding Homeobox Nucleus Reference proteome Transcription Transcription regulation
MDAPDAPHTP
MDAPDAPHTPKYMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRSALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMHSGGNNGGGSNSGSPSHYLPPGHSPTPSSTPVSELSPEFPPTGLSPPTQAPWDQKPHWIDHKPPPQMTPQPPHPAATLHPQTHHHNPPPQMGGYVPQYWYQPETNPSL...
analia development antennal development determination of ventral identity genital disc development imaginal disc-derived appendage morphogenesis imaginal disc-derived leg morphogenesis imaginal disc-derived male genitalia development imaginal disc-derived wing margin morphogenesis leg disc proximal/distal pattern forma...
cellular response to glucose starvation cellular response to interleukin-4 cerebellar Purkinje cell layer development cerebellum structural organization chaperone cofactor-dependent protein refolding endoplasmic reticulum unfolded protein response ER overload response maintenance of protein localization in endoplasmic ...
cell surface; COP9 signalosome; cytoplasm; cytosol; endoplasmic reticulum; endoplasmic reticulum chaperone complex; endoplasmic reticulum lumen; endoplasmic reticulum membrane; endoplasmic reticulum-Golgi intermediate compartment; extracellular region; intracellular membrane-bounded organelle; melanosome; membrane; mid...
ATP binding ATP hydrolysis activity ATP-dependent protein folding chaperone enzyme binding heat shock protein binding misfolded protein binding protein domain specific binding protein folding chaperone ribosome binding ubiquitin protein ligase binding unfolded protein binding
Mus musculus
Acetylation ATP-binding Chaperone Cytoplasm Direct protein sequencing Endoplasmic reticulum Hydrolase Isopeptide bond Methylation Nitration Nucleotide-binding Phosphoprotein Reference proteome Signal Ubl conjugation
MMKFTVVAAA
MMKFTVVAAALLLLGAVRAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFS...
cellular response to glucose starvation cellular response to interleukin-4 cerebellar Purkinje cell layer development cerebellum structural organization chaperone cofactor-dependent protein refolding endoplasmic reticulum unfolded protein response ER overload response maintenance of protein localization in endoplasmic ...
GMP salvage IMP salvage purine ribonucleoside salvage XMP salvage
cytoplasm
guanine phosphoribosyltransferase activity hypoxanthine phosphoribosyltransferase activity metal ion binding nucleotide binding xanthine phosphoribosyltransferase activity
Plasmodium falciparum
3D-structure Cytoplasm Glycosyltransferase Magnesium Metal-binding Nucleotide-binding Purine salvage Transferase
MPIPNNPGAG
MPIPNNPGAGENAFDPVFVNDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYDIKKVYNNEEFHILCLLKGSRGFFTALLKHLSRIHNYSAVETSKPLFGEHYVRVKSYCNDQSTGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPLWNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKKYKATSL
GMP salvage IMP salvage purine ribonucleoside salvage XMP salvage cytoplasm guanine phosphoribosyltransferase activity hypoxanthine phosphoribosyltransferase activity metal ion binding nucleotide binding xanthine phosphoribosyltransferase activity Plasmodium falciparum 3D-structure Cytoplasm Glycosyltransferase Magnesi...
adaptive immune response antigen processing and presentation of exogenous peptide antigen via MHC class II cellular response to type II interferon immune response peptide antigen assembly with MHC class II protein complex positive regulation of immune response positive regulation of T cell activation positive regulatio...
cell surface; clathrin-coated endocytic vesicle membrane; endocytic vesicle membrane; ER to Golgi transport vesicle membrane; Golgi membrane; intracellular membrane-bounded organelle; late endosome membrane; lumenal side of endoplasmic reticulum membrane; lysosomal membrane; MHC class II protein complex; plasma membran...
MHC class II protein complex binding MHC class II receptor activity peptide antigen binding
Homo sapiens
3D-structure Adaptive immunity Cell membrane Disulfide bond Endoplasmic reticulum Endosome Glycoprotein Golgi apparatus Immunity Lysosome Membrane MHC II Reference proteome Signal Transmembrane Transmembrane helix
MRPEDRMFHI
MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL
adaptive immune response antigen processing and presentation of exogenous peptide antigen via MHC class II cellular response to type II interferon immune response peptide antigen assembly with MHC class II protein complex positive regulation of immune response positive regulation of T cell activation positive regulatio...
adaptive immune response antigen processing and presentation antigen processing and presentation of exogenous peptide antigen via MHC class II antigen processing and presentation of peptide antigen cellular response to glucocorticoid stimulus negative regulation of T cell proliferation peptide antigen assembly with MHC...
external side of plasma membrane; late endosome membrane; lysosomal membrane; lysosome; MHC class II protein complex; plasma membrane
MHC class II protein complex binding peptide antigen binding protein-containing complex binding
Rattus norvegicus
Adaptive immunity Disulfide bond Glycoprotein Immunity Membrane MHC II Reference proteome Signal Transmembrane Transmembrane helix
MPLSRALILG
MPLSRALILGVLALTTMLSPCGGQDDIEADHVGSYGITVYQYHESKGQYTHEFDGDERFYVDLDKKETIWRIPEFGQLISFDPQGALRNIAIIKHNLEILMKRSNSTPAVNEVPEATVFSKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKPLTEGVYETSFLINSDYSFHKMAYLTFIPSNDDIYDCKVEHWSLDEPVLRHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTIFIIQGLRSVAPSRHPGPL
adaptive immune response antigen processing and presentation antigen processing and presentation of exogenous peptide antigen via MHC class II antigen processing and presentation of peptide antigen cellular response to glucocorticoid stimulus negative regulation of T cell proliferation peptide antigen assembly with MHC...
cytoplasmic translational initiation formation of cytoplasmic translation initiation complex formation of translation preinitiation complex in utero embryonic development male germ cell proliferation male gonad development translational initiation
cytoplasm; cytosol; eukaryotic translation initiation factor 2 complex; synapse
metal ion binding mRNA binding RNA binding translation factor activity, RNA binding translation initiation factor activity translation initiation factor binding
Homo sapiens
3D-structure Acetylation Cytoplasm Host-virus interaction Initiation factor Isopeptide bond Metal-binding Phosphoprotein Protein biosynthesis Reference proteome Ubl conjugation Zinc Zinc-finger
MSGDEMIFDP
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQA...
cytoplasmic translational initiation formation of cytoplasmic translation initiation complex formation of translation preinitiation complex in utero embryonic development male germ cell proliferation male gonad development translational initiation cytoplasm; cytosol; eukaryotic translation initiation factor 2 complex; ...
homologous chromosome pairing at meiosis homologous recombination meiotic recombination checkpoint signaling reciprocal meiotic recombination synaptonemal complex assembly
condensed nuclear chromosome; lateral element; nucleus; synaptonemal complex
four-way junction DNA binding metal ion binding
Saccharomyces cerevisiae
3D-structure Chromosome DNA-binding Meiosis Metal-binding Nucleus Reference proteome Zinc Zinc-finger
MSNKQLVKPK
MSNKQLVKPKTETKTEITTEQSQKLLQTMLTMSFGCLAFLRGLFPDDIFVDQRFVPEKVEKNYNKQNTSQNNSIKIKTLIRGKSAQADLLLDWLEKGVFKSIRLKCLKALSLGIFLEDPTDLLENYIFSFDYDEENNVNINVNLSGNKKGSKNADPENETISLLDSRRMVQQLMRRFIIITQSLEPLPQKKFLTMRLMFNDNVDEDYQPELFKDATFDKRATLKVPTNLDNDAIDVGTLNTKHHKVALSVLSAATSSMEKAGNTNFIRVDPFDLILQQQEENKLEESVPTKPQNFVTSQTTNVLGNLLNSSQASIQPTQF...
homologous chromosome pairing at meiosis homologous recombination meiotic recombination checkpoint signaling reciprocal meiotic recombination synaptonemal complex assembly condensed nuclear chromosome; lateral element; nucleus; synaptonemal complex four-way junction DNA binding metal ion binding Saccharomyces cerevisia...
intracellular monoatomic cation homeostasis negative regulation of calcium-mediated signaling negative regulation of macroautophagy negative regulation of phosphate metabolic process negative regulation of transcription by RNA polymerase II regulation of protein localization vacuole fusion, non-autophagic
cyclin-dependent protein kinase holoenzyme complex; cytoplasm; nucleus; Pho85-Pho80 CDK-cyclin complex
cyclin-dependent protein serine/threonine kinase regulator activity protein kinase binding
Saccharomyces cerevisiae
3D-structure Cyclin Cytoplasm Nucleus Phosphoprotein Reference proteome
MESTSGERSE
MESTSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYVLPPNIDIVSESGSQTTQLKGSSSPNSHSSQKRYSEAKDAHIYNKRSKPD
intracellular monoatomic cation homeostasis negative regulation of calcium-mediated signaling negative regulation of macroautophagy negative regulation of phosphate metabolic process negative regulation of transcription by RNA polymerase II regulation of protein localization vacuole fusion, non-autophagic cyclin-depend...