Biological Process stringlengths 7 1.01k | Cellular Component stringlengths 6 867 | Molecular Function stringlengths 11 871 | Organism stringlengths 8 73 | Keywords stringlengths 1 810 | Sequence 10 stringlengths 5 10 | Sequence stringlengths 5 1.02k | Combined stringlengths 136 3.91k |
|---|---|---|---|---|---|---|---|
antiviral innate immune response apoptotic process defense response defense response to virus innate immune response interleukin-27-mediated signaling pathway negative regulation of viral genome replication response to type I interferon response to virus signal transduction | cytoplasm; cytosol; endoplasmic reticulum membrane; membrane; microtubule; nuclear membrane; nucleus; perinuclear region of cytoplasm | GTP binding GTPase activity identical protein binding microtubule binding | Homo sapiens | 3D-structure Acetylation Alternative splicing Antiviral defense Cytoplasm Direct protein sequencing Endoplasmic reticulum GTP-binding Immunity Innate immunity Membrane Nucleotide-binding Nucleus Reference proteome Ubl conjugation | MVVSEVDIAK | MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREKIFFENHPYFRDLLEEGKATV... | antiviral innate immune response apoptotic process defense response defense response to virus innate immune response interleukin-27-mediated signaling pathway negative regulation of viral genome replication response to type I interferon response to virus signal transduction cytoplasm; cytosol; endoplasmic reticulum mem... |
defense response defense response to virus innate immune response mRNA transport protein transport regulation of cell cycle regulation of nucleocytoplasmic transport response to interferon-alpha response to virus | cytoplasm; cytosol; membrane; microtubule; nuclear pore; nucleus | GTP binding GTPase activity microtubule binding | Homo sapiens | 3D-structure Alternative splicing Antiviral defense Cytoplasm GTP-binding Immunity Innate immunity mRNA transport Nuclear pore complex Nucleotide-binding Nucleus Protein transport Reference proteome Translocation Transport | MSKAHKPWPY | MSKAHKPWPYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMGPENNLYSQYEQKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKQPCEAWAGRISYRNTELELQDPGQVEKEIHKAQNVMAGNGRGISHELISLEITSPEVPDLTIIDLPGITRVAVDNQPRDIGLQIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAHEVDPEGDRTIGILTKPDLMDRGTEKSVMNVVRNLTYPLKK... | defense response defense response to virus innate immune response mRNA transport protein transport regulation of cell cycle regulation of nucleocytoplasmic transport response to interferon-alpha response to virus cytoplasm; cytosol; membrane; microtubule; nuclear pore; nucleus GTP binding GTPase activity microtubule bi... |
cellular response to nitric oxide cGMP biosynthetic process cGMP-mediated signaling nitric oxide-cGMP-mediated signaling pathway response to oxygen levels trans-synaptic signaling by nitric oxide, modulating synaptic transmission | cytosol; glutamatergic synapse; guanylate cyclase complex, soluble; presynaptic active zone; presynaptic active zone cytoplasmic component; protein-containing complex | GTP binding guanylate cyclase activity heme binding Hsp90 protein binding ion binding metal ion binding protein-containing complex binding | Rattus norvegicus | 3D-structure cGMP biosynthesis Cytoplasm GTP-binding Heme Iron Lyase Metal-binding Nucleotide-binding Reference proteome | MYGFVNHALE | MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRSEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQDSRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGKCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGAEISCLRLKGQMIYLPEADSIL... | cellular response to nitric oxide cGMP biosynthetic process cGMP-mediated signaling nitric oxide-cGMP-mediated signaling pathway response to oxygen levels trans-synaptic signaling by nitric oxide, modulating synaptic transmission cytosol; glutamatergic synapse; guanylate cyclase complex, soluble; presynaptic active zon... |
cell division cellular response to oxidative stress DNA repair G1/S transition of mitotic cell cycle intracellular signal transduction regulation of actin cytoskeleton organization regulation of fungal-type cell wall organization TOR signaling tRNA wobble uridine modification | cytoplasm; nucleus; protein phosphatase type 2A complex; protein serine/threonine phosphatase complex | metal ion binding myosin phosphatase activity protein serine/threonine phosphatase activity | Saccharomyces cerevisiae | Cell cycle Cell division Cytoplasm Hydrolase Manganese Metal-binding Mitosis Protein phosphatase Reference proteome | MVSRGPDEWL | MVSRGPDEWLETIKKCQALTENEMKQLCEMVKELLMEESNIQPVQTPVTVCGDIHGQFHDLLELFRTAGGFPDDINYIFLGDYVDRGYYSLETFTLLMCLKVKYPAKITLVRGNHESRQITQVYGFYEECLNKYGSTTVWKYCCQVFDFLTLAAIIDGKILCVHGGLSPEIRMLDQIRVLSRAQEVPHEGGFSDLLWSDPDNVEAWQVSPRGAGWLFGSKVAREFNHVNGLNLIARAHQLVMEGFKYHFPEKDVVTVWSAPNYCYRCGNVASVMKVDEDLEPTFKIFSAVPDDYIRESTANHNNQRAGYFL | cell division cellular response to oxidative stress DNA repair G1/S transition of mitotic cell cycle intracellular signal transduction regulation of actin cytoskeleton organization regulation of fungal-type cell wall organization TOR signaling tRNA wobble uridine modification cytoplasm; nucleus; protein phosphatase typ... |
endoplasmic reticulum to Golgi vesicle-mediated transport intracellular protein transport membrane organization mitochondrial fission mitochondrial membrane organization nuclear envelope organization positive regulation of ER to Golgi vesicle-mediated transport positive regulation of protein exit from endoplasmic retic... | COPII vesicle coat; endoplasmic reticulum; endoplasmic reticulum exit site; endoplasmic reticulum membrane; Golgi membrane; mitochondria-associated endoplasmic reticulum membrane; mitochondrion | GTP binding GTPase activity | Saccharomyces cerevisiae | 3D-structure Cytoplasmic vesicle Endoplasmic reticulum ER-Golgi transport Golgi apparatus GTP-binding Hydrolase Isopeptide bond Membrane Nucleotide-binding Phosphoprotein Protein transport Reference proteome Transport Ubl conjugation | MAGWDIFGWF | MAGWDIFGWFRDVLASLGLWNKHGKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELAIGNIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKIDAPNAVSEAELRSALGLLNTTGSQRIEGQRPVEVFMCSVVMRNGYLEAFQWLSQYI | endoplasmic reticulum to Golgi vesicle-mediated transport intracellular protein transport membrane organization mitochondrial fission mitochondrial membrane organization nuclear envelope organization positive regulation of ER to Golgi vesicle-mediated transport positive regulation of protein exit from endoplasmic retic... |
autophagic cell death chemical synaptic transmission dephosphorylation lysosome organization response to organic substance skeletal system development | lysosomal lumen; lysosomal membrane; lysosome; synapse | acid phosphatase activity phosphoprotein phosphatase activity phosphotyrosine residue binding | Rattus norvegicus | Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Lysosome Membrane Reference proteome Signal Transmembrane Transmembrane helix | MAGRQSGWSQ | MAGRQSGWSQAALLQFLLGMCLMVMPPIQARSLRFVTLLYRHGDRSPVKAYPKDPYQEEKWPQGFGQLTKEGMLQHWELGQALRQRYHGFLNASYHRQEVYVRSTDFDRTLMSAEANLAGLFPPTEVQHFNPNISWQPIPVHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNMSIQNAQFLDMVANETGLMNLTLETIWNVYDTLFCEQTHGLLLPPWASPQTVQALSQLKDFSFLFLFGIHDQVQKARLQGGVLLAQILKNLTLMATTSQFPKLLVYSAHDTTLVALQMALNVYNGKQAPYASCHIFELYQEDN... | autophagic cell death chemical synaptic transmission dephosphorylation lysosome organization response to organic substance skeletal system development lysosomal lumen; lysosomal membrane; lysosome; synapse acid phosphatase activity phosphoprotein phosphatase activity phosphotyrosine residue binding Rattus norvegicus Di... |
adenylate cyclase-modulating G protein-coupled receptor signaling pathway background adaptation cell population proliferation cellular response to electrical stimulus detection of chemical stimulus involved in sensory perception of bitter taste detection of light stimulus detection of light stimulus involved in visual ... | apical plasma membrane; heterotrimeric G-protein complex; membrane; neuronal cell body; photoreceptor connecting cilium; photoreceptor inner segment; photoreceptor outer segment | G protein-coupled receptor binding G-protein beta/gamma-subunit complex binding GTP binding GTPase activity metal ion binding | Mus musculus | Cell projection Direct protein sequencing GTP-binding Lipoprotein Magnesium Membrane Metal-binding Myristate Nucleotide-binding Phosphoprotein Reference proteome Sensory transduction Transducer Vision | MGAGASAEEK | MGAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFATTSIVLFLNKKDVFSEKIKKAHLSICFPDYDGPNTYEDAGNYIKVQFLELNMRRDVKEIYSHMT... | adenylate cyclase-modulating G protein-coupled receptor signaling pathway background adaptation cell population proliferation cellular response to electrical stimulus detection of chemical stimulus involved in sensory perception of bitter taste detection of light stimulus detection of light stimulus involved in visual ... |
anterior/posterior pattern specification cell chemotaxis DNA-templated transcription embryonic skeletal system development embryonic skeletal system morphogenesis mammary gland development positive regulation of transcription by RNA polymerase II proximal/distal pattern formation regulation of transcription by RNA poly... | nucleoplasm; nucleus; RNA polymerase II transcription regulator complex | DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific double-stranded DNA binding | Mus musculus | Developmental protein DNA-binding Homeobox Isopeptide bond Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation Ubl conjugation | MSISGTLSSY | MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYANPRQPGHAEHLDFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYLQPQGAPAAESRYLRTWLEPAPRAEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRAGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE | anterior/posterior pattern specification cell chemotaxis DNA-templated transcription embryonic skeletal system development embryonic skeletal system morphogenesis mammary gland development positive regulation of transcription by RNA polymerase II proximal/distal pattern formation regulation of transcription by RNA poly... |
biological process involved in interaction with host lipid catabolic process sphingomyelin metabolic process | periplasmic space | sphingomyelin phosphodiesterase D activity | Corynebacterium pseudotuberculosis | Direct protein sequencing Hydrolase Lipid degradation Lipid metabolism Magnesium Signal Virulence | MREKVVLFLS | MREKVVLFLSIIMAIMLPVGNAAAAPVVHNPASTANRPVYAIAHRVLTTQGVDDAVAIGANALEIDFTAWGRGWWADHDGIPTSAGATAEEIFKHIADKRKQGANITFTWLDIKNPDYCRDARSVCSINALRDLARKYLEPAGVRVLYGFYKTVGGPAWKTITADLRDGEAVALSGPAQDVLNDFARSENKILTKQKIADYGYYNINQGFGNCYGTWNRTCDQLRKSSEARDQGKLGKTFGWTIATGQDARVNDLLGKANVDGLIFGFKITHFYRHADTENSFKAIKRWVDKHSATHHLATVADNPW | biological process involved in interaction with host lipid catabolic process sphingomyelin metabolic process periplasmic space sphingomyelin phosphodiesterase D activity Corynebacterium pseudotuberculosisDirect protein sequencing Hydrolase Lipid degradation Lipid metabolism Magnesium Signal Virulence MREKVVLFLS MREKVVL... |
endosome to lysosome transport glycosphingolipid catabolic process lysosomal transport protein targeting to lysosome receptor-mediated endocytosis secretion of lysosomal enzymes | clathrin-coated endocytic vesicle membrane; endosome; late endosome; lysosomal membrane; membrane; perinuclear region of cytoplasm; plasma membrane; trans-Golgi network; trans-Golgi network membrane; transport vesicle | protein domain specific binding protein transporter activity retromer complex binding transmembrane signaling receptor activity | Homo sapiens | 3D-structure Disulfide bond Glycoprotein Lysosome Membrane Phosphoprotein Receptor Reference proteome Signal Transmembrane Transmembrane helix Transport | MFPFYSCWRT | MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKETVVGRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAVVMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACSPEISHLSVGSILLVTFASLVAVYVVGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM | endosome to lysosome transport glycosphingolipid catabolic process lysosomal transport protein targeting to lysosome receptor-mediated endocytosis secretion of lysosomal enzymes clathrin-coated endocytic vesicle membrane; endosome; late endosome; lysosomal membrane; membrane; perinuclear region of cytoplasm; plasma mem... |
adenosine metabolic process dephosphorylation lipid metabolic process lysosome organization nucleotide metabolic process positive regulation of adenosine receptor signaling pathway purine nucleobase metabolic process regulation of sensory perception of pain thiamine metabolic process | apical part of cell; extracellular space; filopodium; Golgi cisterna; lysosomal membrane; lysosome; membrane; multivesicular body; plasma membrane; secretory granule; vesicle membrane | 5'-nucleotidase activity acid phosphatase activity choline binding identical protein binding lysophosphatidic acid phosphatase activity molecular adaptor activity phosphatase activity protein homodimerization activity protein tyrosine phosphatase activity thiamine phosphate phosphatase activity XMP 5'-nucleosidase acti... | Rattus norvegicus | 3D-structure Alternative splicing Cell membrane Disulfide bond Glycoprotein Hydrolase Lipid metabolism Lysosome Membrane Reference proteome Secreted Signal | MRAVPLHLVG | MRAVPLHLVGTASLTLGFLLLLSLRLDPGQAKELKFVTLVFRHGDRGPIETFPNDPIKESSWPQGFGQLTKWGMGQHYELGSYIRRRYGRFLNNSYKHDQVYIRSTDVDRTLMSAMTNLAALFPPEGISIWNPRLLWQPIPVHTVSLSEDRLLYLPFRDCPRFQELKSETLKSEEFLKRLQPYKSFIDTLPSLSGFEDQDLFEIWSRLYDPLYCESVHNFTLPTWATEDAMTKLKELSELSLLSLYGIHKQKEKSRLQGGVLVNEILKNMKLATQPQKARKLIMYSAHDTTVSGLQMALDVYNGLLPPYASCHIMELYQD... | adenosine metabolic process dephosphorylation lipid metabolic process lysosome organization nucleotide metabolic process positive regulation of adenosine receptor signaling pathway purine nucleobase metabolic process regulation of sensory perception of pain thiamine metabolic process apical part of cell; extracellular ... |
proton export across plasma membrane proton transmembrane transport regulation of stomatal movement response to abscisic acid response to water deprivation stomatal opening | Golgi apparatus; membrane; plant-type vacuole; plasma membrane; plasmodesma | ATP binding ATP hydrolysis activity magnesium ion binding P-type proton-exporting transporter activity | Arabidopsis thaliana | Acetylation ATP-binding Cell membrane Hydrogen ion transport Ion transport Magnesium Membrane Metal-binding Nucleotide-binding Phosphoprotein Reference proteome Translocase Transmembrane Transmembrane helix Transport | MSGLEDIKNE | MSGLEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIVIFGPNKLEEKKESKILKFLGFMWNPLSWVMEAAALMAIALANGDNRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSIGNFCICSIAIGIAIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEM... | proton export across plasma membrane proton transmembrane transport regulation of stomatal movement response to abscisic acid response to water deprivation stomatal opening Golgi apparatus; membrane; plant-type vacuole; plasma membrane; plasmodesma ATP binding ATP hydrolysis activity magnesium ion binding P-type proton... |
cellular response to transforming growth factor beta stimulus dephosphorylation N-terminal protein myristoylation negative regulation of BMP signaling pathway negative regulation of canonical NF-kappaB signal transduction negative regulation of non-canonical NF-kappaB signal transduction negative regulation of transfor... | cytosol; membrane; neuron projection; nucleus | calmodulin-dependent protein phosphatase activity magnesium ion binding manganese ion binding myosin phosphatase activity phosphoprotein phosphatase activity protein serine/threonine phosphatase activity R-SMAD binding transmembrane transporter binding | Rattus norvegicus | Cytoplasm Direct protein sequencing Hydrolase Lipoprotein Magnesium Manganese Membrane Metal-binding Myristate Nucleus Phosphoprotein Protein phosphatase Reference proteome | MGAFLDKPKM | MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSAEAVKKEAELDKYLENRVEEII... | cellular response to transforming growth factor beta stimulus dephosphorylation N-terminal protein myristoylation negative regulation of BMP signaling pathway negative regulation of canonical NF-kappaB signal transduction negative regulation of non-canonical NF-kappaB signal transduction negative regulation of transfor... |
calcineurin-mediated signaling calcineurin-NFAT signaling cascade calcium-ion regulated exocytosis heart development locomotion involved in locomotory behavior lymphangiogenesis muscle cell cellular homeostasis negative regulation of signaling negative regulation of T cell mediated cytotoxicity positive regulation of i... | calcineurin complex; cytoplasm; cytosol; glutamatergic synapse; plasma membrane; protein-containing complex; synapse; T-tubule; Z disc | calcium ion binding calcium-dependent protein serine/threonine phosphatase activity calmodulin binding calmodulin-dependent protein phosphatase activity enzyme binding myosin phosphatase activity protein dimerization activity protein phosphatase 2B binding protein serine/threonine phosphatase activity protein-containin... | Rattus norvegicus | Acetylation Calmodulin-binding Cytoplasm Hydrolase Iron Metal-binding Phosphoprotein Protein phosphatase Reference proteome Zinc | MAAPEPARAA | MAAPEPARAAPPPPPPPPPPLGADRVVKAVPFPPTHRLTSEEVFDMDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNY... | calcineurin-mediated signaling calcineurin-NFAT signaling cascade calcium-ion regulated exocytosis heart development locomotion involved in locomotory behavior lymphangiogenesis muscle cell cellular homeostasis negative regulation of signaling negative regulation of T cell mediated cytotoxicity positive regulation of i... |
anisotropic cell growth ascospore formation chromosome segregation DNA damage checkpoint signaling DNA replication checkpoint signaling establishment of cell polarity fungal-type cell wall chitin biosynthetic process intracellular monoatomic ion homeostasis mitotic spindle assembly checkpoint signaling mitotic spindle ... | cell septum; cellular bud neck septin collar; cytoplasm; incipient cellular bud site; kinetochore; mating projection base; mRNA cleavage and polyadenylation specificity factor complex; nucleolus; nucleus; protein phosphatase type 1 complex; spindle pole body | metal ion binding myosin phosphatase activity protein serine/threonine phosphatase activity | Emericella nidulans | Cell cycle Cell division Hydrolase Manganese Metal-binding Mitosis Protein phosphatase Reference proteome | MADQDVDLDS | MADQDVDLDSIIDRLLEVRGSRPGKQVQLLESEIRYLCTKAREIFISQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFVLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLNSMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEKKQKYVYGAMSSGRPITPPRK... | anisotropic cell growth ascospore formation chromosome segregation DNA damage checkpoint signaling DNA replication checkpoint signaling establishment of cell polarity fungal-type cell wall chitin biosynthetic process intracellular monoatomic ion homeostasis mitotic spindle assembly checkpoint signaling mitotic spindle ... |
DNA replication initiation DNA replication, synthesis of RNA primer | alpha DNA polymerase:primase complex | DNA primase activity magnesium ion binding ribonucleotide binding zinc ion binding | Mus musculus | Acetylation Direct protein sequencing DNA replication DNA-directed RNA polymerase Magnesium Manganese Metal-binding Nucleotidyltransferase Primosome Reference proteome Transcription Transferase Zinc | MEPFDPAELP | MEPFDPAELPELLKLYYRRLFPYAQYYRWLNYGGVTKNYFQHREFSFTLKDDIYIRYQSFNNQSELEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICSKCWTLMTMAMRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLNEKVHPFVRKSINIIKKYFEEYALVGQDILENKENWDKILALVPETIHDELQRGFQKFHSSPQRWEHLRKVANSSQNMKNDKCGPWLEWEVMLQYCFPRLDVNVSKGVNHLLKSPF... | DNA replication initiation DNA replication, synthesis of RNA primer alpha DNA polymerase:primase complex DNA primase activity magnesium ion binding ribonucleotide binding zinc ion binding Mus musculus Acetylation Direct protein sequencing DNA replication DNA-directed RNA polymerase Magnesium Manganese Metal-binding Nuc... |
amino acid metabolic process ammonia assimilation cycle arginine biosynthetic process arginine biosynthetic process via ornithine arginine metabolic process argininosuccinate metabolic process cellular response to ammonium ion cellular response to cAMP cellular response to dexamethasone stimulus cellular response to gl... | cell body fiber; cytosol; mitochondrial outer membrane; neuronal cell body; perikaryon; perinuclear region of cytoplasm | argininosuccinate lyase activity identical protein binding | Rattus norvegicus | Acetylation Amino-acid biosynthesis Arginine biosynthesis Lyase Reference proteome Urea cycle | MASESGKLWG | MASESGKLWGGRFAGSVDPTMDKFNSSIAYDRHLWNVDLQGSKAYSRGLEKAGLLTKAEMQQILQGLDKVAEEWAQGIFKLYPNDEDIHTANERRLKELIGEAAGKLHTGRSRNDQVVTDLRLWMRQTYSKLSTFLKVLIEAMVDRAEAECEVLFPGYTHLQRAQPIRWSHWILSHAVALTRDLERLKEVQKRINVLPLGSGAIAGNPLGVDREFLCAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYGTKEFNFVQLSDAYSTGSSLMPQKKNPDSLELIRSKARRVFGRCAGLLMTLKGLPST... | amino acid metabolic process ammonia assimilation cycle arginine biosynthetic process arginine biosynthetic process via ornithine arginine metabolic process argininosuccinate metabolic process cellular response to ammonium ion cellular response to cAMP cellular response to dexamethasone stimulus cellular response to gl... |
cellular respiration mitochondrial electron transport, cytochrome c to oxygen | mitochondrial inner membrane; mitochondrial membrane; mitochondrial respiratory chain complex IV | cytochrome-c oxidase activity electron transfer activity metal ion binding | Homo sapiens | 3D-structure Acetylation Direct protein sequencing Disease variant Heme Iron Membrane Metal-binding Mitochondrion Mitochondrion inner membrane Phosphoprotein Primary mitochondrial disease Reference proteome Transit peptide | MLGAALRRCA | MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCYSHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV | cellular respiration mitochondrial electron transport, cytochrome c to oxygen mitochondrial inner membrane; mitochondrial membrane; mitochondrial respiratory chain complex IV cytochrome-c oxidase activity electron transfer activity metal ion binding Homo sapiens 3D-structure Acetylation Direct protein sequencing Diseas... |
cardiac muscle tissue morphogenesis muscle contraction neuromuscular synaptic transmission phosphorylation positive regulation of fast-twitch skeletal muscle fiber contraction positive regulation of gene expression regulation of MAPK cascade regulation of muscle filament sliding regulation of neuronal synaptic plastici... | cytoplasm; dendrite; dendritic spine; neuronal cell body; nucleus; synapse; synaptic vesicle; terminal bouton | ATP binding calmodulin binding myosin light chain binding myosin light chain kinase activity | Rattus norvegicus | Acetylation ATP-binding Calmodulin-binding Cytoplasm Kinase Nucleotide-binding Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase | MATENGAVEL | MATENGAVELGTQSLSTDHPPTDAAGDGSPASEKEPSLPDTEKDLGPTNTKKDPGAPDPKKNPDPPSLKKTPEAPGPEKKGDSAPASASNQGPSGEGDGGGGPAEGGTGPPAVLPQPTATADASIQKLDATQAPSGNQESGEAKAGKKAAECREAGRRGSPAFLHSPSCPAIISCSEKTLAMKPLSETTELIFAGVSETPDPQDPGPAKDEGGTNTLADGKEEAEAGQAEQAKVQGDTSQRIGFQAVPSERAEVGQALCLTAKEEDCFQILDDCPPPPAPFPHRIVELRTGNVSSEFSMNSKEALGGGKFGAVCTCTERS... | cardiac muscle tissue morphogenesis muscle contraction neuromuscular synaptic transmission phosphorylation positive regulation of fast-twitch skeletal muscle fiber contraction positive regulation of gene expression regulation of MAPK cascade regulation of muscle filament sliding regulation of neuronal synaptic plastici... |
B cell antigen processing and presentation Fc receptor-mediated immune complex endocytosis immune response macrophage activation positive regulation of humoral immune response mediated by circulating immunoglobulin positive regulation of killing of cells of another organism positive regulation of nitric-oxide synthase ... | external side of plasma membrane; extracellular region; plasma membrane | carbohydrate binding IgE binding low-affinity IgE receptor activity metal ion binding | Mus musculus | Alternative splicing Calcium Cell membrane Disulfide bond Glycoprotein IgE-binding protein Lectin Lipoprotein Membrane Metal-binding Palmitate Proteoglycan Receptor Reference proteome Repeat Secreted Signal-anchor Transmembrane Transmembrane helix | MEENEYSGYW | MEENEYSGYWEPPRKRCCCARRGTQLMLVGLLSTAMWAGLLALLLLWHWETEKNLKQLGDTAIQNVSHVTKDLQKFQSNQLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCEISAPLASV... | B cell antigen processing and presentation Fc receptor-mediated immune complex endocytosis immune response macrophage activation positive regulation of humoral immune response mediated by circulating immunoglobulin positive regulation of killing of cells of another organism positive regulation of nitric-oxide synthase ... |
glial cell proliferation muscle cell differentiation negative regulation of axon extension negative regulation of collateral sprouting neuroblast proliferation positive regulation of DNA-binding transcription factor activity positive regulation of transcription by RNA polymerase II skeletal muscle tissue regeneration s... | cytoplasm; nucleus; plasma membrane; sarcoplasm | RNA polymerase II-specific DNA-binding transcription factor binding | Rattus norvegicus | Cell membrane Cytoplasm Developmental protein Differentiation Membrane Neurogenesis Nucleus Reference proteome | MPKNKKRNAP | MPKNKKRNAPHRGGGGGGGSGAATSAATTGGPHRTVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGVKNALSSKVLYEFVLERRMTLTDSIERCLKKGKSDGQRAAAALASVLCIQLGPGLESEEILKTLGPILKKIICDGTASIQARQTCATCFGVCCFIATDDITELYSTLECLEGIFTKSYLKEKDTNVPCSTPNTVLHISSLLAWTLLLTICPISEVKKKLELHFHKLPSLLSCDDVNMRIAAGESLALLFELARGMESDFFYEDMDSLTQMLRALATD... | glial cell proliferation muscle cell differentiation negative regulation of axon extension negative regulation of collateral sprouting neuroblast proliferation positive regulation of DNA-binding transcription factor activity positive regulation of transcription by RNA polymerase II skeletal muscle tissue regeneration s... |
heterochromatin formation nuclear envelope organization nuclear migration nuclear pore localization protein localization to nuclear envelope | lamin filament; membrane; nuclear envelope; nuclear inner membrane; nuclear lamina; nuclear matrix; nuclear membrane; nucleoplasm; nucleus | phospholipase binding sequence-specific double-stranded DNA binding structural constituent of cytoskeleton structural molecule activity | Homo sapiens | 3D-structure Acetylation Chromosomal rearrangement Coiled coil Direct protein sequencing Disease variant Disulfide bond Intellectual disability Intermediate filament Isopeptide bond Leukodystrophy Lipoprotein Methylation Nucleus Phosphoprotein Prenylation Primary microcephaly Reference proteome Ubl conjugation | MATATPVPPR | MATATPVPPRMGSRAGGPTTPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSALQLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKLQIELGKCKAEHDQLLLNYAKKESDLNGAQIKLREYEAALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLAAAKKQLADETLLKVDLENRCQSLTEDLEFRKSMYEEEINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLER... | heterochromatin formation nuclear envelope organization nuclear migration nuclear pore localization protein localization to nuclear envelope lamin filament; membrane; nuclear envelope; nuclear inner membrane; nuclear lamina; nuclear matrix; nuclear membrane; nucleoplasm; nucleus phospholipase binding sequence-specific ... |
amino acid metabolic process catecholamine metabolic process dopamine biosynthetic process gene expression kidney development response to toxic substance serotonin biosynthetic process | cytoplasm; cytosol; extracellular exosome | 5-hydroxy-L-tryptophan decarboxylase activity aromatic-L-amino-acid decarboxylase activity enzyme binding L-dopa decarboxylase activity pyridoxal phosphate binding | Homo sapiens | 3D-structure Acetylation Alternative splicing Catecholamine biosynthesis Decarboxylase Disease variant Lyase Pyridoxal phosphate Reference proteome Repeat | MNASEFRRRG | MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRT... | amino acid metabolic process catecholamine metabolic process dopamine biosynthetic process gene expression kidney development response to toxic substance serotonin biosynthetic process cytoplasm; cytosol; extracellular exosome 5-hydroxy-L-tryptophan decarboxylase activity aromatic-L-amino-acid decarboxylase activity en... |
cellular response to leukemia inhibitory factor chromatin remodeling intracellular estrogen receptor signaling pathway negative regulation of chemokine-mediated signaling pathway negative regulation of lymphocyte chemotaxis transcription initiation-coupled chromatin remodeling | cytoplasm; euchromatin; nucleus | calcium ion binding histone arginine deiminase activity histone H3R26 arginine deiminase activity nuclear estrogen receptor binding protein homodimerization activity protein-arginine deiminase activity | Rattus norvegicus | Calcium Cytoplasm Direct protein sequencing Hydrolase Metal-binding Reference proteome | MLRERTVRLQ | MLRERTVRLQYGSRVEAVYVLGTQLWTDVYSAAPAGAKTFSLKHSEGVKVEVVRDGEAEEVVTNGKQRWALSPSTTLRLSMAQASTEASSDKVTVNYYEEDGSAPIDQAGLFLTAIEISLDVDADRDGEVEKNNPKKASWTWGPEGQGAILLVNCDRDTPWLPKEDCSDEKVYSKQDLQDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRQKLYHVVKYTGGSAELLFFVEGLRFPDESFSGLVSIHVSLLEYMAEDIPLTPIFTDTVTFRIAPWIMTPNILPPVSVFVCCMKDNYLF... | cellular response to leukemia inhibitory factor chromatin remodeling intracellular estrogen receptor signaling pathway negative regulation of chemokine-mediated signaling pathway negative regulation of lymphocyte chemotaxis transcription initiation-coupled chromatin remodeling cytoplasm; euchromatin; nucleus calcium io... |
apoptotic process killing of cells of another organism proteolysis | cytolytic granule; cytoplasm; intracellular membrane-bounded organelle; membrane | serine-type endopeptidase activity | Homo sapiens | 3D-structure Alternative splicing Cytolysis Disulfide bond Glycoprotein Hydrolase Lysosome Protease Reference proteome Serine protease Signal Zymogen | MQPFLLLLAF | MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL | apoptotic process killing of cells of another organism proteolysis cytolytic granule; cytoplasm; intracellular membrane-bounded organelle; membrane serine-type endopeptidase activity Homo sapiens 3D-structure Alternative splicing Cytolysis Disulfide bond Glycoprotein Hydrolase Lysosome Protease Reference proteome Serin... |
anterior/posterior pattern specification bronchiole development cell migration cell-cell signaling involved in mammary gland development embryonic skeletal system morphogenesis epithelial tube branching involved in lung morphogenesis intestinal epithelial cell maturation lung alveolus development lung goblet cell diffe... | chromatin; nucleus | DNA binding DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific double-stranded DNA binding | Homo sapiens | Developmental protein DNA-binding Homeobox Nucleus Reference proteome Transcription Transcription regulation | MSSYFVNSFC | MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP | anterior/posterior pattern specification bronchiole development cell migration cell-cell signaling involved in mammary gland development embryonic skeletal system morphogenesis epithelial tube branching involved in lung morphogenesis intestinal epithelial cell maturation lung alveolus development lung goblet cell diffe... |
animal organ regeneration bile acid secretion cellular glucuronidation estrogen metabolic process flavonoid glucuronidation liver development response to organic cyclic compound vitamin D3 metabolic process xenobiotic glucuronidation | endoplasmic reticulum; endoplasmic reticulum membrane | enzyme binding glucuronosyltransferase activity protein homodimerization activity retinoic acid binding | Rattus norvegicus | Alternative splicing Endoplasmic reticulum Glycoprotein Glycosyltransferase Membrane Microsome Reference proteome Signal Transferase Transmembrane Transmembrane helix | MDTGLCAPLR | MDTGLCAPLRGLSGLLLLLCALPWAEGGKVLVFPMEGSHWLSMRDVVRELHARGHQAVVLAPEVTVHMKGEDFFTLQTYAFPYTKEEYQREILGNAKKGFEPQHFVKTFFETMASIKKFFDLYANSCAALLHNKTLIQQLNSSSFDVVLTDPVFPCGALLAKYLQIPAVFFLRSVPCGIDYEATQCPKPSSYIPNLLTMLSDHMTFLQRVKNMLYPLTLKYICHLSITPYESLASELLQREMSLVEVLSHASVWLFRGDFVFDYPRPIMPNMVFIGGINCVIKKPLSQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAM... | animal organ regeneration bile acid secretion cellular glucuronidation estrogen metabolic process flavonoid glucuronidation liver development response to organic cyclic compound vitamin D3 metabolic process xenobiotic glucuronidation endoplasmic reticulum; endoplasmic reticulum membrane enzyme binding glucuronosyltrans... |
glutamate metabolic process glutathione biosynthetic process glutathione catabolic process peptide modification regulation of immune system process regulation of inflammatory response zymogen activation | plasma membrane | glutathione hydrolase activity leukotriene C4 gamma-glutamyl transferase activity leukotriene-C(4) hydrolase | Sus scrofa | Acyltransferase Cell membrane Disulfide bond Glutathione biosynthesis Glycoprotein Hydrolase Membrane Protease Reference proteome Signal-anchor Transferase Transmembrane Transmembrane helix Zymogen | MKKRYLLLAL | MKKRYLLLALAAVALVLLILGLCLWLPSNSKPHNHVYPRAAVAADALRCSEIGRDTLRDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEIINAREVAPRLASASMFNSSEQSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIELASQGFPVGKGLAAALERSQDAIKRHPALCEVFCRNGNVLREGDLVTMPRLAKTYETLAVEGAQAFYNGSLTAQIVKDIQEAGGIVTAEDLNNYRAELIEQPLRISLGDAQLYAPNAPLSGPVLALILNILKGYNFSRASVETPEQKGLTYHRIVEAFR... | glutamate metabolic process glutathione biosynthetic process glutathione catabolic process peptide modification regulation of immune system process regulation of inflammatory response zymogen activation plasma membrane glutathione hydrolase activity leukotriene C4 gamma-glutamyl transferase activity leukotriene-C(4) hy... |
de novo' IMP biosynthetic process adenine biosynthetic process purine nucleobase biosynthetic process purine nucleotide biosynthetic process | cytosol | ATP binding metal ion binding phosphoribosylamine-glycine ligase activity phosphoribosylformylglycinamidine cyclo-ligase activity | Schizosaccharomyces pombe | ATP-binding Cytoplasm Ligase Magnesium Manganese Metal-binding Multifunctional enzyme Nucleotide-binding Purine biosynthesis Reference proteome | MEPIIALLIG | MEPIIALLIGNGGREHTIAWKLCESPLISKVYVAPGNGGTASNGAESKMENVNIGVCDFEQLVKFALDKDVNLVIPGPELPLVEGIEGHFRRVGIPCFGPSALAARMEGSKVFSKDFMHRNNIPTAVYKSFSNYDHAKSFLDTCTFDVVIKADGLAAGKGVIIPKTKKEAFEALESIMLNEEFGSAGKNVVIEELLEGEELSILTFSDGYTCRSLPPAQDHKRAFDGDKGPNTGGMGCYAPTPVASPKLLETVQSTIIQPTIDGMRHEGYPLVGILFTGLMLTPSGPRVLEYNVRFGDPETQAVLPLLESDLAEIILACV... | de novo' IMP biosynthetic process adenine biosynthetic process purine nucleobase biosynthetic process purine nucleotide biosynthetic process cytosol ATP binding metal ion binding phosphoribosylamine-glycine ligase activity phosphoribosylformylglycinamidine cyclo-ligase activity Schizosaccharomyces pombe ATP-binding Cy... |
articular cartilage development bone development negative regulation of smooth muscle cell proliferation | collagen-containing extracellular matrix; extracellular exosome; extracellular matrix; extracellular region; extracellular space; extracellular vesicle; Golgi lumen; lysosomal lumen | growth factor activity | Homo sapiens | Direct protein sequencing Disulfide bond Extracellular matrix Glycoprotein Growth factor Leucine-rich repeat Proteoglycan Reference proteome Repeat Secreted Signal | MKTLQSTLLL | MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKSLQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFKKLNNLTFLYLDHNALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLGKHPNSFICLKRLPIGSYF | articular cartilage development bone development negative regulation of smooth muscle cell proliferation collagen-containing extracellular matrix; extracellular exosome; extracellular matrix; extracellular region; extracellular space; extracellular vesicle; Golgi lumen; lysosomal lumen growth factor activity Homo sapie... |
acrosome reaction adult walking behavior chemical synaptic transmission chloride transmembrane transport gamma-aminobutyric acid receptor clustering monoatomic ion transport nervous system development neuromuscular process neuropeptide signaling pathway regulation of membrane potential righting reflex startle response ... | cytoplasm; dendrite; GABA-ergic synapse; glycine-gated chloride channel complex; glycinergic synapse; membrane; neuron projection; perikaryon; plasma membrane; postsynaptic membrane; postsynaptic specialization; synapse | extracellularly glycine-gated chloride channel activity extracellularly glycine-gated ion channel activity glycine binding protein-containing complex binding transmembrane signaling receptor activity transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential | Rattus norvegicus | 3D-structure Cell membrane Cell projection Chloride Chloride channel Cytoplasm Direct protein sequencing Disulfide bond Glycoprotein Ion channel Ion transport Ligand-gated ion channel Membrane Phosphoprotein Postsynaptic cell membrane Receptor Reference proteome Signal Synapse Transmembrane Transmembrane helix Transpor... | MKFSLAVSFF | MKFSLAVSFFILMSLLFEDACSKEKSSKKGKGKKKQYLCPSQQSAEDLARVPPNSTSNILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPSDFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIALPQFDIKKEDIEYGNCTKYYKGTGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAAEL... | acrosome reaction adult walking behavior chemical synaptic transmission chloride transmembrane transport gamma-aminobutyric acid receptor clustering monoatomic ion transport nervous system development neuromuscular process neuropeptide signaling pathway regulation of membrane potential righting reflex startle response ... |
monoatomic cation transport regulation of membrane potential skeletal muscle contraction | acetylcholine-gated channel complex; neuromuscular junction; neuron projection; postsynaptic membrane; postsynaptic specialization membrane; synapse | acetylcholine-gated monoatomic cation-selective channel activity excitatory extracellular ligand-gated monoatomic ion channel activity transmembrane signaling receptor activity transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential | Mus musculus | Cell membrane Disulfide bond Glycoprotein Ion channel Ion transport Ligand-gated ion channel Membrane Postsynaptic cell membrane Receptor Reference proteome Signal Synapse Transmembrane Transmembrane helix Transport | MAGALLGALL | MAGALLGALLLLTLFGRSQGKNEELSLYHHLFDNYDPECRPVRRPEDTVTITLKVTLTNLISLNEKEETLTTSVWIGIDWHDYRLNYSKDDFAGVGILRVPSEHVWLPEIVLENNIDGQFGVAYDSNVLVYEGGYVSWLPPAIYRSTCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFIFAVDDDGNTINKIDIDTAAFTENGEWAIDYCPGMIRRYEGGSTEGPGETDVIYTLIIRRKPLFYVINIIVPCVLISGLVLLAYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLSVPLLGRYLIFVMVVATLIVM... | monoatomic cation transport regulation of membrane potential skeletal muscle contraction acetylcholine-gated channel complex; neuromuscular junction; neuron projection; postsynaptic membrane; postsynaptic specialization membrane; synapse acetylcholine-gated monoatomic cation-selective channel activity excitatory extrac... |
activation of GTPase activity activation of protein kinase B activity cell-cell signaling induction of positive chemotaxis memory modulation of chemical synaptic transmission negative regulation of neuron apoptotic process negative regulation of peptidyl-tyrosine phosphorylation nerve development nerve growth factor si... | axon; dendrite; extracellular region; extracellular space; synaptic vesicle | chemoattractant activity growth factor activity nerve growth factor receptor binding signaling receptor binding | Homo sapiens | 3D-structure Alternative splicing Cleavage on pair of basic residues Disulfide bond Glycoprotein Growth factor Reference proteome Secreted Signal | MSILFYVIFL | MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGSPVVANRTSRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT | activation of GTPase activity activation of protein kinase B activity cell-cell signaling induction of positive chemotaxis memory modulation of chemical synaptic transmission negative regulation of neuron apoptotic process negative regulation of peptidyl-tyrosine phosphorylation nerve development nerve growth factor si... |
mitochondrial electron transport, ubiquinol to cytochrome c mitochondrial respiratory chain complex III assembly respiratory electron transport chain response to hormone response to xenobiotic stimulus | mitochondrial membrane; mitochondrial respiratory chain complex III; mitochondrial respiratory chain complex IV; mitochondrion; respiratory chain complex III | 2 iron, 2 sulfur cluster binding metal ion binding oxidoreductase activity protein-containing complex binding ubiquinol-cytochrome-c reductase activity | Rattus norvegicus | 2Fe-2S Direct protein sequencing Disulfide bond Electron transport Iron Iron-sulfur Membrane Metal-binding Mitochondrion Mitochondrion inner membrane Reference proteome Respiratory chain Transit peptide Translocase Transmembrane Transmembrane helix Transport | MLSVAARSGP | MLSVAARSGPFAPVLSATSRGVAGALRPLLQSAVPATSEPPVLDVKRPFLCRESLSGQAATRPLVATVGLNVPASVRYSHTDIKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNAVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFTSGDVVVVG | mitochondrial electron transport, ubiquinol to cytochrome c mitochondrial respiratory chain complex III assembly respiratory electron transport chain response to hormone response to xenobiotic stimulus mitochondrial membrane; mitochondrial respiratory chain complex III; mitochondrial respiratory chain complex IV; mitoc... |
adult locomotory behavior D-aspartate import across plasma membrane detection of temperature stimulus involved in sensory perception of pain inositol phosphate catabolic process L-glutamate import across plasma membrane learning negative regulation of apoptotic process negative regulation of release of sequestered calc... | axon; axon terminus; cell surface; cytoplasmic side of plasma membrane; dendrite; dendritic shaft; dendritic spine; membrane raft; neuron spine; neuronal cell body; perikaryon; plasma membrane; symmetric synapse; terminal bouton | G protein-coupled neurotensin receptor activity identical protein binding protein-containing complex binding | Rattus norvegicus | 3D-structure Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Lipoprotein Membrane Palmitate Receptor Reference proteome Transducer Transmembrane Transmembrane helix | MHLNSSVPQG | MHLNSSVPQGTPGEPDAQPFSGPQSEMEATFLALSLSNGSGNTSESDTAGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNSVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQNRSGDGTHPGGLVCTPIVDTATVKVVIQVNTFMSFLFPMLVISILNTVIANKLTVMVHQAAEQGRVCTVGTHNGLEHSTFNMTIEPGRVQALRHGVLVLRAVVIAFVVC... | adult locomotory behavior D-aspartate import across plasma membrane detection of temperature stimulus involved in sensory perception of pain inositol phosphate catabolic process L-glutamate import across plasma membrane learning negative regulation of apoptotic process negative regulation of release of sequestered calc... |
actin cytoskeleton organization calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules contractile vacuole discharge contractile vacuole organization contractile vacuole tethering involved in discharge hypotonic response protein secretion regulation of aggregate size involved in sorocarp devel... | contractile vacuolar membrane; contractile vacuole; intracellular membrane-bounded organelle; lipid droplet; pathogen-containing vacuole; plasma membrane | GTP binding GTPase activating protein binding GTPase activity protein-containing complex binding | Dictyostelium discoideum | Cell membrane GTP-binding Lipoprotein Membrane Nucleotide-binding Prenylation Protein transport Reference proteome Transport | MTSPATNKSA | MTSPATNKSAAYDYLIKLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGIDFKIRTIELEGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDEKSFGNIRNWIRNIEQHATDSVNKMLIGNKCDMAEKKVVDSSRGKSLADEYGIKFLETSAKNSINVEEAFISLAKDIKKRMIDTPNEQPQVVQPGTNLGANNNKKKACC | actin cytoskeleton organization calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules contractile vacuole discharge contractile vacuole organization contractile vacuole tethering involved in discharge hypotonic response protein secretion regulation of aggregate size involved in sorocarp devel... |
activin receptor signaling pathway cellular response to growth factor stimulus dauer entry dauer larval development defense response to Gram-negative bacterium detection of bacterium determination of adult lifespan larval feeding behavior negative regulation of dauer larval development nervous system development phosph... | activin receptor complex; plasma membrane | activin binding activin receptor activity, type I ATP binding transforming growth factor beta receptor activity | Caenorhabditis elegans | Alternative splicing ATP-binding Developmental protein Glycoprotein Kinase Membrane Nucleotide-binding Receptor Reference proteome Serine/threonine-protein kinase Signal Transferase Transmembrane Transmembrane helix | MRIRHVVFCL | MRIRHVVFCLLALVYGAETSDDDLDERTNIFIRDKLIPALKLAEVTKVNFTRLHLCHCSREVGCNARTTGWVPGIEFLNETDRSFYENTCYTDGSCYQSARPSPEISHFGCMDEKSVTDETEFHDTAAKVCTNNTKDPHATVWICCDKGNFCANETIIHLAPGPQQSSTWLILTILALLTFIVLLGIAIFLTRKSWEAKFDWYIRFKPKPGDPLRETENNVPMVTMGDGAGSSVPEVAPIEQQGSTMSTSAGNSFPPGIMPNNMKDMLDVLEETSGSGMGPTTLHKLTIGGQIRLTGRVGSGRFGNVSRGDYRGEAVAVK... | activin receptor signaling pathway cellular response to growth factor stimulus dauer entry dauer larval development defense response to Gram-negative bacterium detection of bacterium determination of adult lifespan larval feeding behavior negative regulation of dauer larval development nervous system development phosph... |
cell differentiation cilium assembly intracellular signal transduction intraciliary transport negative regulation of non-motile cilium assembly non-motile cilium assembly photoreceptor cell maintenance protein autophosphorylation protein phosphorylation spermatogenesis | axoneme; centrosome; cilium; cytoplasm; midbody; mitotic spindle; motile cilium; nucleus; photoreceptor connecting cilium; photoreceptor inner segment; photoreceptor outer segment | ATP binding metal ion binding protein serine kinase activity protein serine/threonine kinase activity transcription coactivator activity | Rattus norvegicus | Alternative splicing ATP-binding Cell projection Cilium Cytoplasm Cytoskeleton Developmental protein Differentiation Kinase Magnesium Metal-binding Nucleotide-binding Nucleus Phosphoprotein Reference proteome Serine/threonine-protein kinase Spermatogenesis Transcription Transcription regulation Transferase | MNRYTTMRQL | MNRYTTMRQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWDECMNLREVKSLKKLNHANVIKLKEVIRENDHLYFIFEYMKENLYQLMKDRNKLFPESVIRNIMYQILQGLAFIHKHGFFHRDMKPENLLCMGPELVKIADFGLARELRSQPPYTDYVSTRWYRAPEVLLRSSVYSSPIDVWAVGSIMAELYTFRPLFPGTSEVDEIFKICQVLGTPKKSDWPEGYQLASSMNFRFPQCIPINLKTLIPNASSEAIQLMTEMLNWDPKKRPTASQALKHPYFQVGQVLGPSAHHLDAKQTLHKQLQPPEPKPSSSERD... | cell differentiation cilium assembly intracellular signal transduction intraciliary transport negative regulation of non-motile cilium assembly non-motile cilium assembly photoreceptor cell maintenance protein autophosphorylation protein phosphorylation spermatogenesis axoneme; centrosome; cilium; cytoplasm; midbody; m... |
cell differentiation cilium assembly intracellular signal transduction intraciliary transport negative regulation of non-motile cilium assembly non-motile cilium assembly photoreceptor cell maintenance protein autophosphorylation protein phosphorylation spermatogenesis | axoneme; centrosome; cilium; cytoplasm; midbody; mitotic spindle; motile cilium; nucleus; photoreceptor connecting cilium; photoreceptor inner segment; photoreceptor outer segment | ATP binding metal ion binding protein kinase activity protein serine kinase activity protein serine/threonine kinase activity transcription coactivator activity | Homo sapiens | Alternative splicing ATP-binding Cell projection Cilium Cytoplasm Cytoskeleton Developmental protein Differentiation Disease variant Kinase Magnesium Metal-binding Nucleotide-binding Nucleus Phosphoprotein Reference proteome Retinitis pigmentosa Serine/threonine-protein kinase Spermatogenesis Transcription Transcriptio... | MNRYTTMRQL | MNRYTTMRQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWDECMNLREVKSLKKLNHANVIKLKEVIRENDHLYFIFEYMKENLYQLMKDRNKLFPESVIRNIMYQILQGLAFIHKHGFFHRDMKPENLLCMGPELVKIADFGLARELRSQPPYTDYVSTRWYRAPEVLLRSSVYSSPIDVWAVGSIMAELYMLRPLFPGTSEVDEIFKICQVLGTPKKSDWPEGYQLASSMNFRFPQCVPINLKTLIPNASNEAIQLMTEMLNWDPKKRPTASQALKHPYFQVGQVLGPSSNHLESKQSLNKQLQPLESKPSLVEVE... | cell differentiation cilium assembly intracellular signal transduction intraciliary transport negative regulation of non-motile cilium assembly non-motile cilium assembly photoreceptor cell maintenance protein autophosphorylation protein phosphorylation spermatogenesis axoneme; centrosome; cilium; cytoplasm; midbody; m... |
endocytosis Golgi to vacuole transport intracellular protein transport piecemeal microautophagy of the nucleus protein targeting to vacuole regulation of SNARE complex assembly regulation of vacuole fusion, non-autophagic vacuole fusion, non-autophagic vacuole organization vesicle docking vesicle fusion with vacuole ve... | CORVET complex; cytosol; early endosome membrane; fungal-type vacuole; fungal-type vacuole membrane; HOPS complex | ATP binding | Saccharomyces cerevisiae | 3D-structure Phosphoprotein Protein transport Reference proteome Transport Vacuole | MNRFWNTKKF | MNRFWNTKKFSLTNADGLCATLNEISQNDEVLVVQPSVLPVLNSLLTFQDLTQSTPVRKITLLDDQLSDDLPSALGSVPQMDLIFLIDVRTSLRLPPQLLDAAQKHNLSSLHIIYCRWKPSFQNTLEDTEQWQKDGFDLNSKKTHFPNVIESQLKELSNEYTLYPWDLLPFPQIDENVLLTHSLYNMENVNMYYPNLRSLQSATESILVDDMVNSLQSLIFETNSIITNVVSIGNLSKRCSHLLKKRIDEHQTENDLFIKGTLYGERTNCGLEMDLIILERNTDPITPLLTQLTYAGILDDLYEFNSGIKIKEKDMNFNY... | endocytosis Golgi to vacuole transport intracellular protein transport piecemeal microautophagy of the nucleus protein targeting to vacuole regulation of SNARE complex assembly regulation of vacuole fusion, non-autophagic vacuole fusion, non-autophagic vacuole organization vesicle docking vesicle fusion with vacuole ve... |
angiogenesis artery smooth muscle contraction axon extension cell surface receptor signaling pathway cell tip growth cytokine-mediated signaling pathway endothelial cell migration energy homeostasis hormonal regulation of the force of heart contraction intracellular calcium ion homeostasis lung alveolus development mac... | extracellular region; extracellular space | endothelin B receptor binding hormone activity | Homo sapiens | Cleavage on pair of basic residues Direct protein sequencing Disulfide bond Reference proteome Secreted Signal Vasoactive Vasoconstrictor | MVSVPTTWCS | MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR | angiogenesis artery smooth muscle contraction axon extension cell surface receptor signaling pathway cell tip growth cytokine-mediated signaling pathway endothelial cell migration energy homeostasis hormonal regulation of the force of heart contraction intracellular calcium ion homeostasis lung alveolus development mac... |
B cell differentiation cell population proliferation fat cell differentiation interleukin-11-mediated signaling pathway megakaryocyte differentiation negative regulation of hormone secretion positive regulation of cell population proliferation positive regulation of MAPK cascade positive regulation of peptidyl-serine p... | cytoplasm; extracellular region; extracellular space | cytokine activity growth factor activity interleukin-11 receptor binding | Homo sapiens | 3D-structure Alternative splicing Cytokine Growth factor Pharmaceutical Reference proteome Secreted Signal | MNCVCRLVLV | MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL | B cell differentiation cell population proliferation fat cell differentiation interleukin-11-mediated signaling pathway megakaryocyte differentiation negative regulation of hormone secretion positive regulation of cell population proliferation positive regulation of MAPK cascade positive regulation of peptidyl-serine p... |
inhibition of cysteine-type endopeptidase activity negative regulation of type B pancreatic cell apoptotic process presynaptic active zone organization | cytoplasm; cytosol; endoplasmic reticulum; membrane | cadherin binding calcium-dependent cysteine-type endopeptidase inhibitor activity endopeptidase inhibitor activity RNA binding | Homo sapiens | Acetylation Alternative splicing Isopeptide bond Palmoplantar keratoderma Phosphoprotein Protease inhibitor Reference proteome Repeat Thiol protease inhibitor Ubl conjugation | MNPTETKAIP | MNPTETKAIPVSQQMEGPHLPNKKKHKKQAVKTEPEKKSQSTKLSVVHEKKSQEGKPKEHTEPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKA... | inhibition of cysteine-type endopeptidase activity negative regulation of type B pancreatic cell apoptotic process presynaptic active zone organization cytoplasm; cytosol; endoplasmic reticulum; membrane cadherin binding calcium-dependent cysteine-type endopeptidase inhibitor activity endopeptidase inhibitor activity R... |
coumarin metabolic process epoxygenase P450 pathway response to stilbenoid xenobiotic metabolic process | cytoplasm; endoplasmic reticulum membrane; intracellular membrane-bounded organelle | arachidonic acid epoxygenase activity aromatase activity heme binding iron ion binding monooxygenase activity oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen oxygen binding | Rattus norvegicus | Acetylation Endoplasmic reticulum Heme Iron Membrane Metal-binding Microsome Monooxygenase Oxidoreductase Phosphoprotein Reference proteome | MLASGLLLVA | MLASGLLLVASVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFIGNYLQLNTEKMYSSLMKISQRYGPVFTIHLGPRRVVVLCGQEAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSSGERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIESFRKTNGALIDPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFITKKVEQNQRTLDPNSPRDFIDSFLIRMLEEKKNPNTEFYMKNLVLTTLNLFFAGTETVSTTLRYGFLLLMKH... | coumarin metabolic process epoxygenase P450 pathway response to stilbenoid xenobiotic metabolic process cytoplasm; endoplasmic reticulum membrane; intracellular membrane-bounded organelle arachidonic acid epoxygenase activity aromatase activity heme binding iron ion binding monooxygenase activity oxidoreductase activit... |
cellular ketone metabolic process epoxygenase P450 pathway steroid metabolic process xenobiotic catabolic process xenobiotic metabolic process | cytoplasm; endoplasmic reticulum membrane; intracellular membrane-bounded organelle | anandamide 11,12 epoxidase activity anandamide 14,15 epoxidase activity anandamide 8,9 epoxidase activity arachidonic acid epoxygenase activity estrogen 2-hydroxylase activity heme binding iron ion binding monooxygenase activity oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecu... | Homo sapiens | 3D-structure Alternative splicing Endoplasmic reticulum Heme Iron Lipid metabolism Membrane Metal-binding Microsome Monooxygenase NADP Oxidoreductase Phosphoprotein Reference proteome | MELSVLLFLA | MELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLRFREKYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNRWKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFHYQDQEFLKMLNLFYQTFSLISSVFGQLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDLIDTYLLHMEKEKSNAHSEFSHQNLNLNTLSLFFAGTETTSTTLRYGFLLMLKYPHV... | cellular ketone metabolic process epoxygenase P450 pathway steroid metabolic process xenobiotic catabolic process xenobiotic metabolic process cytoplasm; endoplasmic reticulum membrane; intracellular membrane-bounded organelle anandamide 11,12 epoxidase activity anandamide 14,15 epoxidase activity anandamide 8,9 epoxid... |
epoxygenase P450 pathway xenobiotic metabolic process | cytoplasm; endoplasmic reticulum membrane; intracellular membrane-bounded organelle | arachidonic acid epoxygenase activity aromatase activity heme binding iron ion binding monooxygenase activity oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen | Rattus norvegicus | Direct protein sequencing Endoplasmic reticulum Heme Iron Membrane Metal-binding Microsome Monooxygenase Oxidoreductase Reference proteome | MDPVVVLLLS | MDPVVVLLLSLFFLLFLSLWRPSSGRGKLPPGPTPLPIIGNFFQVDMKDIRQSLTNFSKTYGPVYTLYVGSQPTVVLHGYEALKEALVDHGEEFSGRGRLPICEKVAKGQGIAFSHGNVWKATRHFTVKTLRNLGMGKGTIEDKVQEEAKWLVKELKKTNGSPCDPQFIMGCAPGNVICSIILQNRFDYEDKDFLNLIEKVNEAVKIISSPGIQVFNIFPILLDYCPGNHNIYFKNHTWLKSYLLEKIKEHEESLDVSNPRDFIDYFLIERNQENANQWMNYTLEHLAIMVTDLFFAGIETVSSTMRFALLLLMKYPHVT... | epoxygenase P450 pathway xenobiotic metabolic process cytoplasm; endoplasmic reticulum membrane; intracellular membrane-bounded organelle arachidonic acid epoxygenase activity aromatase activity heme binding iron ion binding monooxygenase activity oxidoreductase activity, acting on paired donors, with incorporation or ... |
aflatoxin metabolic process alkaloid catabolic process estrogen metabolic process lipid hydroxylation oxidative demethylation retinoic acid metabolic process retinol metabolic process steroid metabolic process xenobiotic catabolic process xenobiotic metabolic process | endoplasmic reticulum membrane; intracellular membrane-bounded organelle | aromatase activity estrogen 16-alpha-hydroxylase activity heme binding iron ion binding monooxygenase activity oxidoreductase activity oxygen binding retinoic acid 4-hydroxylase activity testosterone 6-beta-hydroxylase activity | Homo sapiens | 3D-structure Alternative splicing Endoplasmic reticulum Heme Iron Lipid metabolism Membrane Metal-binding Microsome Monooxygenase Oxidoreductase Reference proteome Steroid metabolism | MDLIPNLAVE | MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKFDTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSLFPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYE... | aflatoxin metabolic process alkaloid catabolic process estrogen metabolic process lipid hydroxylation oxidative demethylation retinoic acid metabolic process retinol metabolic process steroid metabolic process xenobiotic catabolic process xenobiotic metabolic process endoplasmic reticulum membrane; intracellular membra... |
arachidonic acid metabolic process icosanoid biosynthetic process kidney development lauric acid metabolic process linoleic acid metabolic process response to hormone response to xenobiotic stimulus | endoplasmic reticulum membrane; intracellular membrane-bounded organelle | alkane 1-monooxygenase activity arachidonic acid 11,12-epoxygenase activity arachidonic acid binding arachidonic acid monooxygenase activity fatty acid binding heme binding iron ion binding long-chain fatty acid omega-hydroxylase activity | Rattus norvegicus | Direct protein sequencing Endoplasmic reticulum Heme Iron Membrane Metal-binding Microsome Monooxygenase NADP Oxidoreductase Phosphoprotein Reference proteome | MGFSVFSPTR | MGFSVFSPTRSLDGVSGFFQGAFLLSLFLVLFKAVQFYLRRQWLLKALEKFPSTPSHWLWGHNLKDREFQQVLTWVEKFPGACLQWLSGSTARVLLYDPDYVKVVLGRSDPKPYQSLAPWIGYGLLLLNGKKWFQHRRMLTPAFHYDILKPYVKIMADSVSIMLDKWEKLDDQDHPLEIFHYVSLMTLDTVMKCAFSHQGSVQLDVNSRSYTKAVEDLNNLIFFRVRSAFYGNSIIYNMSSDGRLSRRACQIAHEHTDGVIKTRKAQLQNEEELQKARKKRHLDFLDILLFAKMEDGKSLSDEDLRAEVDTFMFEGHDTT... | arachidonic acid metabolic process icosanoid biosynthetic process kidney development lauric acid metabolic process linoleic acid metabolic process response to hormone response to xenobiotic stimulus endoplasmic reticulum membrane; intracellular membrane-bounded organelle alkane 1-monooxygenase activity arachidonic acid... |
arachidonic acid metabolic process icosanoid biosynthetic process kidney development lauric acid metabolic process linoleic acid metabolic process response to 3-methylcholanthrene | endoplasmic reticulum membrane; intracellular membrane-bounded organelle | alkane 1-monooxygenase activity arachidonic acid monooxygenase activity heme binding iron ion binding long-chain fatty acid omega-hydroxylase activity | Rattus norvegicus | Direct protein sequencing Endoplasmic reticulum Heme Iron Membrane Metal-binding Microsome Monooxygenase NADP Oxidoreductase Phosphoprotein Reference proteome | MGFSVFTPTR | MGFSVFTPTRSLDGVSGFFQGAFLLSLFLVLFKAVQFYLRRQWLLKALEKFPSTPSHWLWGHDLKDREFQQVLTWVEKFPGACLQWLSGSKTRVLLYDPDYVKVVLGRSDPKASGIYQFLAPWIGYGLLLLNGKKWFQHRRMLTPAFHYGILKPYVKIMADSVNIMLDKWEKLDDQDHPLEIFHYVSLMTLDTVMKCAFSHQGSVQLDVNSRSYTKAVEDLNNLTFFRVRSAFYGNSIIYNMSSDGRLSRRACQIAHEHTDGVIKMRKAQLQNEEELQKARKKRHLDFLDILLFAKMEDGKSLSDEDLRAEVDTFMFEGH... | arachidonic acid metabolic process icosanoid biosynthetic process kidney development lauric acid metabolic process linoleic acid metabolic process response to 3-methylcholanthrene endoplasmic reticulum membrane; intracellular membrane-bounded organelle alkane 1-monooxygenase activity arachidonic acid monooxygenase acti... |
glucose homeostasis glucose import insulin secretion liver development pancreas development positive regulation of DNA-templated transcription positive regulation of transcription by RNA polymerase II positive regulation of transcription initiation by RNA polymerase II regulation of transcription by RNA polymerase II r... | chromatin; cytoplasm; nucleus; protein-containing complex | DNA binding DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific protein dimerization activity protein heterodimerization activity protein homodimerization activity RNA polymerase II cis-r... | Homo sapiens | 3D-structure Activator Alternative splicing Diabetes mellitus Disease variant DNA-binding Homeobox Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation | MVSKLSQLQT | MVSKLSQLQTELLAALLESGLSKEALIQALGEPGPYLLAGEGPLDKGESCGGGRGELAELPNGLGETRGSEDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRHKLAMDTYSGPPPGPGPGPALPAHSSPGLPPPALSPSKVHGV... | glucose homeostasis glucose import insulin secretion liver development pancreas development positive regulation of DNA-templated transcription positive regulation of transcription by RNA polymerase II positive regulation of transcription initiation by RNA polymerase II regulation of transcription by RNA polymerase II r... |
GMP biosynthetic process GTP biosynthetic process | azurophil granule lumen; cytoplasm; cytosol; extracellular region; ficolin-1-rich granule lumen; nucleus; secretory granule lumen | DNA binding identical protein binding IMP dehydrogenase activity metal ion binding nucleic acid binding nucleotide binding RNA binding | Homo sapiens | 3D-structure Alternative splicing CBS domain Cytoplasm Direct protein sequencing Disease variant DNA-binding GMP biosynthesis Leber congenital amaurosis Metal-binding Methylation NAD Nucleus Oxidoreductase Phosphoprotein Potassium Purine biosynthesis Reference proteome Repeat Retinitis pigmentosa RNA-binding | MADYLISGGT | MADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDG... | GMP biosynthetic process GTP biosynthetic process azurophil granule lumen; cytoplasm; cytosol; extracellular region; ficolin-1-rich granule lumen; nucleus; secretory granule lumen DNA binding identical protein binding IMP dehydrogenase activity metal ion binding nucleic acid binding nucleotide binding RNA binding Homo ... |
agglutination involved in conjugation with cellular fusion | cell periphery; extracellular region; fungal-type cell wall; fungal-type vacuole; side of membrane | cell adhesion molecule binding | Saccharomyces cerevisiae | Cell adhesion Cell wall Direct protein sequencing Disulfide bond Glycoprotein GPI-anchor Lipoprotein Membrane Reference proteome Repeat Secreted Signal | MFTFLKIILW | MFTFLKIILWLFSLALASAININDITFSNLEITPLTANKQPDQGWTATFDFSIADASSIREGDEFTLSMPHVYRIKLLNSSQTATISLADGTEAFKCYVSQQAAYLYENTTFTCTAQNDLSSYNTIDGSITFSLNFSDGGSSYEYELENAKFFKSGPMLVKLGNQMSDVVNFDPAAFTENVFHSGRSTGYGSFESYHLGMYCPNGYFLGGTEKIDYDSSNNNVDLDCSSVQVYSSNDFNDWWFPQSYNDTNADVTCFGSNLWITLDEKLYDGEMLWVNALQSLPANVNTIDHALEFQYTCLDTIANTTYATQFSTTREFI... | agglutination involved in conjugation with cellular fusion cell periphery; extracellular region; fungal-type cell wall; fungal-type vacuole; side of membrane cell adhesion molecule binding Saccharomyces cerevisiae Cell adhesion Cell wall Direct protein sequencing Disulfide bond Glycoprotein GPI-anchor Lipoprotein Memb... |
animal organ morphogenesis extracellular matrix organization | collagen type IX trimer; collagen-containing extracellular matrix; endoplasmic reticulum lumen; extracellular region; extracellular space | carbohydrate binding extracellular matrix structural constituent conferring tensile strength metal ion binding protein homodimerization activity | Homo sapiens | 3D-structure Alternative splicing Collagen Deafness Direct protein sequencing Disease variant Disulfide bond Extracellular matrix Glycoprotein Hydroxylation Metal-binding Reference proteome Repeat Secreted Signal Stickler syndrome Zinc | MKTCWKIPVF | MKTCWKIPVFFFVCSFLEPWASAAVKRRPRFPVNSNSNGGNELCPKIRIGQDDLPGFDLISQFQVDKAASRRAIQRVVGSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMTGSTLKKNWNIWQIQDSSGKEQVGIKINGQTQSVVFSYKGLDGSLQTAAFSNLSSLFDSQWHKIMIGVERSSATLFVDCNRIESLPIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGPPGPPGPAGEPGKPGAPGKPG... | animal organ morphogenesis extracellular matrix organization collagen type IX trimer; collagen-containing extracellular matrix; endoplasmic reticulum lumen; extracellular region; extracellular space carbohydrate binding extracellular matrix structural constituent conferring tensile strength metal ion binding protein ho... |
cellular response to cadmium ion coumarin metabolic process epoxygenase P450 pathway heme metabolic process response to stilbenoid xenobiotic metabolic process | cytoplasm; cytoplasmic microtubule; endoplasmic reticulum membrane; intracellular membrane-bounded organelle | arachidonic acid epoxygenase activity aromatase activity coumarin 7-hydroxylase activity enzyme binding heme binding iron ion binding oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxyge... | Mus musculus | Acetylation Endoplasmic reticulum Heme Iron Membrane Metal-binding Microsome Monooxygenase Oxidoreductase Phosphoprotein Reference proteome | MLTSGLLLVA | MLTSGLLLVAAVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFIGNFLQLNTEQMYNSLMKISQRYGPVFTIYLGPRRIVVLCGQEAVKEALVDQAEEFSGRGEQATFDWLFKGYGVVFSSGERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDSFRKTNGAFIDPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSMGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFITKKVEHNQRTLDPNSPRDFIDSFLIRMLEEKKNPNTEFYMKNLVLTTLNLFFAGTETVSTTLRYGFLLLMKH... | cellular response to cadmium ion coumarin metabolic process epoxygenase P450 pathway heme metabolic process response to stilbenoid xenobiotic metabolic process cytoplasm; cytoplasmic microtubule; endoplasmic reticulum membrane; intracellular membrane-bounded organelle arachidonic acid epoxygenase activity aromatase act... |
coumarin metabolic process epoxygenase P450 pathway xenobiotic metabolic process | cytoplasm; endoplasmic reticulum membrane; intracellular membrane-bounded organelle | arachidonic acid epoxygenase activity aromatase activity heme binding iron ion binding oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen oxygen binding | Homo sapiens | Endoplasmic reticulum Heme Iron Membrane Metal-binding Microsome Monooxygenase Oxidoreductase Reference proteome | MLASGLLLVA | MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLNTEHICDSIMKFSECYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVAFSNGERAKQLLRFAIATLRDFGVGKRGIEERIQEESGFLIEAIRSTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLSMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFKLLQGLEDFIAKKVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFIAGTETVSTTLRYGFLLLMKH... | coumarin metabolic process epoxygenase P450 pathway xenobiotic metabolic process cytoplasm; endoplasmic reticulum membrane; intracellular membrane-bounded organelle arachidonic acid epoxygenase activity aromatase activity heme binding iron ion binding oxidoreductase activity, acting on paired donors, with incorporation... |
endoderm development in utero embryonic development mesoderm development negative regulation of cardiac muscle hypertrophy signal transduction | extracellular region; extracellular space | cytokine activity growth factor activity | Mus musculus | Cleavage on pair of basic residues Cytokine Disulfide bond Glycoprotein Growth factor Reference proteome Secreted Signal | MLPVCHRFCD | MLPVCHRFCDHLLLLLLLPSTTLAPAPASMGPAAALLQVLGLPEAPRSVPTHRPVPPVMWRLFRRRDPQEARVGRPLRPCHVEELGVAGNIVRHIPDSGLSSRPAQPARTSGLCPEWTVVFDLSNVEPTERPTRARLELRLEAESEDTGGWELSVALWADAEHPGPELLRVPAPPGVLLRADLLGTAVAANASVPCTVRLALSLHPGATAACGRLAEASLLLVTLDPRLCPLPRLRRHTEPRVEVGPVGTCRTRRLHVSFREVGWHRWVIAPRGFLANFCQGTCALPETLRGPGGPPALNHAVLRALMHAAAPTPGAGSP... | endoderm development in utero embryonic development mesoderm development negative regulation of cardiac muscle hypertrophy signal transduction extracellular region; extracellular space cytokine activity growth factor activity Mus musculus Cleavage on pair of basic residues Cytokine Disulfide bond Glycoprotein Growth fa... |
suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I suppression by virus of host antigen processing and presentation of peptide antigen via MHC class II suppression by virus of host autophagy | extracellular region; host cell Golgi membrane; host cell plasma membrane; membrane; virion component | GTP binding SH3 domain binding | Human immunodeficiency virus type 1 group M subtype B | AIDS Apoptosis Early protein Host cell membrane Host Golgi apparatus Host membrane Host-virus interaction Inhibition of host adaptive immune response by virus Inhibition of host autophagy by virus Inhibition of host MHC class I molecule presentation by virus Inhibition of host MHC class II molecule presentation by viru... | MGGKWSKHSV | MGGKWSKHSVPGWSTVRERMRRAEPATDRVRQTEPAAVGVGAVSRDLEKHGAITSSNTAATNADCAWLEAYEDEEVGFPVRPQVPLRPMTYKAAIDLSHFLKEKGGLEGLIYSQKRQDILDLWIYHTQGYFPDWQNYTAGPGVRFPLTFGWCFKLVPVDPEKVEEANEGENNCLLHPMSQHGMDDPEKEVLVWKFDSKLALHHVARELHPEYYKDC | suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I suppression by virus of host antigen processing and presentation of peptide antigen via MHC class II suppression by virus of host autophagy extracellular region; host cell Golgi membrane; host cell plasma membrane; membr... |
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane fusion of virus membrane with host plasma membrane positive regulation of cell growth positive regulation of establishment of T cell polarity positive regulation of plasma membrane raft polarization positive regula... | host cell endosome membrane; host cell plasma membrane; membrane; viral envelope; virion membrane | structural molecule activity | Human immunodeficiency virus type 1 group M subtype B | 3D-structure AIDS Apoptosis Clathrin-mediated endocytosis of virus by host Cleavage on pair of basic residues Coiled coil Disulfide bond Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Host cell membrane Host endosome Host membrane Host-virus interaction Li... | MRVKGIRKNY | MRVKGIRKNYQHLWKGGILLLGTLMICSAVEKLWVTVYYGVPVWKETTTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLENVTEDFNMWKNNMVEQMQEDVINLWDQSLKPCVKLTPLCVTLNCKDVNATNTTSSSEGMMERGEIKNCSFNITKSIRDKVQKEYALFYKLDVVPIDNKNNTKYRLISCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGKGQCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEKVVIRSDNFTDNAKTIIVQLNESVKINCTRPSNNTRKSIHIGPGRAFYTTGEII... | clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane fusion of virus membrane with host plasma membrane positive regulation of cell growth positive regulation of establishment of T cell polarity positive regulation of plasma membrane raft polarization positive regula... |
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane suppression by virus of host tetherin activity suppression by virus of host type I interferon-mediated signaling pathway virion attachment to host cell | host cell endosome membrane; host cell plasma membrane; membrane; viral envelope; virion membrane | structural molecule activity | Human immunodeficiency virus type 2 subtype A | 3D-structure AIDS Apoptosis Clathrin-mediated endocytosis of virus by host Cleavage on pair of basic residues Coiled coil Disulfide bond Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Host cell membrane Host endosome Host membrane Host-virus interaction In... | MCGRNQLFVA | MCGRNQLFVASLLASACLIYCVQYVTVFYGVPVWRNASIPLFCATKNRDTWGTIQCLPDNDDYQEIALNVTEAFDAWNNTVTEQAVEDVWSLFETSIKPCVKLTPLCVAMRCNSTTAKNTTSTPTTTTTANTTIGENSSCIRTDNCTGLGEEEMVDCQFNMTGLERDKKKLYNETWYSKDVVCESNDTKKEKTCYMNHCNTSVITESCDKHYWDTMRFRYCAPPGFALLRCNDTNYSGFEPNCSKVVAATCTRMMETQTSTWFGFNGTRAENRTYIYWHGRDNRTIISLNKFYNLTVHCKRPGNKTVVPITLMSGLVFHS... | clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane suppression by virus of host tetherin activity suppression by virus of host type I interferon-mediated signaling pathway virion attachment to host cell host cell endosome membrane; host cell plasma membrane; membra... |
viral budding via host ESCRT complex | host cell nucleus; host cell plasma membrane; host multivesicular body; membrane; viral nucleocapsid; virion membrane | RNA binding structural molecule activity zinc ion binding | Human immunodeficiency virus type 1 group M subtype B | AIDS Capsid protein Host cell membrane Host cytoplasm Host endosome Host membrane Host nucleus Host-virus interaction Lipoprotein Membrane Metal-binding Methylation Myristate Phosphoprotein Reference proteome Repeat Ribosomal frameshifting RNA-binding Viral budding Viral budding via the host ESCRT complexes Viral nucle... | MGARASVLSG | MGARASVLSGGELDRWEKIRLRPGGKKKYRLKHIVWASRELERFAVNPGLLESSEGCRQILGQLQPSLKTGSEELTSLYNTVATLYCVHQRIEIKDTKEALEKIEEEQTKSMKKAQQAAADTGNSSQVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVIEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPVSILDIRQGPKEPFRDYVDRFYKTLRAEQATQEVKNWMTET... | viral budding via host ESCRT complex host cell nucleus; host cell plasma membrane; host multivesicular body; membrane; viral nucleocapsid; virion membrane RNA binding structural molecule activity zinc ion binding Human immunodeficiency virus type 1 group M subtype B AIDS Capsid protein Host cell membrane Host cytoplas... |
viral budding via host ESCRT complex | host cell nucleus; host cell plasma membrane; host multivesicular body; membrane; viral nucleocapsid; virion membrane | RNA binding structural molecule activity zinc ion binding | Human immunodeficiency virus type 2 subtype A | AIDS Capsid protein Host cell membrane Host cytoplasm Host endosome Host membrane Host nucleus Host-virus interaction Lipoprotein Membrane Metal-binding Myristate Phosphoprotein Repeat Ribosomal frameshifting RNA-binding Viral budding Viral budding via the host ESCRT complexes Viral nucleoprotein Viral release from hos... | MGARNSVLRG | MGARNSVLRGKKADELEKIRLRPGGKKKYRLKHIVWAANELDRFGLAESLLESKEGCQKILTVLDPLVPTGSENLKSLFNTVCVIWCIHAEEKAKDTEEAKQKVQRHLVAETKTTEKMPSTSRPTAPPSGNGGNFPVQQVAGNYTHVPLSPRTLNAWVKLVEEKKFGAEVVPGFQALSEGCTPYDINQMLNCVGDHQAAMQIIREIINEEAADWDAQHPIPGPLPAGQLREPRGSDIAGTTSTVEEQIQWMFRPQNPVPVGSIYRRWIQIGLQKCVRMYNPTNILDIKQGPKEPFQSYVDRFYKSLRAEQTDPAVKNWMT... | viral budding via host ESCRT complex host cell nucleus; host cell plasma membrane; host multivesicular body; membrane; viral nucleocapsid; virion membrane RNA binding structural molecule activity zinc ion binding Human immunodeficiency virus type 2 subtype A AIDS Capsid protein Host cell membrane Host cytoplasm Host e... |
DNA-templated transcription modulation by virus of host chromatin organization negative regulation of peptidyl-threonine phosphorylation positive regulation of transcription elongation by RNA polymerase II positive regulation of viral transcription suppression by virus of host translation initiation suppression by viru... | extracellular region; host cell cytoplasm; host cell nucleolus | actinin binding cyclin binding metal ion binding protein domain specific binding protein serine/threonine phosphatase inhibitor activity regulatory region RNA binding RNA-binding transcription regulator activity trans-activation response element binding | Human immunodeficiency virus type 1 group M subtype B | Acetylation Activator AIDS Alternative splicing Apoptosis Host cytoplasm Host nucleus Host-virus interaction Inhibition of host innate immune response by virus Inhibition of host interferon signaling pathway by virus Isopeptide bond Metal-binding Methylation Modulation of host chromatin by virus Modulation of host PP1 ... | MEPVDPSLEP | MEPVDPSLEPWKHPGSQPKTACTNCYCKKCCLHCQVCFTTKGLGISYGRKKRRQRRRPPQDSQTHQVSLPKQPSSQQRGDPTGPKESKKKVERETETDPDN | DNA-templated transcription modulation by virus of host chromatin organization negative regulation of peptidyl-threonine phosphorylation positive regulation of transcription elongation by RNA polymerase II positive regulation of viral transcription suppression by virus of host translation initiation suppression by viru... |
positive regulation of viral transcription | host cell nucleolus | RNA binding RNA-binding transcription regulator activity | Human immunodeficiency virus type 2 subtype A | Activator AIDS Alternative splicing Host nucleus Host-virus interaction Phosphoprotein RNA-binding Transcription Transcription regulation | METPLKAPEG | METPLKAPEGSLGSYNEPSSCTSEQDAAAQGLVSPGDEILYQLYQPLEACDNKCYCKKCCYHCQMCFLNKGLGIWYERKGRRRRTPKKTKAHSSSASDKSISTRTGNSQPEKKQKKTLETALETIGGPGR | positive regulation of viral transcription host cell nucleolus RNA binding RNA-binding transcription regulator activity Human immunodeficiency virus type 2 subtype A Activator AIDS Alternative splicing Host nucleus Host-virus interaction Phosphoprotein RNA-binding Transcription Transcription regulation METPLKAPEG METP... |
suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I suppression by virus of host antigen processing and presentation of peptide antigen via MHC class II suppression by virus of host autophagy | extracellular region; host cell Golgi membrane; host cell plasma membrane; membrane; virion component | GTP binding SH3 domain binding | Human immunodeficiency virus type 1 group M subtype B | AIDS Apoptosis Early protein Host cell membrane Host Golgi apparatus Host membrane Host-virus interaction Inhibition of host adaptive immune response by virus Inhibition of host autophagy by virus Inhibition of host MHC class I molecule presentation by virus Inhibition of host MHC class II molecule presentation by viru... | MGGKWSKCSM | MGGKWSKCSMKGWPTIRERMKRAELQPPEPAAEGVGAASRDLEKHGAITSSNTAATNADCAWLEAQEDEEVGFPVRPQVPLRPMTYKGALDLSHFLKEKGGLEGLIYSQKRQDILDLWVYHTQGYFPDWQNYTPGPGIRYPLCFGWCFKLVPMDPDQVEEANEGENNSLLHPISLHGMDDPEKEVLVWKFDSRLAFRHMAREVHPEYYKDC | suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I suppression by virus of host antigen processing and presentation of peptide antigen via MHC class II suppression by virus of host autophagy extracellular region; host cell Golgi membrane; host cell plasma membrane; membr... |
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane fusion of virus membrane with host plasma membrane positive regulation of establishment of T cell polarity positive regulation of plasma membrane raft polarization positive regulation of receptor clustering viral p... | host cell endosome membrane; host cell plasma membrane; membrane; viral envelope; virion membrane | structural molecule activity | Human immunodeficiency virus type 1 group M subtype B | AIDS Apoptosis Clathrin-mediated endocytosis of virus by host Cleavage on pair of basic residues Coiled coil Disulfide bond Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Host cell membrane Host endosome Host membrane Host-virus interaction Lipoprotein Mem... | MTARGTRKNY | MTARGTRKNYQRLWRWGTMLLGMLMICSAAENLWVTVYYGVPVWKEATTTLFCASDARAYATEVHNVWATHACVPTDPNPQEVVLGNVTENFDMWKNNMVEQMQEDIISLWDQSLKPCVKLTPLCVTLDCTDVNTTSSSLRNATNTTSSSWETMEKGELKNCSFNTTTSIRDKMQEQYALFYKLDVLPIDKNDTKFRLIHCNTSTITQACPKISFEPIPMHYCTPAGFAILKCNDKKFNGTGPCTNVSTVQCTHGIKPVVSTQLLLNGSLAEEEVIIRSSNFTNNAKIIIVQLNKSVEINCTRPNNNTRNRISIGPGRAF... | clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane fusion of virus membrane with host plasma membrane positive regulation of establishment of T cell polarity positive regulation of plasma membrane raft polarization positive regulation of receptor clustering viral p... |
viral budding via host ESCRT complex | host cell nucleus; host cell plasma membrane; host multivesicular body; membrane; viral nucleocapsid; virion membrane | RNA binding structural molecule activity zinc ion binding | Human immunodeficiency virus type 1 group M subtype B | AIDS Capsid protein Host cell membrane Host cytoplasm Host endosome Host membrane Host nucleus Host-virus interaction Lipoprotein Membrane Metal-binding Methylation Myristate Phosphoprotein Repeat Ribosomal frameshifting RNA-binding Viral budding Viral budding via the host ESCRT complexes Viral nucleoprotein Viral rele... | MGARASVLSG | MGARASVLSGGELDKWEKIRLRPGGKKKYQLKHIVWASRELERFAINPGLLETSEGCRQILGQLQPSLKTGSEEIRSLYNTVATLYCVHQKIEVKDTKEALDKIEEEQNKSKKKAQQTAADTGNSSQVSQNYPIVQNLQGQMVHQPISPRTLNAWVKVVEEKAFSPEVIPMFSALAEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQDVKNWMTET... | viral budding via host ESCRT complex host cell nucleus; host cell plasma membrane; host multivesicular body; membrane; viral nucleocapsid; virion membrane RNA binding structural molecule activity zinc ion binding Human immunodeficiency virus type 1 group M subtype B AIDS Capsid protein Host cell membrane Host cytoplas... |
DNA-templated transcription modulation by virus of host chromatin organization negative regulation of peptidyl-threonine phosphorylation positive regulation of transcription elongation by RNA polymerase II positive regulation of viral transcription suppression by virus of host translation initiation suppression by viru... | extracellular region; host cell cytoplasm; host cell nucleolus | actinin binding cyclin binding metal ion binding protein domain specific binding protein serine/threonine phosphatase inhibitor activity regulatory region RNA binding RNA-binding transcription regulator activity trans-activation response element binding | Human immunodeficiency virus type 1 group M subtype B | Acetylation Activator AIDS Alternative splicing Apoptosis Host cytoplasm Host nucleus Host-virus interaction Inhibition of host innate immune response by virus Inhibition of host interferon signaling pathway by virus Isopeptide bond Metal-binding Methylation Modulation of host chromatin by virus Modulation of host PP1 ... | MEPVDPRLEP | MEPVDPRLEPWKHPGSQPKTASNNCYCKRCCLHCQVCFTKKGLGISYGRKKRRQRRRAPQDSKTHQVSLSKQPASQPRGDPTGPKESKKKVERETETDPED | DNA-templated transcription modulation by virus of host chromatin organization negative regulation of peptidyl-threonine phosphorylation positive regulation of transcription elongation by RNA polymerase II positive regulation of viral transcription suppression by virus of host translation initiation suppression by viru... |
adenylate cyclase-activating serotonin receptor signaling pathway chemical synaptic transmission courtship behavior female mating behavior G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger male courtship behavior, orientation prior to leg tapping and wing vibration male courtsh... | dendrite; membrane; plasma membrane; synapse | G protein-coupled amine receptor activity G protein-coupled serotonin receptor activity neurotransmitter receptor activity | Drosophila melanogaster | Cell membrane Disulfide bond G-protein coupled receptor Membrane Receptor Reference proteome Repeat Transducer Transmembrane Transmembrane helix | MALSGQDWRR | MALSGQDWRRHQSHRQHRNHRTQGNHQKLISTATLTLFVLFLSSWIAYAAGKATVPAPLVEGETESATSQDFNSSSAFLGAIASASSTGSGSGSGSGSGSGSGSGSYGLASMNSSPIAIVSYQGITSSNLGDSNTTLVPLSDTPLLLEEFAAGEFVLPPLTSIFVSIVLLIVILGTVVGNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEHEDEEGQPICTVCQNF... | adenylate cyclase-activating serotonin receptor signaling pathway chemical synaptic transmission courtship behavior female mating behavior G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger male courtship behavior, orientation prior to leg tapping and wing vibration male courtsh... |
cell division meiotic cell cycle phosphorylation | transcription factor TFIIK complex | ATP binding cyclin-dependent protein serine/threonine kinase activity protein serine kinase activity RNA polymerase II CTD heptapeptide repeat kinase activity | Xenopus laevis | ATP-binding Cell cycle Cell division Kinase Meiosis Nucleotide-binding Nucleus Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase | MEGIAARGVD | MEGIAARGVDVRSRAKQYEKLDFLGEGQFATVYKARDKNTDRIVAIKKIKLGHRAEANDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDTSLVLTPAHIKSYMLMTLQGLEYLHHLWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRIYTHQVVTRWYRSPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPGMSSLPDYVAFKSFPGTPLHLIFIAAGDDLLELLQGLFTFNPCARCTASQALRKRYFSNRPAPTPGNLLPRPNCSI... | cell division meiotic cell cycle phosphorylation transcription factor TFIIK complex ATP binding cyclin-dependent protein serine/threonine kinase activity protein serine kinase activity RNA polymerase II CTD heptapeptide repeat kinase activity Xenopus laevis ATP-binding Cell cycle Cell division Kinase Meiosis Nucleotide... |
axon regeneration cell adhesion cell-cell adhesion via plasma-membrane adhesion molecules cellular response to mechanical stimulus central nervous system myelin formation negative regulation of axon extension negative regulation of neuron apoptotic process negative regulation of neuron differentiation negative regulati... | compact myelin; membrane raft; mesaxon; myelin sheath; myelin sheath adaxonal region; paranode region of axon; plasma membrane; Schmidt-Lanterman incisure | carbohydrate binding ganglioside GT1b binding protein homodimerization activity protein kinase binding sialic acid binding signaling receptor binding | Homo sapiens | Alternative splicing Cell adhesion Cell membrane Disease variant Disulfide bond Glycoprotein Hereditary spastic paraplegia Immunoglobulin domain Lectin Lipid-binding Lipoprotein Membrane Neurodegeneration Palmitate Phosphoprotein Reference proteome Repeat Signal Transmembrane Transmembrane helix Ubl conjugation | MIFLTALPLF | MIFLTALPLFWIMISASRGGHWGAWMPSSISAFEGTCVSIPCRFDFPDELRPAVVHGVWYFNSPYPKNYPPVVFKSRTQVVHESFQGRSRLLGDLGLRNCTLLLSNVSPELGGKYYFRGDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTREANGHRLGCQASFPNTTLQFEGYASMDVKYPPVIVEMNSSVEAIEGSHVSLLCGADSNPPPLLTWMRDGTVLREAVAESLLLELEEVTPAEDGVYACLAENAYGQDNRTVGL... | axon regeneration cell adhesion cell-cell adhesion via plasma-membrane adhesion molecules cellular response to mechanical stimulus central nervous system myelin formation negative regulation of axon extension negative regulation of neuron apoptotic process negative regulation of neuron differentiation negative regulati... |
axon regeneration cell adhesion cell-cell adhesion via plasma-membrane adhesion molecules cellular response to mechanical stimulus central nervous system myelin formation central nervous system myelination myelination negative regulation of axon extension negative regulation of neuron apoptotic process negative regulat... | compact myelin; membrane raft; mesaxon; myelin sheath; myelin sheath adaxonal region; paranode region of axon; plasma membrane; Schmidt-Lanterman incisure | carbohydrate binding ganglioside GT1b binding protein homodimerization activity protein kinase binding sialic acid binding signaling receptor binding | Mus musculus | 3D-structure Alternative splicing Cell adhesion Cell membrane Direct protein sequencing Disulfide bond Glycoprotein Immunoglobulin domain Lectin Lipid-binding Lipoprotein Membrane Palmitate Phosphoprotein Reference proteome Repeat Signal Transmembrane Transmembrane helix Ubl conjugation | MIFLATLPLF | MIFLATLPLFWIMISASRGGHWGAWMPSTISAFEGTCVSIPCRFDFPDELRPAVVHGVWYFNSPYPKNYPPVVFKSRTQVVHESFQGRSRLLGDLGLRNCTLLLSTLSPELGGKYYFRGDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPTVLGRLREDEGTWVQVSLLHFVPTREANGHRLGCQAAFPNTTLQFEGYASLDVKYPPVIVEMNSSVEAIEGSHVSLLCGADSNPPPLLTWMRDGMVLREAVAKSLYLDLEEVTPGEDGVYACLAENAYGQDNRTVEL... | axon regeneration cell adhesion cell-cell adhesion via plasma-membrane adhesion molecules cellular response to mechanical stimulus central nervous system myelin formation central nervous system myelination myelination negative regulation of axon extension negative regulation of neuron apoptotic process negative regulat... |
biological process involved in interaction with symbiont blood coagulation extracellular matrix disassembly fibrinolysis labyrinthine layer blood vessel development mononuclear cell migration muscle cell cellular homeostasis myoblast differentiation negative regulation of angiogenesis negative regulation of cell-substr... | cell surface; collagen-containing extracellular matrix; external side of plasma membrane; extracellular region; extracellular space; glutamatergic synapse; Schaffer collateral - CA1 synapse | apolipoprotein binding endopeptidase activity enzyme binding kinase binding protease binding protein antigen binding protein domain specific binding protein-folding chaperone binding serine-type endopeptidase activity signaling receptor binding | Mus musculus | Blood coagulation Cleavage on pair of basic residues Direct protein sequencing Disulfide bond Fibrinolysis Hemostasis Hydrolase Kringle Phosphoprotein Protease Reference proteome Repeat Secreted Serine protease Signal Tissue remodeling Zymogen | MDHKEVILLF | MDHKEVILLFLLLLKPGQGDSLDGYISTQGASLFSLTKKQLAAGGVSDCLAKCEGETDFVCRSFQYHSKEQQCVIMAENSKTSSIIRMRDVILFEKRVYLSECKTGIGNGYRGTMSRTKSGVACQKWGATFPHVPNYSPSTHPNEGLEENYCRNPDNDEQGPWCYTTDPDKRYDYCNIPECEEECMYCSGEKYEGKISKTMSGLDCQAWDSQSPHAHGYIPAKFPSKNLKMNYCRNPDGEPRPWCFTTDPTKRWEYCDIPRCTTPPPPPSPTYQCLKGRGENYRGTVSVTVSGKTCQRWSEQTPHRHNRTPENFPCKNLE... | biological process involved in interaction with symbiont blood coagulation extracellular matrix disassembly fibrinolysis labyrinthine layer blood vessel development mononuclear cell migration muscle cell cellular homeostasis myoblast differentiation negative regulation of angiogenesis negative regulation of cell-substr... |
mandelate catabolic process | plasma membrane | (S)-mandelate dehydrogenase activity FMN binding | Pseudomonas putida | 3D-structure Aromatic hydrocarbons catabolism Cell inner membrane Cell membrane Direct protein sequencing Flavoprotein FMN Mandelate pathway Membrane Oxidoreductase | MSQNLFNVED | MSQNLFNVEDYRKLRQKRLPKMVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKRLVDVSRRSLQAEVLGKRQSMPLLIGPTGLNGALWPKGDLALARAATKAGIPFVLSTASNMSIEDLARQCDGDLWFQLYVIHREIAQGMVLKALHTGYTTLVLTTDVAVNGYRERDLHNRFKIPMSYSAKVVLDGCLHPRWSLDFVRHGMPQLANFVSSQTSSLEMQAALMSRQMDASFNWEALRWLRDLWPHKLLVKGLLSAEDADRCIAEGADGVILSNHGGRQLDCAISPMEVLAQSVAKTGKPVLIDSGFRRGSDIVKALALGA... | mandelate catabolic process plasma membrane (S)-mandelate dehydrogenase activity FMN binding Pseudomonas putida 3D-structure Aromatic hydrocarbons catabolism Cell inner membrane Cell membrane Direct protein sequencing Flavoprotein FMN Mandelate pathway Membrane Oxidoreductase MSQNLFNVED MSQNLFNVEDYRKLRQKRLPKMVYDYLEGGAE... |
protein deglycosylation proteolysis | azurophil granule lumen; cytoplasm; endoplasmic reticulum; extracellular region; extracellular space; lysosome | asparaginase activity beta-aspartyl-peptidase activity N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity | Homo sapiens | 3D-structure Autocatalytic cleavage Direct protein sequencing Disease variant Disulfide bond Glycoprotein Hydrolase Lysosome Protease Reference proteome Signal | MARKSNLPVL | MARKSNLPVLLVPFLLCQALVRCSSPLPLVVNTWPFKNATEAAWRALASGGSALDAVESGCAMCEREQCDGSVGFGGSPDELGETTLDAMIMDGTTMDVGAVGDLRRIKNAIGVARKVLEHTTHTLLVGESATTFAQSMGFINEDLSTTASQALHSDWLARNCQPNYWRNVIPDPSKYCGPYKPPGILKQDIPIHKETEDDRGHDTIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPIPGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEFFGAVICANVTGSYGAACNKL... | protein deglycosylation proteolysis azurophil granule lumen; cytoplasm; endoplasmic reticulum; extracellular region; extracellular space; lysosome asparaginase activity beta-aspartyl-peptidase activity N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity Homo sapiens 3D-structure Autocatalytic cleavage Direct protein... |
cell adhesion | external side of plasma membrane; plasma membrane | carbohydrate binding signaling receptor activity | Mus musculus | 3D-structure Cell adhesion Disulfide bond Glycoprotein Lectin Membrane Receptor Reference proteome Signal-anchor Transmembrane Transmembrane helix | MSEQEVTYSM | MSEQEVTYSMVRFHKSAGLQKQVRPEETKGPREAGYRRCSFHWKFIVIALGIFCFLLLVAVSVLAIKIFQYDQQKNCEEFLNHHNNCSNMQSDINLKDEMLKNKSIECDLLESLNRDQNRLYNKTKTVLDSLQHTGRGDKVYWFCYGMKCYYFVMDRKTWSGCKQACQSSSLSLLKIDDEDELKFLQLVVPSDSCWVGLSYDNKKKDWAWIDNRPSKLALNTGKYNIRDGGCMLLSKTRLDNGNCDQVFICICGKRLDKFPH | cell adhesion external side of plasma membrane; plasma membrane carbohydrate binding signaling receptor activity Mus musculus 3D-structure Cell adhesion Disulfide bond Glycoprotein Lectin Membrane Receptor Reference proteome Signal-anchor Transmembrane Transmembrane helix MSEQEVTYSM MSEQEVTYSMVRFHKSAGLQKQVRPEETKGPREAGY... |
G protein-coupled receptor signaling pathway phototransduction regulation of G protein-coupled receptor signaling pathway visual perception | cytosol; nucleus; photoreceptor inner segment; photoreceptor outer segment | phospholipase inhibitor activity | Homo sapiens | Alternative splicing Cell projection Cilium Cytoplasm Nucleus Phosphoprotein Reference proteome Sensory transduction Vision | MEEAKSQSLE | MEEAKSQSLEEDFEGQATHTGPKGVINDWRKFKLESQDSDSIPPSKKEILRQMSSPQSRNGKDSKERVSRKMSIQEYELIHKEKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGKQFLETIEKELKITTIVVHIYEDGIKGCDALNSSLTCLAAEYPIVKFCKIKASNTGAGDRFSLDVLPTLLIYKGGELISNFISVAEQFAEEFFAGDVESFLNEYGLLPEREVHVLEHTKIEEEDVE | G protein-coupled receptor signaling pathway phototransduction regulation of G protein-coupled receptor signaling pathway visual perception cytosol; nucleus; photoreceptor inner segment; photoreceptor outer segment phospholipase inhibitor activity Homo sapiens Alternative splicing Cell projection Cilium Cytoplasm Nucle... |
cell adhesion regulation of lamellipodium morphogenesis wound healing, spreading of cells | apical plasma membrane; cell projection; extracellular region; lamellipodium membrane; microvillus; plasma membrane | hyaluronic acid binding | Cricetulus griseus | Cell adhesion Cell membrane Cell projection Disulfide bond Glycoprotein Membrane Phosphoprotein Proteoglycan Receptor Secreted Signal Transmembrane Transmembrane helix | MDKFWWHAAW | MDKFWWHAAWGLCLLPLSLAHEQIDLNITCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMVMALSKGFETCRYGFIEGHVVIPRIQPNAICAANHTGVYILTSNTSHYDTYCFNASAPLEEDCTSVTDLPNSFEGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNTTDDDVSSGSSSEKSTSGGYVFHTYLPTIHSTADQDDPYFIGSTMATRDQDSSMDPRGNSLTVTDGSKLTEHSSGNQDSGLNSTSRPGGKPRVPEWLIVLASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGKVEDRKPSELN... | cell adhesion regulation of lamellipodium morphogenesis wound healing, spreading of cells apical plasma membrane; cell projection; extracellular region; lamellipodium membrane; microvillus; plasma membrane hyaluronic acid binding Cricetulus griseus Cell adhesion Cell membrane Cell projection Disulfide bond Glycoprotei... |
conidiophore development conidium formation phialide development positive regulation of conidium formation positive regulation of phialide development regulation of DNA-templated transcription regulation of transcription by RNA polymerase II sporulation resulting in formation of a cellular spore | nucleus; transcription regulator complex | DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding | Emericella nidulans | Activator Conidiation DNA-binding Nucleus Reference proteome Sporulation Transcription Transcription regulation | MATDWQPECM | MATDWQPECMVSQNQAALESIGAHSDRALQNTSGNVQAYSDSLAHHDTTGRDDPLQHYTLKYPHPPVPVPSHPLPTATANLYHPQLLSHRYQVKKLRRLQSNGSSYAGSRRGRSYLKSQKYLEYRARPRRDTGKDGEPVWSDELEDAFQQALEANPPMGRRKWSERGKSYGRNELIAEYIYKLTGKRRTRKQVSSHLQVLDSFLKGDPDWERLVREQSDRSTAQTQPVGPRWRTSMDHLPSSHYGTHATSSYPEPMRLMPPYSADLQLPQYSPTSTQQDTNNNTIQGLSFDMWVSAPNKPDRIDDAYHLYTRLQGDQRQP... | conidiophore development conidium formation phialide development positive regulation of conidium formation positive regulation of phialide development regulation of DNA-templated transcription regulation of transcription by RNA polymerase II sporulation resulting in formation of a cellular spore nucleus; transcription ... |
apoptotic process MAPK cascade negative regulation of protein phosphorylation negative regulation of smooth muscle cell migration negative regulation of smooth muscle cell proliferation osteoblast differentiation positive regulation of apoptotic process positive regulation of insulin-like growth factor receptor signali... | extracellular space; insulin-like growth factor ternary complex; nucleus | fibronectin binding insulin-like growth factor I binding insulin-like growth factor II binding protein tyrosine phosphatase activator activity | Bos taurus | Apoptosis Direct protein sequencing Disulfide bond Glycoprotein Growth factor binding Phosphoprotein Reference proteome Secreted Signal | MLRARPALWA | MLRARPALWAAALTALTLLRGPPAARAGAGTMGAGPVVRCEPCDARAVAQCAPPPPSPPCAELVREPGCGCCLTCALREGQPCGVYTERCGSGLRCQPPPGDPRPLQALLDGRGLCANASAVGRLRPYLLPSASGNGSESEEDHSMGSTENQAGPSTHRVPVSKFHPIHTKMDVIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNMLSPRGIHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGFDVKGKGDVHCYSMESK | apoptotic process MAPK cascade negative regulation of protein phosphorylation negative regulation of smooth muscle cell migration negative regulation of smooth muscle cell proliferation osteoblast differentiation positive regulation of apoptotic process positive regulation of insulin-like growth factor receptor signali... |
adaptive immune response alpha-beta T cell activation cell surface receptor signaling pathway Fc-gamma receptor signaling pathway gamma-delta T cell activation positive regulation of protein localization to cell surface protein complex oligomerization protein-containing complex assembly T cell receptor signaling pathwa... | alpha-beta T cell receptor complex; cytoplasm; Fc-gamma receptor III complex; gamma-delta T cell receptor complex; Golgi apparatus; plasma membrane; T cell receptor complex | identical protein binding protein heterodimerization activity protein homodimerization activity protein tyrosine kinase binding transmembrane signaling receptor activity | Homo sapiens | 3D-structure Adaptive immunity Alternative splicing Cell membrane Host-virus interaction Immunity Membrane Phosphoprotein Receptor Reference proteome Repeat Signal Transmembrane Transmembrane helix | MKWKALFTAA | MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR | adaptive immune response alpha-beta T cell activation cell surface receptor signaling pathway Fc-gamma receptor signaling pathway gamma-delta T cell activation positive regulation of protein localization to cell surface protein complex oligomerization protein-containing complex assembly T cell receptor signaling pathwa... |
ribosome biogenesis sporulation resulting in formation of a cellular spore | cytoplasm | GTP binding GTPase activity magnesium ion binding | Bacillus subtilis | 3D-structure Cytoplasm GTP-binding Hydrolase Magnesium Metal-binding Nucleotide-binding Reference proteome Sporulation | MFVDQVKVYV | MFVDQVKVYVKGGDGGNGMVAFRREKYVPKGGPAGGDGGKGGDVVFEVDEGLRTLMDFRYKKHFKAIRGEHGMSKNQHGRNADDMVIKVPPGTVVTDDDTKQVIADLTEHGQRAVIARGGRGGRGNSRFATPANPAPQLSENGEPGKERYIVLELKVLADVGLVGFPSVGKSTLLSVVSSAKPKIADYHFTTLVPNLGMVETDDGRSFVMADLPGLIEGAHQGVGLGHQFLRHIERTRVIVHVIDMSGLEGRDPYDDYLTINQELSEYNLRLTERPQIIVANKMDMPEAAENLEAFKEKLTDDYPVFPISAVTREGLREL... | ribosome biogenesis sporulation resulting in formation of a cellular spore cytoplasm GTP binding GTPase activity magnesium ion binding Bacillus subtilis 3D-structure Cytoplasm GTP-binding Hydrolase Magnesium Metal-binding Nucleotide-binding Reference proteome Sporulation MFVDQVKVYV MFVDQVKVYVKGGDGGNGMVAFRREKYVPKGGPAGGD... |
mRNA processing mRNA stabilization negative regulation of nuclear-transcribed mRNA poly(A) tail shortening positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay positive regulation of nuclear-transcribed mRNA poly(A) tail shortening regulation of translation regulatory ncRNA-m... | cytoplasm | eukaryotic initiation factor 4G binding poly(A) binding protein self-association | Xenopus laevis | Cytoplasm mRNA processing Protein biosynthesis Reference proteome Repeat RNA-binding Translation regulation | MNPSAPSYPM | MNPSAPSYPMASLYVGDLHQDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGDDMNDERLKEMFGKYGPALSVKVMTDDNGKSKGFGFVSFERHEDAQKAVDEMNGKDMNGKSMFVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFLPFGTI... | mRNA processing mRNA stabilization negative regulation of nuclear-transcribed mRNA poly(A) tail shortening positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay positive regulation of nuclear-transcribed mRNA poly(A) tail shortening regulation of translation regulatory ncRNA-m... |
fructose import across plasma membrane phosphoenolpyruvate-dependent sugar phosphotransferase system phosphorylation | plasma membrane; transmembrane transporter complex | carbohydrate:proton symporter activity kinase activity protein-N(PI)-phosphohistidine-fructose phosphotransferase system transporter activity protein-phosphocysteine-D-fructose-phosphotransferase system transporter activity protein-phosphocysteine-sugar phosphotransferase activity | Escherichia coli | Cell inner membrane Cell membrane Direct protein sequencing Kinase Membrane Phosphoprotein Phosphotransferase system Reference proteome Repeat Sugar transport Transferase Transmembrane Transmembrane helix Transport | MKTLLIIDAN | MKTLLIIDANLGQARAYMAKTLLGAAARKAKLEIIDNPNDAEMAIVLGDSIPNDSALNGKNVWLGDISRAVAHPELFLSEAKGHAKPYTAPVAATAPVAASGPKRVVAVTACPTGVAHTFMAAEAIETEAKKRGWWVKVETRGSVGAGNAITPEEVAAADLVIVAADIEVDLAKFAGKPMYRTSTGLALKKTAQELDKAVAEATPYEPAGKAQTATTESKKESAGAYRHLLTGVSYMLPMVVAGGLCIALSFAFGIEAFKEPGTLAAALMQIGGGSAFALMVPVLAGYIAFSIADRPGLTPGLIGGMLAVSTGSGFIGGI... | fructose import across plasma membrane phosphoenolpyruvate-dependent sugar phosphotransferase system phosphorylation plasma membrane; transmembrane transporter complex carbohydrate:proton symporter activity kinase activity protein-N(PI)-phosphohistidine-fructose phosphotransferase system transporter activity protein-ph... |
2-oxoglutarate metabolic process tricarboxylic acid cycle | mitochondrial alpha-ketoglutarate dehydrogenase complex; mitochondrial nucleoid; mitochondrial oxoglutarate dehydrogenase complex; mitochondrion; oxoglutarate dehydrogenase complex | oxoglutarate dehydrogenase (succinyl-transferring) activity thiamine pyrophosphate binding | Saccharomyces cerevisiae | Mitochondrion Mitochondrion nucleoid Oxidoreductase Reference proteome Thiamine pyrophosphate Transit peptide Tricarboxylic acid cycle | MLRFVSSQTC | MLRFVSSQTCRYSSRGLLKTSLLKNASTVKIVGRGLATTGTDNFLSTSNATYIDEMYQAWQKDPSSVHVSWDAYFKNMSNPKIPATKAFQAPPSISNFPQGTEAAPLGTAMTGSVDENVSIHLKVQLLCRAYQVRGHLKAHIDPLGISFGSNKNNPVPPELTLDYYGFSKHDLDKEINLGPGILPRFARDGKSKMSLKEIVDHLEKLYCSSYGVQYTHIPSKQKCDWLRERIEIPEPYQYTVDQKRQILDRLTWATSFESFLSTKFPNDKRFGLEGLESVVPGIKTLVDRSVELGVEDIVLGMAHRGRLNVLSNVVRKPN... | 2-oxoglutarate metabolic process tricarboxylic acid cycle mitochondrial alpha-ketoglutarate dehydrogenase complex; mitochondrial nucleoid; mitochondrial oxoglutarate dehydrogenase complex; mitochondrion; oxoglutarate dehydrogenase complex oxoglutarate dehydrogenase (succinyl-transferring) activity thiamine pyrophosphat... |
NAD catabolic process | plasma membrane; side of membrane | hydrolase activity, acting on glycosyl bonds NAD glycohydrolase activity NAD+ ADP-ribosyltransferase activity NAD+-protein-arginine ADP-ribosyltransferase activity nucleotidyltransferase activity | Rattus norvegicus | 3D-structure ADP-ribosylation Cell membrane Direct protein sequencing Disulfide bond Glycoprotein Glycosyltransferase GPI-anchor Hydrolase Lipoprotein Membrane NAD NADP Nucleotidyltransferase Reference proteome Signal Transferase | MPSNICKFFL | MPSNICKFFLTWWLIQQVTGLTGPLMLDTAPNAFDDQYEGCVNKMEEKAPLLLQEDFNMNAKLKVAWEEAKKRWNNIKPSRSYPKGFNDFHGTALVAYTGSIAVDFNRAVREFKENPGQFHYKAFHYYLTRALQLLSNGDCHSVYRGTKTRFHYTGAGSVRFGQFTSSSLSKKVAQSQEFFSDHGTLFIIKTCLGVYIKEFSFRPDQEEVLIPGYEVYQKVRTQGYNEIFLDSPKRKKSNYNCLYSSAGARESCVSLFLVVLPSLLVQLLCLAEP | NAD catabolic process plasma membrane; side of membrane hydrolase activity, acting on glycosyl bonds NAD glycohydrolase activity NAD+ ADP-ribosyltransferase activity NAD+-protein-arginine ADP-ribosyltransferase activity nucleotidyltransferase activity Rattus norvegicus 3D-structure ADP-ribosylation Cell membrane Direct... |
actin filament organization muscle contraction | actin cytoskeleton; actin filament; cleavage furrow; cortical cytoskeleton; cytoplasm; cytosol; growth cone; neuron projection; podosome; stress fiber | actin filament binding | Mus musculus | Acetylation Actin-binding Alternative splicing Coiled coil Cytoplasm Cytoskeleton Muscle protein Phosphoprotein Reference proteome | MMEAIKKKMQ | MMEAIKKKMQMLKLDKENVLDRAEQAEAEQKQAEERSKQLEDELATMQKKLKGTEDELDKYSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISDELDHALNDMTSI | actin filament organization muscle contraction actin cytoskeleton; actin filament; cleavage furrow; cortical cytoskeleton; cytoplasm; cytosol; growth cone; neuron projection; podosome; stress fiber actin filament binding Mus musculus Acetylation Actin-binding Alternative splicing Coiled coil Cytoplasm Cytoskeleton Musc... |
5-phosphoribose 1-diphosphate biosynthetic process male gonad development phosphorylation purine nucleotide biosynthetic process ribonucleoside monophosphate biosynthetic process | cytoplasm; ribose phosphate diphosphokinase complex | ATP binding kinase activity magnesium ion binding protein homodimerization activity ribose phosphate diphosphokinase activity | Homo sapiens | ATP-binding Direct protein sequencing Kinase Magnesium Metal-binding Nucleotide biosynthesis Nucleotide-binding Reference proteome Transferase | MPNIKIFSGS | MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIDESVRGEDVYIVQSGCGEINDSLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRSPISAKLVANMLSIAGADHIITMDLHASQIQGFFDIPVDNLYAEPTVLKWIRENIPEWKNCIIVSPDAGGAKRVTSIADQLNVDFALIHKERKKANEVDCIVLVGDVNDRVAILVDDMADTCVTICLAADKLLSAGATRVYAILTHGIFSGPAISRINTACFEAVVVTNTIPQDEKMKHCSKIRVIDISMILAEAIRRTHNGESVSYLFSHVPL | 5-phosphoribose 1-diphosphate biosynthetic process male gonad development phosphorylation purine nucleotide biosynthetic process ribonucleoside monophosphate biosynthetic process cytoplasm; ribose phosphate diphosphokinase complex ATP binding kinase activity magnesium ion binding protein homodimerization activity ribos... |
apoptotic process mitotic cell cycle protein phosphorylation regulation of apoptotic process regulation of cell cycle regulation of cell growth regulation of centrosome cycle regulation of DNA-templated transcription regulation of mitotic cell cycle regulation of mRNA processing regulation of RNA splicing | cyclin-dependent protein kinase holoenzyme complex; cytoplasm; nucleus | ATP binding cyclin-dependent protein serine/threonine kinase activity protein kinase activity protein serine kinase activity protein serine/threonine kinase activity RNA binding | Homo sapiens | 3D-structure Alternative initiation Alternative splicing Apoptosis ATP-binding Cell cycle Cytoplasm Isopeptide bond Kinase Nucleotide-binding Nucleus Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase Ubl conjugation | MGDEKDSWKV | MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASHWSRSPPRPPRERFELGDGRKPGEARPAPAQKPAQLKEEKMEERDLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEEEEEEGSTS... | apoptotic process mitotic cell cycle protein phosphorylation regulation of apoptotic process regulation of cell cycle regulation of cell growth regulation of centrosome cycle regulation of DNA-templated transcription regulation of mitotic cell cycle regulation of mRNA processing regulation of RNA splicing cyclin-depend... |
female pregnancy immune response negative regulation of lipid catabolic process post-transcriptional gene silencing proteolysis | cytoplasm; extracellular region; extracellular space; plasma membrane | growth factor activity lyase activity manganese ion binding polysaccharide binding RNA binding RNA endonuclease activity scavenger receptor activity serine-type peptidase activity | Homo sapiens | Alternative splicing Direct protein sequencing Disulfide bond Endonuclease Hydrolase Lyase Manganese Metal-binding Nuclease Reference proteome Repeat RNA-binding Secreted Signal | MRACISLVLA | MRACISLVLAVLCGLAWAGKIESCASRCNEKFNRDAACQCDRRCLWHGNCCEDYEHLCTEDHKESEPLPQLEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQEFGNCCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVMKELYSFLHHQNRYGSEQEFVDDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTGFHNWIRFYLEEKEGLVDYYSHI... | female pregnancy immune response negative regulation of lipid catabolic process post-transcriptional gene silencing proteolysis cytoplasm; extracellular region; extracellular space; plasma membrane growth factor activity lyase activity manganese ion binding polysaccharide binding RNA binding RNA endonuclease activity s... |
cell division chromosome organization chromosome segregation DNA damage response meiotic nuclear division negative regulation of mitotic sister chromatid separation | cytoplasm; meiotic spindle; nucleus; separase-securin complex | endopeptidase inhibitor activity | Schizosaccharomyces pombe | Cell cycle Cell division Chromosome partition Cytoplasm Mitosis Nucleus Reference proteome Repeat Ubl conjugation | MLPRTMFSYG | MLPRTMFSYGKENAFPVTPISNRNGTKGAGSKRAPLGSTKQSNAPSSVTVPRTVLGGKSTNISKFISAPSTKKMSPMDISMDSPTILEPNSQGISRSAVQERSKRLSASPRRSSLTDTPLPNELEEDIEYMPPPVHLDPIQSLGFDDVAIDCETLDPWPSMQNKATSVTIRNTPASDFHVYKEFSDDDPIQFPLLSVDGDSPLTEKDTNLTTPATLKASDQQRKVLEKPSVSKQSSSRTRLSTVYRTKLASGKSIPRPLSHKLTRPRVTASGNSRRRPLSRSIHSLSSSRIDFSSLDTGLL | cell division chromosome organization chromosome segregation DNA damage response meiotic nuclear division negative regulation of mitotic sister chromatid separation cytoplasm; meiotic spindle; nucleus; separase-securin complex endopeptidase inhibitor activity Schizosaccharomyces pombe Cell cycle Cell division Chromoso... |
phosphorylation positive regulation of oocyte maturation protein kinase A signaling | cAMP-dependent protein kinase complex; cytosol; nucleus | AMP-activated protein kinase activity ATP binding cAMP-dependent protein kinase activity protein serine kinase activity | Caenorhabditis elegans | Alternative splicing ATP-binding cAMP Kinase Lipoprotein Myristate Nucleotide-binding Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase | MPTRLDIVGN | MPTRLDIVGNLQFSSSTDNGDEDQEADVTACFVLPSPSSFSKLSILDDPVEDFKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYG... | phosphorylation positive regulation of oocyte maturation protein kinase A signaling cAMP-dependent protein kinase complex; cytosol; nucleus AMP-activated protein kinase activity ATP binding cAMP-dependent protein kinase activity protein serine kinase activity Caenorhabditis elegansAlternative splicing ATP-binding cAMP ... |
apical protein localization apoptotic process cell differentiation central nervous system development central nervous system myelination membrane raft polarization myelination positive regulation of extrinsic apoptotic signaling pathway via death domain receptors protein insertion into plasma membrane protein localizat... | apical plasma membrane; endoplasmic reticulum; hinge region between urothelial plaques of apical plasma membrane; membrane raft; plasma membrane raft; Schmidt-Lanterman incisure | lipid binding peptidase activator activity involved in apoptotic process structural constituent of myelin sheath | Homo sapiens | Alternative splicing Lipoprotein Membrane Reference proteome Transmembrane Transmembrane helix | MAPAAATGGS | MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS | apical protein localization apoptotic process cell differentiation central nervous system development central nervous system myelination membrane raft polarization myelination positive regulation of extrinsic apoptotic signaling pathway via death domain receptors protein insertion into plasma membrane protein localizat... |
cardiac muscle contraction desensitization of G protein-coupled receptor signaling pathway G protein-coupled acetylcholine receptor signaling pathway G protein-coupled receptor internalization G protein-coupled receptor signaling pathway heart development intracellular protein transport negative regulation of relaxatio... | cell projection; cytoplasm; cytosol; membrane; plasma membrane; postsynapse; presynapse | alpha-2A adrenergic receptor binding ATP binding beta-adrenergic receptor kinase activity Edg-2 lysophosphatidic acid receptor binding G protein-coupled receptor binding G protein-coupled receptor kinase activity protein kinase activity | Bos taurus | 3D-structure ATP-binding Cell membrane Cell projection Cytoplasm Direct protein sequencing Kinase Membrane Nucleotide-binding Phosphoprotein Reference proteome Serine/threonine-protein kinase Synapse Transferase | MADLEAVLAD | MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFSQKLGYLLFRDFCLKHLEEAKPLVEFYEEIKKYEKLETEEERLVCSREIFDTYIMKELLACSHPFSKSAIEHVQGHLVKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAEIILGLEHMHNRFVVYRDLKP... | cardiac muscle contraction desensitization of G protein-coupled receptor signaling pathway G protein-coupled acetylcholine receptor signaling pathway G protein-coupled receptor internalization G protein-coupled receptor signaling pathway heart development intracellular protein transport negative regulation of relaxatio... |
mitochondrion inheritance unsaturated fatty acid biosynthetic process | endoplasmic reticulum; endoplasmic reticulum membrane | electron transfer activity heme binding iron ion binding stearoyl-CoA 9-desaturase activity | Saccharomyces cerevisiae | Electron transport Endoplasmic reticulum Fatty acid biosynthesis Fatty acid metabolism Heme Iron Lipid biosynthesis Lipid metabolism Membrane Metal-binding Oxidoreductase Reference proteome Transmembrane Transmembrane helix Transport | MPTSGTTIEL | MPTSGTTIELIDDQFPKDDSASSGIVDEVDLTEANILATGLNKKAPRIVNGFGSLMGSKEMVSVEFDKKGNEKKSNLDRLLEKDNQEKEEAKTKIHISEQPWTLNNWHQHLNWLNMVLVCGMPMIGWYFALSGKVPLHLNVFLFSVFYYAVGGVSITAGYHRLWSHRSYSAHWPLRLFYAIFGCASVEGSAKWWGHSHRIHHRYTDTLRDPYDARRGLWYSHMGWMLLKPNPKYKARADITDMTDDWTIRFQHRHYILLMLLTAFVIPTLICGYFFNDYMGGLIYAGFIRVFVIQQATFCINSLAHYIGTQPFDDRRTPR... | mitochondrion inheritance unsaturated fatty acid biosynthetic process endoplasmic reticulum; endoplasmic reticulum membrane electron transfer activity heme binding iron ion binding stearoyl-CoA 9-desaturase activity Saccharomyces cerevisiae Electron transport Endoplasmic reticulum Fatty acid biosynthesis Fatty acid me... |
fatty acid beta-oxidation fatty acid catabolic process phenylacetate catabolic process | cytoplasm; fatty acid beta-oxidation multienzyme complex | acetyl-CoA C-acyltransferase activity | Escherichia coli | Acyltransferase Cytoplasm Direct protein sequencing Fatty acid metabolism Lipid degradation Lipid metabolism Reference proteome Transferase | MEQVVIVDAI | MEQVVIVDAIRTPMGRSKGGAFRNVRAEDLSAHLMRSLLARNPALEAAALDDIYWGCVQQTLEQGFNIARNAALLAEVPHSVPAVTVNRLCGSSMQALHDAARMIMTGDAQACLVGGVEHMGHVPMSHGVDFHPGLSRNVAKAAGMMGLTAEMLARMHGISREMQDAFAARSHARAWAATQSAAFKNEIIPTGGHDADGVLKQFNYDEVIRPETTVEALATLRPAFDPVNGMVTAGTSSALSDGAAAMLVMSESRAHELGLKPRARVRSMAVVGCDPSIMGYGPVPASKLALKKAGLSASDIGVFEMNEAFAAQILPCIK... | fatty acid beta-oxidation fatty acid catabolic process phenylacetate catabolic process cytoplasm; fatty acid beta-oxidation multienzyme complex acetyl-CoA C-acyltransferase activity Escherichia coli Acyltransferase Cytoplasm Direct protein sequencing Fatty acid metabolism Lipid degradation Lipid metabolism Reference pr... |
hydrogen sulfide biosynthetic process response to oxidative stress sulfate assimilation sulfate reduction sulfur compound metabolic process | sulfate adenylyltransferase complex (ATP) | ATP binding sulfate adenylyltransferase (ATP) activity | Escherichia coli | ATP-binding Direct protein sequencing Nucleotide-binding Nucleotidyltransferase Reference proteome Transferase | MDQIRLTHLR | MDQIRLTHLRQLEAESIHIIREVAAEFSNPVMLYSIGKDSSVMLHLARKAFYPGTLPFPLLHVDTGWKFREMYEFRDRTAKAYGCELLVHKNPEGVAMGINPFVHGSAKHTDIMKTEGLKQALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQRPELWHNYNGQINKGESIRVFPLSNWTEQDIWQYIWLENIDIVPLYLAAERPVLERDGMLMMIDDNRIDLQPGEVIKKRMVRFRTLGCWPLTGAVESNAQTLPEIIEEMLVSTTSERQGRVIDRDQAGSMELKKRQGYF | hydrogen sulfide biosynthetic process response to oxidative stress sulfate assimilation sulfate reduction sulfur compound metabolic process sulfate adenylyltransferase complex (ATP) ATP binding sulfate adenylyltransferase (ATP) activity Escherichia coli ATP-binding Direct protein sequencing Nucleotide-binding Nucleotid... |
peptide catabolic process proteolysis | cytosol | aminopeptidase activity dipeptidase activity manganese ion binding metallodipeptidase activity phosphoric triester hydrolase activity proline dipeptidase activity protein homodimerization activity | Escherichia coli | 3D-structure Dipeptidase Direct protein sequencing Hydrolase Manganese Metal-binding Metalloprotease Protease Reference proteome | MESLASLYKN | MESLASLYKNHIATLQERTRDALARFKLDALLIHSGELFNVFLDDHPYPFKVNPQFKAWVPVTQVPNCWLLVDGVNKPKLWFYLPVDYWHNVEPLPTSFWTEDVEVIALPKADGIGSLLPAARGNIGYIGPVPERALQLGIEASNINPKGVIDYLHYYRSFKTEYELACMREAQKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTDVPYSNIVALNEHAAVLHYTKLDHQAPEEMRSFLLDAGAEYNGYAADLTRTWSAKSDNDYAQLVKDVNDEQLALIATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSE... | peptide catabolic process proteolysis cytosol aminopeptidase activity dipeptidase activity manganese ion binding metallodipeptidase activity phosphoric triester hydrolase activity proline dipeptidase activity protein homodimerization activity Escherichia coli 3D-structure Dipeptidase Direct protein sequencing Hydrolase... |
arginine catabolic process protein homotetramerization putrescine biosynthetic process putrescine biosynthetic process from arginine spermidine biosynthetic process | periplasmic space | arginine decarboxylase activity identical protein binding magnesium ion binding pyridoxal phosphate binding | Escherichia coli | 3D-structure Decarboxylase Lyase Magnesium Metal-binding Periplasm Polyamine biosynthesis Putrescine biosynthesis Pyridoxal phosphate Reference proteome Spermidine biosynthesis | MSDDMSMGLP | MSDDMSMGLPSSAGEHGVLRSMQEVAMSSQEASKMLRTYNIAWWGNNYYDVNELGHISVCPDPDVPEARVDLAQLVKTREAQGQRLPALFCFPQILQHRLRSINAAFKRARESYGYNGDYFLVYPIKVNQHRRVIESLIHSGEPLGLEAGSKAELMAVLAHAGMTRSVIVCNGYKDREYIRLALIGEKMGHKVYLVIEKMSEIAIVLDEAERLNVVPRLGVRARLASQGSGKWQSSGGEKSKFGLAATQVLQLVETLREAGRLDSLQLLHFHLGSQMANIRDIATGVRESARFYVELHKLGVNIQCFDVGGGLGVDYEGT... | arginine catabolic process protein homotetramerization putrescine biosynthetic process putrescine biosynthetic process from arginine spermidine biosynthetic process periplasmic space arginine decarboxylase activity identical protein binding magnesium ion binding pyridoxal phosphate binding Escherichia coli 3D-structure... |
proteolysis | cell surface; extracellular region | cysteine-type peptidase activity | Listeria monocytogenes serovar 1/2a | Direct protein sequencing Hydrolase Protease Reference proteome Repeat Secreted Signal Thiol protease | MNMKKATIAA | MNMKKATIAATAGIAVTAFAAPTIASASTVVVEAGDTLWGIAQSKGTTVDAIKKANNLTTDKIVPGQKLQVNNEVAAAEKTEKSVSATWLNVRSGAGVDNSIITSIKGGTKVTVETTESNGWHKITYNDGKTGFVNGKYLTDKAVSTPVAPTQEVKKETTTQQAAPAAETKTEVKQTTQATTPAPKVAETKETPVVDQNATTHAVKSGDTIWALSVKYGVSVQDIMSWNNLSSSSIYVGQKLAIKQTANTATPKAEVKTEAPAAEKQAAPVVKENTNTNTATTEKKETATQQQTAPKAPTEAAKPAPAPSTNTNANKTNT... | proteolysis cell surface; extracellular region cysteine-type peptidase activity Listeria monocytogenes serovar 1/2a Direct protein sequencing Hydrolase Protease Reference proteome Repeat Secreted Signal Thiol protease MNMKKATIAA MNMKKATIAATAGIAVTAFAAPTIASASTVVVEAGDTLWGIAQSKGTTVDAIKKANNLTTDKIVPGQKLQVNNEVAAAEKTEKSVSATWLN... |
fatty acid beta-oxidation | fatty acid beta-oxidation multienzyme complex | 3-hydroxyacyl-CoA dehydrogenase activity 3-hydroxybutyryl-CoA epimerase activity delta(3)-delta(2)-enoyl-CoA isomerase activity enoyl-CoA hydratase activity long-chain-3-hydroxyacyl-CoA dehydrogenase activity NAD+ binding | Escherichia coli | 3D-structure Direct protein sequencing Fatty acid metabolism Isomerase Lipid degradation Lipid metabolism Lyase Multifunctional enzyme NAD Oxidoreductase Reference proteome | MLYKGDTLYL | MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSNKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAKAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMVAQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVKGKAKKLTKDVETPKQAAVLG... | fatty acid beta-oxidation fatty acid beta-oxidation multienzyme complex 3-hydroxyacyl-CoA dehydrogenase activity 3-hydroxybutyryl-CoA epimerase activity delta(3)-delta(2)-enoyl-CoA isomerase activity enoyl-CoA hydratase activity long-chain-3-hydroxyacyl-CoA dehydrogenase activity NAD+ binding Escherichia coli 3D-struct... |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.