Biological Process
stringlengths
7
1.01k
Cellular Component
stringlengths
6
867
Molecular Function
stringlengths
11
871
Organism
stringlengths
8
73
Keywords
stringlengths
1
810
Sequence 10
stringlengths
5
10
Sequence
stringlengths
5
1.02k
Combined
stringlengths
136
3.91k
DNA damage response hydrogen peroxide catabolic process hyperosmotic response response to oxidative stress
cytoplasm; cytosol
catalase activity heme binding identical protein binding iron ion binding
Escherichia coli
3D-structure Cytoplasm Direct protein sequencing Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase Reference proteome
MSQHNEKNPH
MSQHNEKNPHQHQSPLHDSSEAKPGMDSLAPEDGSHRPAAEPTPPGAQPTAPGSLKAPDTRNEKLNSLEDVRKGSENYALTTNQGVRIADDQNSLRAGSRGPTLLEDFILREKITHFDHERIPERIVHARGSAAHGYFQPYKSLSDITKADFLSDPNKITPVFVRFSTVQGGAGSADTVRDIRGFATKFYTEEGIFDLVGNNTPIFFIQDAHKFPDFVHAVKPEPHWAIPQGQSAHDTFWDYVSLQPETLHNVMWAMSDRGIPRSYRTMEGFGIHTFRLINAEGKATFVRFHWKPLAGKASLVWDEAQKLTGRDPDFHRR...
DNA damage response hydrogen peroxide catabolic process hyperosmotic response response to oxidative stress cytoplasm; cytosol catalase activity heme binding identical protein binding iron ion binding Escherichia coli 3D-structure Cytoplasm Direct protein sequencing Heme Hydrogen peroxide Iron Metal-binding Oxidoreducta...
complement activation complement activation, classical pathway innate immune response positive regulation of apoptotic cell clearance proteolysis response to bacterium response to lipopolysaccharide response to nutrient response to thyroid hormone
classical-complement-pathway C3/C5 convertase complex; extracellular space
metal ion binding serine-type endopeptidase activity
Mus musculus
Alternative splicing Complement pathway Disulfide bond Glycoprotein Hydrolase Immunity Innate immunity Metal-binding Protease Reference proteome Repeat Secreted Serine protease Signal Sushi
MAPLLALFYL
MAPLLALFYLLQLGPGLAALFCNQNVNITGGNFTLSHGWAPGSLLIYSCPLGRYPSPAWRKCQSNGQWLTPRSSSHHTLRSSRMVKAVCKPVRCLAPSSFENGIYFPRLVSYPVGSNVSFECEQDFTLRGSPVRYCRPNGLWDGETAVCDNGASHCPNPGISVGTARTGLNFDLGDKVRYRCSSSNMVLTGSAERECQSNGVWSGSEPICRQPYSYDFPEDVASALDTSLTNLLGATNPTQNLLTKSLGRKIIIQRSGHLNLYLLLDASQSVTEKDFDIFKKSAELMVERIFSFEVNVSVAIITFASQPKTIMSILSERS...
complement activation complement activation, classical pathway innate immune response positive regulation of apoptotic cell clearance proteolysis response to bacterium response to lipopolysaccharide response to nutrient response to thyroid hormone classical-complement-pathway C3/C5 convertase complex; extracellular spa...
pantothenate biosynthetic process spermidine biosynthetic process spermine biosynthetic process
cytoplasm; cytosol; nucleus
adenosylmethionine decarboxylase activity
Saccharomyces cerevisiae
Autocatalytic cleavage Decarboxylase Direct protein sequencing Lyase Polyamine biosynthesis Pyruvate Reference proteome S-adenosyl-L-methionine Schiff base Spermidine biosynthesis Zymogen
MTVTIKELTN
MTVTIKELTNHNYIDHELSATLDSTDAFEGPEKLLEIWFFPHKKSITTEKTLRNIGMDRWIEILKLVKCEVLSMKKTKELDAFLLSESSLFVFDHKLTMKTCGTTTTLFCLEKLFQIVEQELSWAFRTTQGGKYKPFKVFYSRRCFLFPCKQAAIHQNWADEVDYLNKFFDNGKSYSVGRNDKSNHWNLYVTETDRSTPKGKEYIEDDDETFEVLMTELDPECASKFVCGPEASTTALVEPNEDKGHNLGYQMTKNTRLDEIYVNSAQDSDLSFHHDAFAFTPCGYSSNMILAEKYYYTLHVTPEKGWSYASFESNIPVF...
pantothenate biosynthetic process spermidine biosynthetic process spermine biosynthetic process cytoplasm; cytosol; nucleus adenosylmethionine decarboxylase activity Saccharomyces cerevisiae Autocatalytic cleavage Decarboxylase Direct protein sequencing Lyase Polyamine biosynthesis Pyruvate Reference proteome S-adenos...
cellular response to organic substance cytokine-mediated signaling pathway inflammatory response to antigenic stimulus interleukin-5-mediated signaling pathway regulation of interleukin-5 production
external side of plasma membrane; plasma membrane; receptor complex
cytokine binding cytokine receptor activity interleukin-5 receptor activity
Mus musculus
Disulfide bond Glycoprotein Membrane Receptor Reference proteome Repeat Signal Transmembrane Transmembrane helix
MVPVLLILVG
MVPVLLILVGALATLQADLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWG...
cellular response to organic substance cytokine-mediated signaling pathway inflammatory response to antigenic stimulus interleukin-5-mediated signaling pathway regulation of interleukin-5 production external side of plasma membrane; plasma membrane; receptor complex cytokine binding cytokine receptor activity interleuk...
chemical synaptic transmission dorsal/ventral pattern formation male meiosis cytokinesis male meiotic nuclear division mRNA splicing, via spliceosome oocyte development oogenesis positive regulation of translation regulation of compound eye photoreceptor development spermatid nucleus differentiation spermatogenesis
catalytic step 2 spliceosome; cytoplasm; cytoplasmic stress granule; cytosol; nucleus; precatalytic spliceosome; ribonucleoprotein complex; synapse
mRNA 3'-UTR binding mRNA binding poly(A) binding poly(U) RNA binding
Drosophila melanogaster
3D-structure Reference proteome Repeat RNA-binding
MASLYVGDLP
MASLYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDTMNFDLVRNKPIRIMWSQRDPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDEKGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEELKQKRHESVFGVNLYVKNLDDTIDDDRLRIAFSPYGNITSAKVMT...
chemical synaptic transmission dorsal/ventral pattern formation male meiosis cytokinesis male meiotic nuclear division mRNA splicing, via spliceosome oocyte development oogenesis positive regulation of translation regulation of compound eye photoreceptor development spermatid nucleus differentiation spermatogenesis cat...
meiotic cell cycle positive regulation of transcription by RNA polymerase II pseudohyphal growth regulation of meiotic nuclear division regulation of sporulation resulting in formation of a cellular spore regulation of transcription by RNA polymerase II sporulation resulting in formation of a cellular spore
nucleus; transcription regulator complex
transcription factor binding
Saccharomyces cerevisiae
Activator Meiosis Nucleus Reference proteome Repressor Sporulation Transcription Transcription regulation
MQADMHGKLH
MQADMHGKLHAALEDGFFLFPFEQQQQPNIYYDTTTDQEDRPCFSFGSTISPRSWHFEKSDKIASSQLQNLVHTQPIHLINPQILFNEEFLNLENIDSQPISKETKTTKDCTMATGPERGKKSSESTRSSSLSSLFSNDESASTFHSSFNNHDNFQKSNRNGDDIDISDTIKYETNTNAQKDIKIFQENFEFNEFPYTQDFYPYTTNYTYSKPTNIHESINSKNTDSYSQYQDQFPPHTDNIHSFNNRHYSNHKSTNCNYYNNTSNNNNASDNVYEADPFIDEPQVPSYYYPLEIAFDVEKSPPPSLQKLNSKELEFLKK...
meiotic cell cycle positive regulation of transcription by RNA polymerase II pseudohyphal growth regulation of meiotic nuclear division regulation of sporulation resulting in formation of a cellular spore regulation of transcription by RNA polymerase II sporulation resulting in formation of a cellular spore nucleus; tr...
negative regulation of transcription by RNA polymerase II positive regulation of antisense RNA transcription positive regulation of septum digestion after cytokinesis positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II
cytoplasm; cytosol; nucleus
cis-regulatory region sequence-specific DNA binding DNA-binding transcription factor activity, RNA polymerase II-specific metal ion binding RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific DNA binding
Saccharomyces cerevisiae
Activator DNA-binding Metal-binding Nucleus Phosphoprotein Reference proteome Repeat Transcription Transcription regulation Zinc Zinc-finger
MDNVVDPWYI
MDNVVDPWYINPSGFAKDTQDEEYVQHHDNVNPTIPPPDNYILNNENDDGLDNLLGMDYYNIDDLLTQELRDLDIPLVPSPKTGDGSSDKKNIDRTWNLGDENNKVSHYSKKSMSSHKRGLSGTAIFGFLGHNKTLSISSLQQSILNMSKDPQPMELINELGNHNTVKNNNDDFDHIRENDGENSYLSQVLLKQQEELRIALEKQKEVNEKLEKQLRDNQIQQEKLRKVLEEQEEVAQKLVSGATNSNSKPGSPVILKTPAMQNGRMKDNAIIVTTNSANGGYQFPPPTLISPRMSNTSINGSPSRKYHRQRYPNKSPES...
negative regulation of transcription by RNA polymerase II positive regulation of antisense RNA transcription positive regulation of septum digestion after cytokinesis positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II cytoplasm; cytosol; nucleus cis-regulatory reg...
cell-cell recognition ceramide metabolic process fucosylation macromolecule glycosylation oligosaccharide biosynthetic process oligosaccharide metabolic process positive regulation of cell-cell adhesion protein N-linked glycosylation protein O-linked glycosylation regulation of cell migration regulation of cell populat...
extracellular exosome; Golgi cisterna membrane; Golgi membrane; membrane
3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity alpha-(1->3)-fucosyltransferase activity fucosyltransferase activity
Homo sapiens
Blood group antigen Glycoprotein Glycosyltransferase Golgi apparatus Lipid metabolism Membrane Reference proteome Signal-anchor Transferase Transmembrane Transmembrane helix
MDPLGAAKPQ
MDPLGAAKPQWPWRRCLAALLFQLLVAVCFFSYLRVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLRTWPFHIPVALSRCSEMVPGTADCHITADRKVYPQADMVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPPPNCQHLEALDRYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYF...
cell-cell recognition ceramide metabolic process fucosylation macromolecule glycosylation oligosaccharide biosynthetic process oligosaccharide metabolic process positive regulation of cell-cell adhesion protein N-linked glycosylation protein O-linked glycosylation regulation of cell migration regulation of cell populat...
chlorophyll biosynthetic process photosynthesis response to ethylene
chloroplast; chloroplast envelope; chloroplast outer membrane; chloroplast thylakoid; chloroplast thylakoid membrane; cytosol
mRNA binding protein domain specific binding protochlorophyllide reductase activity
Arabidopsis thaliana
3D-structure Chlorophyll biosynthesis Chloroplast Direct protein sequencing Membrane NADP Oxidoreductase Photosynthesis Plastid Plastid outer membrane Pyrrolidone carboxylic acid Reference proteome Thylakoid Transit peptide
MALQAASLVS
MALQAASLVSSAFSVRKDAKLNASSSSFKDSSLFGASITDQIKSEHGSSSLRFKREQSLRNLAIRAQTAATSSPTVTKSVDGKKTLRKGNVVVTGASSGLGLATAKALAETGKWNVIMACRDFLKAERAAKSVGMPKDSYTVMHLDLASLDSVRQFVDNFRRTETPLDVLVCNAAVYFPTAKEPTYSAEGFELSVATNHLGHFLLARLLLDDLKKSDYPSKRLIIVGSITGNTNTLAGNVPPKANLGDLRGLAGGLNGLNSSAMIDGGDFDGAKAYKDSKVCNMLTMQEFHRRFHEETGVTFASLYPGCIASTGLFREHI...
chlorophyll biosynthetic process photosynthesis response to ethylene chloroplast; chloroplast envelope; chloroplast outer membrane; chloroplast thylakoid; chloroplast thylakoid membrane; cytosol mRNA binding protein domain specific binding protochlorophyllide reductase activity Arabidopsis thaliana 3D-structure Chlorop...
acetaldehyde catabolic process chromatin remodeling ethanol catabolic process positive regulation of transcription by RNA polymerase II threonine catabolic process
nucleus
DNA binding DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific zinc ion binding
Emericella nidulans
3D-structure Activator DNA-binding Metal-binding Nucleus Reference proteome Transcription Transcription regulation Zinc
MADTRRRQNH
MADTRRRQNHSCDPCRKGKRRCDAPENRNEANENGWVSCSNCKRWNKDCTFNWLSSQRSKAKGAAPRARTKKARTATTTSEPSTSAATIPTPESDNHDAPPVINSHDALPSWTQGLLSHPGDLFDFSHSAIPANAEDAANVQSDAPFPWDLAIPGDFSMGQQLEKPLSPLSFQAVLLPPHSPNTDDLIRELEEQTTDPDSVTDTNSVQQVAQDGSLWSDRQSPLLPENSLCMASDSTARRYARSTMTKNLMRIYHDSMENALSCWLTEHNCPYSDQISYLPPKQRAEWGPNWSNRMCIRVCRLDRVSTSLRGRALSAEED...
acetaldehyde catabolic process chromatin remodeling ethanol catabolic process positive regulation of transcription by RNA polymerase II threonine catabolic process nucleus DNA binding DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific zinc ion binding Emerice...
chloroplast organization embryo development ending in seed dormancy protein folding protein refolding protein stabilization
apoplast; chloroplast; chloroplast envelope; chloroplast stroma; cytosolic ribosome; mitochondrion; peroxisome; stromule; thylakoid
ATP binding ATP-dependent protein folding chaperone
Arabidopsis thaliana
ATP-binding Chaperone Chloroplast Nucleotide-binding Phosphoprotein Plastid Reference proteome Transit peptide
MASANALSSA
MASANALSSASVLCSSRQSKLGGGNQQQGQRVSYNKRTIRRFSVRANVKEIAFDQHSRAALQAGIDKLADCVGLTLGPRGRNVVLDEFGSPKVVNDGVTIARAIELPNAMENAGAALIREVASKTNDSAGDGTTTASILAREIIKHGLLSVTSGANPVSLKRGIDKTVQGLIEELQKKARPVKGRDDIRAVASISAGNDDLIGSMIADAIDKVGPDGVLSIESSSSFETTVEVEEGMEIDRGYISPQFVTNPEKLLAEFENARVLITDQKITAIKDIIPILEKTTQLRAPLLIIAEDVTGEALATLVVNKLRGVLNVVAV...
chloroplast organization embryo development ending in seed dormancy protein folding protein refolding protein stabilization apoplast; chloroplast; chloroplast envelope; chloroplast stroma; cytosolic ribosome; mitochondrion; peroxisome; stromule; thylakoid ATP binding ATP-dependent protein folding chaperone Arabidopsis ...
cell death chaperone cofactor-dependent protein refolding protein refolding response to cold systemic acquired resistance
apoplast; chloroplast; chloroplast envelope; chloroplast stroma; cytosolic ribosome; nucleus; stromule
ATP binding ATP-dependent protein folding chaperone mRNA binding protein domain specific binding
Arabidopsis thaliana
ATP-binding Chaperone Chloroplast Direct protein sequencing Nucleotide-binding Phosphoprotein Plastid Reference proteome Transit peptide
MASTFTATSS
MASTFTATSSIGSMVAPNGHKSDKKLISKLSSSSFGRRQSVCPRPRRSSSAIVCAAKELHFNKDGTTIRRLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAREVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGFIAEGVKVVAAGANPVLITRGIEKTAKALVTELKKMSKEVEDSELADVAAVSAGNNDEIGNMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEKMSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNK...
cell death chaperone cofactor-dependent protein refolding protein refolding response to cold systemic acquired resistance apoplast; chloroplast; chloroplast envelope; chloroplast stroma; cytosolic ribosome; nucleus; stromule ATP binding ATP-dependent protein folding chaperone mRNA binding protein domain specific bindin...
proteasomal protein catabolic process proteasomal ubiquitin-independent protein catabolic process proteasome-mediated ubiquitin-dependent protein catabolic process
nucleus; proteasome complex; proteasome core complex, alpha-subunit complex; proteasome storage granule
mRNA binding
Saccharomyces cerevisiae
3D-structure Acetylation Cytoplasm Direct protein sequencing Nucleus Proteasome Reference proteome
MTSIGTGYDL
MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEINGDDDEDEDDSDNVMSSDDENAPVATNANATTDQEGDIHLE
proteasomal protein catabolic process proteasomal ubiquitin-independent protein catabolic process proteasome-mediated ubiquitin-dependent protein catabolic process nucleus; proteasome complex; proteasome core complex, alpha-subunit complex; proteasome storage granule mRNA binding Saccharomyces cerevisiae 3D-structure ...
neuropeptide signaling pathway
extracellular region
hormone activity
Loxodonta africana
Acetylation Amidation Cleavage on pair of basic residues Direct protein sequencing Endorphin Hormone Phosphoprotein Reference proteome Secreted
SYSMEHFRWG
SYSMEHFRWGKPVGKKRRPVKVYPNGAEGESAEAFPLEFXXELARERPEPARGPEGPDEGAATQADLDNGLVAEVEATSAEKKDEGPYKMEHFRWGSPAKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGH
neuropeptide signaling pathway extracellular region hormone activity Loxodonta africana Acetylation Amidation Cleavage on pair of basic residues Direct protein sequencing Endorphin Hormone Phosphoprotein Reference proteome Secreted SYSMEHFRWG SYSMEHFRWGKPVGKKRRPVKVYPNGAEGESAEAFPLEFXXELARERPEPARGPEGPDEGAATQADLDNGLVAEVEA...
cellular detoxification of nitrogen compound establishment of blood-nerve barrier glutathione metabolic process nitrobenzene metabolic process response to estrogen xenobiotic catabolic process
cytoplasm; cytosol; extracellular exosome; intercellular bridge; nucleus; sperm fibrous sheath
enzyme binding glutathione binding glutathione transferase activity identical protein binding protein homodimerization activity
Homo sapiens
3D-structure Cytoplasm Direct protein sequencing Isopeptide bond Reference proteome Transferase Ubl conjugation
MSCESSMVLG
MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
cellular detoxification of nitrogen compound establishment of blood-nerve barrier glutathione metabolic process nitrobenzene metabolic process response to estrogen xenobiotic catabolic process cytoplasm; cytosol; extracellular exosome; intercellular bridge; nucleus; sperm fibrous sheath enzyme binding glutathione bindi...
cell cycle cell division chemotropism maintenance of protein location in nucleus mitotic cell cycle G1 arrest in response to pheromone regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion
Cdc24p-Far1p-Gbetagamma complex; cell cortex; cytoplasm; mating projection tip; nucleus
cyclin-dependent protein serine/threonine kinase inhibitor activity metal ion binding
Saccharomyces cerevisiae
Cell cycle Cell division Metal-binding Phosphoprotein Protein kinase inhibitor Reference proteome Zinc Zinc-finger
MKTPTRVSFE
MKTPTRVSFEKKIHTPPSGDRDAERSPPKKFLRGLSGKVFRKTPEFKKQQMPTFGYIEESQFTPNLGLMMSKRGNIPKPLNLSKPISPPPSLKKTAGSVASGFSKTGQLSALQSPVNITSSNKYNIKATNLTTSLLRESISDSTTMCDTLSDINLTVMDEDYRIDGDSYYEEDSPTFMISLERNIKKCNSQFSPKRYIGEKCLICEESISSTFTGEKVVESTCSHTSHYNCYLMLFETLYFQGKFPECKICGEVSKPKDKDIVPEMVSKLLTGAGAHDDGPSSNMQQQWIDLKTARSFTGEFPQFTPQEQLIRTADISCD...
cell cycle cell division chemotropism maintenance of protein location in nucleus mitotic cell cycle G1 arrest in response to pheromone regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion Cdc24p-Far1p-Gbetagamma complex; cell cortex; cytoplasm; mating projection tip; nucleu...
tRNA 3'-terminal CCA addition
mitochondrial matrix; mitochondrion; nucleus
ATP binding ATP:3'-cytidine-cytidine-tRNA adenylyltransferase activity CCA tRNA nucleotidyltransferase activity CTP:tRNA cytidylyltransferase activity RNA binding
Saccharomyces cerevisiae
Alternative initiation ATP-binding Cytoplasm Direct protein sequencing Mitochondrion Nucleotide-binding Nucleotidyltransferase Nucleus Reference proteome RNA-binding Transferase Transit peptide
MLRSTISLLM
MLRSTISLLMNSAAQKTMTNSNFVLNAPKITLTKVEQNICNLLNDYTDLYNQKYHNKPEPLTLRITGGWVRDKLLGQGSHDLDIAINVMSGEQFATGLNEYLQQHYAKYGAKPHNIHKIDKNPEKSKHLETATTKLFGVEVDFVNLRSEKYTELSRIPKVCFGTPEEDALRRDATLNALFYNIHKGEVEDFTKRGLQDLKDGVLRTPLPAKQTFLDDPLRVLRLIRFASRFNFTIDPEVMAEMGDPQINVAFNSKISRERVGVEMEKILVGPTPLLALQLIQRAHLENVIFFWHNDSSVVKFNEENCQDMDKINHVYNDN...
tRNA 3'-terminal CCA addition mitochondrial matrix; mitochondrion; nucleus ATP binding ATP:3'-cytidine-cytidine-tRNA adenylyltransferase activity CCA tRNA nucleotidyltransferase activity CTP:tRNA cytidylyltransferase activity RNA binding Saccharomyces cerevisiae Alternative initiation ATP-binding Cytoplasm Direct prot...
circadian rhythm response to cadmium ion response to copper ion response to light intensity response to ozone
chloroplast; chloroplast envelope; chloroplast membrane; chloroplast stroma; cytoplasm; cytosol; mitochondrion; plasma membrane; thylakoid
copper ion binding protein domain specific binding superoxide dismutase activity
Arabidopsis thaliana
Acetylation Alternative splicing Cell membrane Chloroplast Iron Membrane Metal-binding Oxidoreductase Plastid Reference proteome Transit peptide
MAASSAVTAN
MAASSAVTANYVLKPPPFALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTELEGKPLEHIIHSTYNNGDLLPAFNNAAQAWNHEFFWESMKPGGGGKPSGELLALLERDFTSYEKFYEEFNAAAATQFGAGWAWLAYSNEKLKVVKTPNAVNPLVLGSFPLLTIDVWEHAYYLDFQNRRPDYIKTFMTNLVSWEAVSARLEAAKAASA
circadian rhythm response to cadmium ion response to copper ion response to light intensity response to ozone chloroplast; chloroplast envelope; chloroplast membrane; chloroplast stroma; cytoplasm; cytosol; mitochondrion; plasma membrane; thylakoid copper ion binding protein domain specific binding superoxide dismutase...
action potential adenylate cyclase-modulating G protein-coupled receptor signaling pathway cellular response to pH cranial skeletal system development developmental pigmentation endothelin receptor signaling pathway G protein-coupled receptor signaling pathway heart development ion channel modulating, G protein-coupled...
cytoplasm; heterotrimeric G-protein complex; plasma membrane; synapse
alkylglycerophosphoethanolamine phosphodiesterase activity enzyme regulator activity G protein activity G protein-coupled receptor binding G-protein beta/gamma-subunit complex binding GTP binding GTPase activity metal ion binding protein-containing complex binding
Mus musculus
Cell membrane Cytoplasm Direct protein sequencing GTP-binding Lipoprotein Magnesium Membrane Metal-binding Nucleotide-binding Palmitate Reference proteome Transducer
MTLESMMACC
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEEDKRGFTKLVYQNIFTAMQAMVRAMETLKILYKYEQNKANALLIREVDVEKVTTFEHQYVNAIKTLWSDPGVQECYDRRREFQLSDSAKYYLTDVDRIATVGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILHSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDS...
action potential adenylate cyclase-modulating G protein-coupled receptor signaling pathway cellular response to pH cranial skeletal system development developmental pigmentation endothelin receptor signaling pathway G protein-coupled receptor signaling pathway heart development ion channel modulating, G protein-coupled...
ATP metabolic process proton transmembrane transport regulation of macroautophagy synaptic vesicle lumen acidification vacuolar acidification
apical plasma membrane; clathrin-coated vesicle membrane; cytosol; extracellular exosome; extrinsic component of synaptic vesicle membrane; intracellular membrane-bounded organelle; lysosomal membrane; melanosome; microvillus; plasma membrane; ruffle; vacuolar proton-transporting V-type ATPase, V1 domain
ATP binding proton transmembrane transporter activity proton-transporting ATPase activity, rotational mechanism
Homo sapiens
3D-structure ATP-binding Cell membrane Cytoplasm Cytoplasmic vesicle Deafness Disease variant Hydrogen ion transport Ion transport Membrane Nucleotide-binding Reference proteome Synapse Transport
MALRAMRGIV
MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGR...
ATP metabolic process proton transmembrane transport regulation of macroautophagy synaptic vesicle lumen acidification vacuolar acidification apical plasma membrane; clathrin-coated vesicle membrane; cytosol; extracellular exosome; extrinsic component of synaptic vesicle membrane; intracellular membrane-bounded organel...
proton transmembrane transport regulation of macroautophagy synaptic vesicle lumen acidification
apical part of cell; clathrin-coated vesicle membrane; cytosol; extracellular exosome; extrinsic component of synaptic vesicle membrane; lysosomal membrane; plasma membrane; proton-transporting two-sector ATPase complex; transmembrane transporter complex; vacuolar proton-transporting V-type ATPase, V1 domain
proton-transporting ATPase activity, rotational mechanism
Homo sapiens
3D-structure Acetylation Cytoplasmic vesicle Direct protein sequencing Hydrogen ion transport Ion transport Membrane Reference proteome Synapse Transport
MTEFWLISAP
MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAML...
proton transmembrane transport regulation of macroautophagy synaptic vesicle lumen acidification apical part of cell; clathrin-coated vesicle membrane; cytosol; extracellular exosome; extrinsic component of synaptic vesicle membrane; lysosomal membrane; plasma membrane; proton-transporting two-sector ATPase complex; tr...
muscle tissue development platelet aggregation sarcomere organization
cytoplasm; extracellular exosome; focal adhesion; nucleus; Z disc
actinin binding RNA binding structural constituent of muscle zinc ion binding
Homo sapiens
Acetylation Isopeptide bond LIM domain Metal-binding Nucleus Phosphoprotein Reference proteome Repeat Ubl conjugation Zinc
MPNWGGGKKC
MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE
muscle tissue development platelet aggregation sarcomere organization cytoplasm; extracellular exosome; focal adhesion; nucleus; Z disc actinin binding RNA binding structural constituent of muscle zinc ion binding Homo sapiens Acetylation Isopeptide bond LIM domain Metal-binding Nucleus Phosphoprotein Reference proteom...
cellular lipid metabolic process
cytosol; extracellular region; lysosome; mitochondrion
alcohol dehydrogenase (NADP+) activity alditol:NADP+ 1-oxidoreductase activity estradiol 17-beta-dehydrogenase activity geranylgeranyl reductase activity indanol dehydrogenase activity NADP-retinol dehydrogenase activity oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor prostaglandi...
Mus musculus
Cytoplasm NADP Oxidoreductase Reference proteome
MATFVELSTK
MATFVELSTKAKMPLVGLGTWKSSPGQVKEAVKAAIDAGYRHIDCAYVYHNENEVGEAIQEKIKENAVKREDLFIVSKLWATFFEKSLVKKAFQNTLSDLKLDYLDLYLVHWPQGFQAGNALLPKDNKGKVLLSKSTFLDAWEAMEELVDQGLVKALGISNFNHFQIERLLNKPGLKHKPVTNQIESHPYLTQEKLIQYCQSKGIAVTAYSPLGSPDRPYAKPEDPVVMEIPKIKEIAAKHKKTVAQVLIRFHVQRNVVVIPKSVTPSRIQENLQVFDFQLSEEDMAAILSFNRNWRACDLLDARTEEDYPFHEEY
cellular lipid metabolic process cytosol; extracellular region; lysosome; mitochondrion alcohol dehydrogenase (NADP+) activity alditol:NADP+ 1-oxidoreductase activity estradiol 17-beta-dehydrogenase activity geranylgeranyl reductase activity indanol dehydrogenase activity NADP-retinol dehydrogenase activity oxidoreduc...
proton motive force-driven ATP synthesis proton motive force-driven mitochondrial ATP synthesis
mitochondrial inner membrane; mitochondrial proton-transporting ATP synthase complex; mitochondrial proton-transporting ATP synthase, central stalk; mitochondrion; proton-transporting ATP synthase complex, catalytic core F(1)
proton-transporting ATP synthase activity, rotational mechanism
Saccharomyces cerevisiae
3D-structure ATP synthesis CF(1) Direct protein sequencing Hydrogen ion transport Ion transport Membrane Mitochondrion Mitochondrion inner membrane Phosphoprotein Reference proteome Transport
MSAWRKAGIS
MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPITK
proton motive force-driven ATP synthesis proton motive force-driven mitochondrial ATP synthesis mitochondrial inner membrane; mitochondrial proton-transporting ATP synthase complex; mitochondrial proton-transporting ATP synthase, central stalk; mitochondrion; proton-transporting ATP synthase complex, catalytic core F(1...
histidine catabolic process to glutamate and formamide histidine catabolic process to glutamate and formate
cytoplasm
histidine ammonia-lyase activity
Pseudomonas putida
3D-structure Cytoplasm Direct protein sequencing Histidine metabolism Lyase
MTELTLKPGT
MTELTLKPGTLTLAQLRAIHAAPVRLQLDASAAPAIDASVACVEQIIAEDRTAYGINTGFGLLASTRIASHDLENLQRSLVLSHAAGIGAPLDDDLVRLIMVLKINSLSRGFSGIRRKVIDALIALVNAEVYPHIPLKGSVGASGDLAPLAHMSLVLLGEGKARYKGQWLSATEALAVAGLEPLTLAAKEGLALLNGTQASTAYALRGLFYAEDLYAAAIACGGLSVEAVLGSRSPFDARIHEARGQRGQIDTAACFRDLLGDSSEVSLSHKNCDKVQDPYSLRCQPQVMGACLTQLRQAAEVLGIEANAVSDNPLVFAA...
histidine catabolic process to glutamate and formamide histidine catabolic process to glutamate and formate cytoplasm histidine ammonia-lyase activity Pseudomonas putida 3D-structure Cytoplasm Direct protein sequencing Histidine metabolism Lyase MTELTLKPGT MTELTLKPGTLTLAQLRAIHAAPVRLQLDASAAPAIDASVACVEQIIAEDRTAYGINTGFGLL...
RNA catabolic process
cytoplasm; outer membrane-bounded periplasmic space
Enterobacter ribonuclease activity ribonuclease T2 activity RNA binding
Escherichia coli
3D-structure Cytoplasm Direct protein sequencing Disulfide bond Endonuclease Hydrolase Lyase Nuclease Periplasm Reference proteome Signal
MKAFWRNAAL
MKAFWRNAALLAVSLLPFSSANALALQAKQYGDFDRYVLALSWQTGFCQSQHDRNRNERDECRLQTETTNKADFLTVHGLWPGLPKSVAARGVDERRWMRFGCATRPIPNLPEARASRMCSSPETGLSLETAAKLSEVMPGAGGRSCLERYEYAKHGACFGFDPDAYFGTMVRLNQEIKESEAGKFLADNYGKTVSRRDFDAAFAKSWGKENVKAVKLTCQGNPAYLTEIQISIKADAINAPLSANSFLPQPHPGNCGKTFVIDKAGY
RNA catabolic process cytoplasm; outer membrane-bounded periplasmic space Enterobacter ribonuclease activity ribonuclease T2 activity RNA binding Escherichia coli 3D-structure Cytoplasm Direct protein sequencing Disulfide bond Endonuclease Hydrolase Lyase Nuclease Periplasm Reference proteome Signal MKAFWRNAAL MKAFWRNA...
pyridine nucleotide salvage
cytosol
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides metal ion binding nicotinamidase activity
Escherichia coli
Hydrolase Metal-binding Pyridine nucleotide biosynthesis Reference proteome Zinc
MPPRALLLVD
MPPRALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIDWCQSRGEAVIASQDWHPANHGSFASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLHQKAIAAVFHKGENPLVDSYSAFFDNGRRQKTSLDDWLRDHEIDELIVMGLATDYCVKFTVLDALQLGYKVNVITDGCRGVNIQPQDSAHAFMEMSAAGATLYTLADWEETQG
pyridine nucleotide salvage cytosol hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides metal ion binding nicotinamidase activity Escherichia coli Hydrolase Metal-binding Pyridine nucleotide biosynthesis Reference proteome Zinc MPPRALLLVD MPPRALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIDWCQSRGE...
mRNA branch site recognition mRNA splicing, via spliceosome
commitment complex; nucleus
ATP binding ATP hydrolysis activity ATP-dependent activity, acting on RNA nucleic acid binding RNA helicase activity
Saccharomyces cerevisiae
3D-structure ATP-binding Coiled coil Helicase Hydrolase mRNA processing mRNA splicing Nucleotide-binding Nucleus Reference proteome
METIDSKQNI
METIDSKQNINRESLLEERRKKLAKWKQKKAQFDAQKEHQTSRNDIVTNSLEGKQTTEKFTERQERVKEELRKRKNEFRKSDEPVSVKPSKKKSKRSKVKKKISFDFSDDDDSEIGVSFRSKEHIQKAPEHDNEKDPLDEFMTSLKEEKMSNSKGMYDRGDILDVEDQLFELGGTDDEDVEDNTDNSNIAKIAKLKAKKRVKQIYYSPEELEPFQKNFYIESETVSSMSEMEVEELRLSLDNIKIKGTGCPKPVTKWSQLGLSTDTMVLITEKLHFGSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKA...
mRNA branch site recognition mRNA splicing, via spliceosome commitment complex; nucleus ATP binding ATP hydrolysis activity ATP-dependent activity, acting on RNA nucleic acid binding RNA helicase activity Saccharomyces cerevisiae 3D-structure ATP-binding Coiled coil Helicase Hydrolase mRNA processing mRNA splicing Nuc...
intracellular iron ion homeostasis NAD metabolic process NADP biosynthetic process phosphorylation
cytoplasm; nucleus
ATP binding NAD+ kinase activity NADH kinase activity
Saccharomyces cerevisiae
ATP-binding Kinase NAD NADP Nucleotide-binding Phosphoprotein Reference proteome Transferase
MKENDMNNGV
MKENDMNNGVDKWVNEEDGRNDHHNNNNNLMKKAMMNNEQIDRTQDIDNAKEMLRKISSESSSRRSSLLNKDSSLVNGNANSGGGTSINGTRGSSKSSNTHFQYASTAYGVRMLSKDISNTKVELDVENLMIVTKLNDVSLYFLTRELVEWVLVHFPRVTVYVDSELKNSKKFAAGELCEDSKCRESRIKYWTKDFIREHDVFFDLVVTLGGDGTVLFVSSIFQRHVPPVMSFSLGSLGFLTNFKFEHFREDLPRIMNHKIKTNLRLRLECTIYRRHRPEVDPNTGKKICVVEKLSTHHILNEVTIDRGPSPFLSMLELY...
intracellular iron ion homeostasis NAD metabolic process NADP biosynthetic process phosphorylation cytoplasm; nucleus ATP binding NAD+ kinase activity NADH kinase activity Saccharomyces cerevisiae ATP-binding Kinase NAD NADP Nucleotide-binding Phosphoprotein Reference proteome Transferase MKENDMNNGV MKENDMNNGVDKWVNEED...
FAD metabolic process protein folding in endoplasmic reticulum
endoplasmic reticulum; mitochondrion
FMN binding fumarate reductase (NADH) activity
Saccharomyces cerevisiae
3D-structure Direct protein sequencing FAD Flavoprotein Mitochondrion NAD Oxidoreductase Reference proteome Transit peptide
MIRSVRRVFI
MIRSVRRVFIYVSIFVLIIVLKRTLSGTDQTSMKQPVVVIGSGLAGLTTSNRLISKYRIPVVLLDKAASIGGNSIKASSGINGAHTDTQQNLKVMDTPELFLKDTLHSAKGRGVPSLMDKLTKESKSAIRWLQTEFDLKLDLLAQLGGHSVPRTHRSSGKLPPGFEIVQALSKKLKDISSKDSNLVQIMLNSEVVDIELDNQGHVTGVVYMDENGNRKIMKSHHVVFCSGGFGYSKEMLKEYSPNLIHLPTTNGKQTTGDGQKILSKLGAELIDMDQVQVHPTGFIDPNDRENNWKFLAAEALRGLGGILLHPTTGRRFT...
FAD metabolic process protein folding in endoplasmic reticulum endoplasmic reticulum; mitochondrion FMN binding fumarate reductase (NADH) activity Saccharomyces cerevisiae 3D-structure Direct protein sequencing FAD Flavoprotein Mitochondrion NAD Oxidoreductase Reference proteome Transit peptide MIRSVRRVFI MIRSVRRVFIYV...
aromatic compound catabolic process
plasma membrane
2 iron, 2 sulfur cluster binding ferredoxin-NAD+ reductase activity metal ion binding
Pseudomonas putida
2Fe-2S Aromatic hydrocarbons catabolism Cell inner membrane Cell membrane Direct protein sequencing FAD Flavoprotein Iron Iron-sulfur Membrane Metal-binding NAD Oxidoreductase Plasmid
MNEFFKKISG
MNEFFKKISGLFVPPPESTVSVRGQGFQFKVPRGQTILESALHQGIAFPHDCKVGSCGTCKYKLISGRVNELTSSAMGLSGDLYQSGYRLGCQCIPKEDLEIELDTVLGQALVPIETSALISKQKRLAHDIVEMEVVPDKQIAFYPGQYADVECAECSAVRSYSFSAPPQPDGSLSFHVRLVPGGVFSGWLFGGDRTGATLTLRAPYGQFGLHESNATMVCVAGGTGLAPIKCVLQSMTQAQRERDVLLFFGARQQRDLYCLDEIEALQLDWGGRFELIPVLSEESSTSSWKGKRGMVTEYFKEYLTGQPYEGYLCGPPP...
aromatic compound catabolic process plasma membrane 2 iron, 2 sulfur cluster binding ferredoxin-NAD+ reductase activity metal ion binding Pseudomonas putida 2Fe-2S Aromatic hydrocarbons catabolism Cell inner membrane Cell membrane Direct protein sequencing FAD Flavoprotein Iron Iron-sulfur Membrane Metal-binding NAD Ox...
catecholamine catabolic process dopamine catabolic process phenylethylamine metabolic process positive regulation of signal transduction serotonin metabolic process
mitochondrial outer membrane; mitochondrion
aliphatic amine oxidase activity flavin adenine dinucleotide binding monoamine oxidase activity phenethylamine:oxygen oxidoreductase (deaminating) activity primary amine oxidase activity serotonin binding
Rattus norvegicus
3D-structure Acetylation Catecholamine metabolism FAD Flavoprotein Membrane Mitochondrion Mitochondrion outer membrane Neurotransmitter degradation Oxidoreductase Phosphoprotein Reference proteome Transmembrane Transmembrane helix
MTDLEKPNLA
MTDLEKPNLAGHMFDVGLIGGGISGLAAAKLLSEYKINVLVLEARDRVGGRTYTVRNEHVKWVDVGGAYVGPTQNRILRLSKELGIETYKVNVNERLVQYVKGKTYPFRGAFPPVWNPLAYLDYNNLWRTMDEMGKEIPVDAPWQARHAQEWDKMTMKDLIDKICWTKTAREFAYLFVNINVTSEPHEVSALWFLWYVRQCGGTARIFSVTNGGQERKFVGGSGQVSEQIMGLLGDKVKLSSPVTYIDQTDDNIIVETLNHEHYECKYVISAIPPILTAKIHFKPELPPERNQLIQRLPMGAVIKCMVYYKEAFWKKKDY...
catecholamine catabolic process dopamine catabolic process phenylethylamine metabolic process positive regulation of signal transduction serotonin metabolic process mitochondrial outer membrane; mitochondrion aliphatic amine oxidase activity flavin adenine dinucleotide binding monoamine oxidase activity phenethylamine:...
biogenic amine metabolic process dopamine catabolic process positive regulation of signal transduction
cytosol; mitochondrial outer membrane; mitochondrion
aliphatic amine oxidase activity flavin adenine dinucleotide binding monoamine oxidase activity phenethylamine:oxygen oxidoreductase (deaminating) activity primary amine oxidase activity
Homo sapiens
3D-structure Acetylation Alternative splicing Catecholamine metabolism Direct protein sequencing Disease variant FAD Flavoprotein Intellectual disability Membrane Mitochondrion Mitochondrion outer membrane Neurotransmitter degradation Oxidoreductase Phosphoprotein Reference proteome Transmembrane Transmembrane helix
MENQEKASIA
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIAYLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFWKKKDY...
biogenic amine metabolic process dopamine catabolic process positive regulation of signal transduction cytosol; mitochondrial outer membrane; mitochondrion aliphatic amine oxidase activity flavin adenine dinucleotide binding monoamine oxidase activity phenethylamine:oxygen oxidoreductase (deaminating) activity primary ...
catecholamine metabolic process
mitochondrial outer membrane; mitochondrion
aliphatic amine oxidase activity flavin adenine dinucleotide binding monoamine oxidase activity phenethylamine:oxygen oxidoreductase (deaminating) activity primary amine oxidase activity
Bos taurus
Acetylation Catecholamine metabolism FAD Flavoprotein Membrane Mitochondrion Mitochondrion outer membrane Neurotransmitter degradation Oxidoreductase Phosphoprotein Reference proteome Transmembrane Transmembrane helix
MESLQKTSDA
MESLQKTSDAGQMFDVVVIGGGISGLSAAKLLAEHEVNVLVLEARERVGGRTYTVRNEHVDYVDVGGAYVGPTQNRILRLSKQLGLETYKVNVNERLVHYVKGKTYPFRGAFPPVWNPIAYLDYNNLWRTMDNMGKEIPADAPWEAPHAVEWDKMTMKDLIEKICWTKTARQFASLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSITNGGQERKFVGGSGQVSERIMQLLGDRVKLRSPVTYVDQSSENITVETLNRELYECRYVISAIPPTLTAKIHFRPELPSERNQLIQRLPMGAVIKCMMYYKEAFWKKKDY...
catecholamine metabolic process mitochondrial outer membrane; mitochondrion aliphatic amine oxidase activity flavin adenine dinucleotide binding monoamine oxidase activity phenethylamine:oxygen oxidoreductase (deaminating) activity primary amine oxidase activity Bos taurus Acetylation Catecholamine metabolism FAD Flavo...
citrate metabolic process intestinal absorption intracellular iron ion homeostasis post-embryonic development regulation of translation response to iron(II) ion tricarboxylic acid cycle
cytoplasm; cytosol; endoplasmic reticulum; extracellular exosome; Golgi apparatus; mitochondrion
3 iron, 4 sulfur cluster binding 4 iron, 4 sulfur cluster binding aconitate hydratase activity iron-responsive element binding metal ion binding RNA binding
Homo sapiens
3D-structure 4Fe-4S Cytoplasm Direct protein sequencing Iron Iron-sulfur Lyase Metal-binding Phosphoprotein Reference proteome RNA-binding Tricarboxylic acid cycle
MSNPFAHLAE
MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSITYL...
citrate metabolic process intestinal absorption intracellular iron ion homeostasis post-embryonic development regulation of translation response to iron(II) ion tricarboxylic acid cycle cytoplasm; cytosol; endoplasmic reticulum; extracellular exosome; Golgi apparatus; mitochondrion 3 iron, 4 sulfur cluster binding 4 ir...
DNA-templated transcription proteolysis viral RNA genome replication
host cell membrane; membrane
nucleotide binding RNA binding RNA-dependent RNA polymerase activity serine-type endopeptidase activity
Southern cowpea mosaic virus )
Covalent protein-RNA linkage Host membrane Hydrolase Membrane Nucleotide-binding Nucleotidyltransferase Protease Reference proteome Ribosomal frameshifting RNA-directed RNA polymerase Serine protease Transferase Transmembrane Transmembrane helix Viral RNA replication
MYRPSCLSYV
MYRPSCLSYVLLVANMWSFAVCANAFIYGSYDPSHNIPIVALMTLCATGLWLSTSVVSFGIRYVRVRVSPEKTQNRTIYVSSGLPHFDPVYGVVKKCEPMGGGPAIELQVNPSWIHLLPTSPAINKVEVGQESAILGSTYSVVETGGEPKSLVAVKSGDSTLGFGARVYHEGMDVLMVPHHVWYNDKPHTALAKNGRSVDTEDWEVEAACADPRIDFVLVKVPTAVWAKLAVRSTKVLAPVHGTAVQTFGGQDSKQLFSGLGKAKALDNAWEFTHTAPTAKGWSGTPLYTRDGIVGMHTGYVDIGTSNRAINMHFIMSCL...
DNA-templated transcription proteolysis viral RNA genome replication host cell membrane; membrane nucleotide binding RNA binding RNA-dependent RNA polymerase activity serine-type endopeptidase activity Southern cowpea mosaic virus )Covalent protein-RNA linkage Host membrane Hydrolase Membrane Nucleotide-binding Nucleo...
nucleotide metabolic process proteolysis viral process
viral nucleocapsid
aspartic-type endopeptidase activity DNA binding dUTP diphosphatase activity structural constituent of virion zinc ion binding
Squirrel monkey retrovirus
Aspartyl protease Capsid protein Direct protein sequencing DNA-binding Hydrolase Lipoprotein Magnesium Myristate Nucleotide metabolism Protease Ribosomal frameshifting Viral matrix protein Viral nucleoprotein Virion
MGQASSHSEN
MGQASSHSENDLFISHLKESLKVRRIRVRKKDLVSFFSFIFKTCPWFPQEGSIDSRVWGRVGDCLNDYYRVFGPETIPITTFNYYNLIRDVLTNQSDSPDIQRLCKEGHKILISHSRPPSRQAPVTITTSEKASSRPPSRAPSTCPSVAIDIGSHDTGQSSLYPNLATLTDPPIQSPHSRAHTPPQHLPLLANSKTLHNSGSQDDQLNPADQADLEEAAAQYNNPDWPQLTNTPALPPFRPPSYVSTAVPPVAVAAPVLHAPTSGVPGSPTAPNLPGVALAKPSGPIDETVSLLDGVKTLVTKLSDLALLPPAGVMAFPV...
nucleotide metabolic process proteolysis viral process viral nucleocapsid aspartic-type endopeptidase activity DNA binding dUTP diphosphatase activity structural constituent of virion zinc ion binding Squirrel monkey retrovirus Aspartyl protease Capsid protein Direct protein sequencing DNA-binding Hydrolase Lipoprotei...
viral budding via host ESCRT complex
host cell late endosome membrane; host cell plasma membrane; host multivesicular body; membrane; viral nucleocapsid
RNA binding structural constituent of virion zinc ion binding
Gibbon ape leukemia virus
Capsid protein Host cell membrane Host cytoplasm Host endosome Host membrane Host-virus interaction Lipoprotein Membrane Metal-binding Myristate Phosphoprotein RNA-binding Viral budding Viral budding via the host ESCRT complexes Viral matrix protein Viral nucleoprotein Viral release from host cell Virion Zinc Zinc-fing...
MGQDNSTPIS
MGQDNSTPISLTLNHWRDVRTRAHNLSVEIKKGKWQTFCSSEWPTFGVGWPPEGTFNLSVIFAVKKIVFQENGGHPDQVPYIVVWQDLAQNPPPWVPASAKVAVVSDTRRPVAGRPSAPPRPPIYPATDDLLLLSEPTPPPYPAALPPPLAPQAIGPPSGQMPDSSDPEGPAAGTRSRRARSPADNSGPDSTVILPLRAIGPPAEPNGLVPLQYWPFSSADLYNWKSNHPSFSENPAGLTGLLESLMFSHQPTWDDCQQLLQILFTTEERERILLEARKNVLGDNGAPTQLENLINEAFPLNRPHWDYNTAAGRERLLVY...
viral budding via host ESCRT complex host cell late endosome membrane; host cell plasma membrane; host multivesicular body; membrane; viral nucleocapsid RNA binding structural constituent of virion zinc ion binding Gibbon ape leukemia virus Capsid protein Host cell membrane Host cytoplasm Host endosome Host membrane Ho...
protein complex oligomerization suppression by virus of host autophagy virus-mediated pore formation in host cell membrane
host cell plasma membrane; membrane; virion membrane
monoatomic ion channel activity proton transmembrane transporter activity
Influenza A virus
Alternative splicing Disulfide bond Glycoprotein Host cell membrane Host membrane Host-virus interaction Hydrogen ion transport Inhibition of host autophagy by virus Ion channel Ion transport Lipoprotein Membrane Palmitate Phosphoprotein Signal-anchor Transmembrane Transmembrane helix Transport Viral ion channel Virion
MSLLTEVETP
MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDHLFFKCIYRFFKHGLKRGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE
protein complex oligomerization suppression by virus of host autophagy virus-mediated pore formation in host cell membrane host cell plasma membrane; membrane; virion membrane monoatomic ion channel activity proton transmembrane transporter activity Influenza A virus Alternative splicing Disulfide bond Glycoprotein Hos...
viral budding via host ESCRT complex
host cell late endosome membrane; host cell plasma membrane; host multivesicular body; membrane; viral nucleocapsid
RNA binding structural constituent of virion zinc ion binding
Hortulanus murine leukemia virus
Capsid protein Coiled coil Host cell membrane Host endosome Host membrane Host-virus interaction Lipoprotein Membrane Metal-binding Myristate Phosphoprotein RNA-binding Viral budding Viral budding via the host ESCRT complexes Viral matrix protein Viral nucleoprotein Viral release from host cell Virion Zinc Zinc-finger
MGQTITTPLS
MGQTITTPLSLTLDHWRDVQRIASNQSVDVKKRRWVTFCSAEWPTFNVGWPQDGTFNKDIITQVKIKVFSPGPHGHPDQVPYIVTWEAIAYDPPPWAKPFVHPQLSVSPSAPSAFSHEVSGPPTRSSLYPALTPTKSPSPKTQVLSDDGGPLIDLLSDDPPPYRGPENQPPAGRPTTTMQEMPRLPLKVPQEPSPMASRLRGRREHPAADSTTSQAFPLRTGGNGQLQYWPFSSADLYNWKNNNPSFSEDPGKLTALIESVLITHQPTWDDCQQLLGTLLTGEEKQRVLLEARKAVRGNDGRPTQLPNEINDAFPLERPD...
viral budding via host ESCRT complex host cell late endosome membrane; host cell plasma membrane; host multivesicular body; membrane; viral nucleocapsid RNA binding structural constituent of virion zinc ion binding Hortulanus murine leukemia virus Capsid protein Coiled coil Host cell membrane Host endosome Host membra...
fusion of virus membrane with host plasma membrane viral entry into host cell virion attachment to host cell
host cell plasma membrane; membrane; viral envelope; virion membrane
metal ion binding
Hortulanus murine leukemia virus
Cleavage on pair of basic residues Coiled coil Disulfide bond Fusion of virus membrane with host cell membrane Fusion of virus membrane with host membrane Glycoprotein Host cell membrane Host membrane Host-virus interaction Lipoprotein Membrane Metal-binding Palmitate Signal Transmembrane Transmembrane helix Viral atta...
MDRPALPKSI
MDRPALPKSIKDKTNPWGPIILGILIMLGGALGKGSPHKVFNLTWEVYNQEYETVWATSGSHPLWTWWPTLTPDLCMLAQLAKPSWGLSDYPPYSKPPGPPCCTTDNNPPGCSRDCNGPLTYLTPRCSTAWNRLKLVLTTHHLNQGFYVCPGPHRPRHARNCGGPDDFYCAHWGCETTGQAYWKPSSSWDYIRVSNNASSSDATTACKNNNWCSPLAISFTDPGKRATSWTSGFTWGLRLYISGHPGLIFGVRLKISDLGPRVPIGPNPVLSEQRPPSQPEPARLPPSSNLTQGGTPSAPTGPPQEGTGDRLLDLVQGAY...
fusion of virus membrane with host plasma membrane viral entry into host cell virion attachment to host cell host cell plasma membrane; membrane; viral envelope; virion membrane metal ion binding Hortulanus murine leukemia virus Cleavage on pair of basic residues Coiled coil Disulfide bond Fusion of virus membrane wit...
intestine smooth muscle contraction muscle contraction negative regulation of luteinizing hormone secretion operant conditioning positive regulation of acetylcholine secretion, neurotransmission positive regulation of flagellated sperm motility positive regulation of monoatomic ion transport positive regulation of smoo...
plasma membrane; sperm flagellum; sperm head; sperm midpiece
substance K receptor activity tachykinin receptor activity
Homo sapiens
3D-structure Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Lipoprotein Membrane Palmitate Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MGTCDIVTEA
MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATKCVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLRHLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGFRL...
intestine smooth muscle contraction muscle contraction negative regulation of luteinizing hormone secretion operant conditioning positive regulation of acetylcholine secretion, neurotransmission positive regulation of flagellated sperm motility positive regulation of monoatomic ion transport positive regulation of smoo...
phototransduction regulation of calcium ion transport visual perception
cytosol; membrane; perikaryon; photoreceptor inner segment; photoreceptor outer segment
calcium ion binding
Bos taurus
3D-structure Calcium Cell projection Direct protein sequencing Disulfide bond Lipoprotein Membrane Metal-binding Myristate Oxidation Redox-active center Reference proteome Repeat Sensory transduction Vision
MGNSKSGALS
MGNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLKEKKL
phototransduction regulation of calcium ion transport visual perception cytosol; membrane; perikaryon; photoreceptor inner segment; photoreceptor outer segment calcium ion binding Bos taurus 3D-structure Calcium Cell projection Direct protein sequencing Disulfide bond Lipoprotein Membrane Metal-binding Myristate Oxidat...
cell division chromosome segregation sporulation resulting in formation of a cellular spore
plasma membrane
ATP binding ATP hydrolysis activity DNA binding
Bacillus subtilis
ATP-binding Cell cycle Cell division Cell membrane Chromosome partition DNA-binding Membrane Nucleotide-binding Reference proteome Sporulation Transmembrane Transmembrane helix
MAKKKRKSRK
MAKKKRKSRKKQAKQLNIKYELNGLLCIAISIIAILQLGVVGQTFIYLFRFFAGEWFILCLLGLLVLGVSLFWKKKTPSLLTRRKAGLYCIIASILLLSHVQLFKNLTHKGSIESASVVRNTWELFLMDMNGSSASPDLGGGMIGALLFAASHFLFASTGSQIMAIVMILIGMILVTGRSLQETLKKWMSPIGRFIKEQWLAFIDDMKSFKSNMQSSKKTKAPSKKQKPARKKQQMEPEPPDEEGDYETVSPLIHSEPIISSFSDRNEEEESPVIEKRAEPVSKPLQDIQPETGDQETVSAPPMTFTELENKDYEMPSLD...
cell division chromosome segregation sporulation resulting in formation of a cellular spore plasma membrane ATP binding ATP hydrolysis activity DNA binding Bacillus subtilis ATP-binding Cell cycle Cell division Cell membrane Chromosome partition DNA-binding Membrane Nucleotide-binding Reference proteome Sporulation Tra...
cellular response to oxidative stress defense response negative regulation of blood vessel remodeling negative regulation of collagen catabolic process negative regulation of elastin catabolic process negative regulation of extracellular matrix disassembly negative regulation of proteolysis positive regulation of cell ...
axon; basement membrane; cell projection; collagen-containing extracellular matrix; contractile fiber; cytoplasm; extracellular region; extracellular space; Golgi apparatus; multivesicular body; neuronal cell body; nuclear membrane; perinuclear region of cytoplasm; plasma membrane; vesicle
amyloid-beta binding cysteine-type endopeptidase inhibitor activity endopeptidase inhibitor activity identical protein binding peptidase inhibitor activity protease binding
Mus musculus
Disulfide bond Protease inhibitor Reference proteome Secreted Signal Thiol protease inhibitor
MASPLRSLLF
MASPLRSLLFLLAVLAVAWAATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA
cellular response to oxidative stress defense response negative regulation of blood vessel remodeling negative regulation of collagen catabolic process negative regulation of elastin catabolic process negative regulation of extracellular matrix disassembly negative regulation of proteolysis positive regulation of cell ...
enteroendocrine cell differentiation positive regulation of proteasomal ubiquitin-dependent protein catabolic process proteasomal protein catabolic process proteasome-mediated ubiquitin-dependent protein catabolic process protein ubiquitination R7 cell fate commitment regulation of R7 cell differentiation sensory organ...
cytoplasm; cytosol; nucleus; ubiquitin ligase complex
identical protein binding ubiquitin conjugating enzyme binding ubiquitin protein ligase activity ubiquitin-protein transferase activity zinc ion binding
Drosophila melanogaster
Cytoplasm Developmental protein Metal-binding Nucleus Reference proteome Sensory transduction Transferase Ubl conjugation pathway Vision Zinc Zinc-finger
MSNKINPKRR
MSNKINPKRREPTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGDAGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFADNGNLGINVTISLV
enteroendocrine cell differentiation positive regulation of proteasomal ubiquitin-dependent protein catabolic process proteasomal protein catabolic process proteasome-mediated ubiquitin-dependent protein catabolic process protein ubiquitination R7 cell fate commitment regulation of R7 cell differentiation sensory organ...
adenylate cyclase-modulating G protein-coupled receptor signaling pathway chemotaxis complement receptor mediated signaling pathway G protein-coupled receptor signaling pathway inflammatory response nitric oxide mediated signal transduction phospholipase C-activating G protein-coupled receptor signaling pathway positiv...
azurophil granule membrane; cytoplasm; ficolin-1-rich granule membrane; membrane; plasma membrane; secretory granule membrane
complement receptor activity G protein-coupled receptor activity G protein-coupled receptor binding N-formyl peptide receptor activity RAGE receptor binding scavenger receptor binding
Homo sapiens
3D-structure Cell membrane Chemotaxis Disulfide bond G-protein coupled receptor Glycoprotein Membrane Phosphoprotein Receptor Reference proteome Transducer Transmembrane Transmembrane helix
METNSSLPTN
METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPMLYVFMGQDFRERLIHALPASL...
adenylate cyclase-modulating G protein-coupled receptor signaling pathway chemotaxis complement receptor mediated signaling pathway G protein-coupled receptor signaling pathway inflammatory response nitric oxide mediated signal transduction phospholipase C-activating G protein-coupled receptor signaling pathway positiv...
adenylate cyclase-activating G protein-coupled receptor signaling pathway adult locomotory behavior B cell differentiation cell surface receptor signaling pathway cellular response to glycoprotein cellular response to thyrotropin-releasing hormone cochlea morphogenesis dopaminergic neuron differentiation hormone-mediat...
basolateral plasma membrane; plasma membrane; receptor complex
G protein-coupled peptide receptor activity protein-containing complex binding signaling receptor activity thyroid-stimulating hormone receptor activity
Rattus norvegicus
Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Leucine-rich repeat Membrane Receptor Reference proteome Repeat Signal Sulfation Transducer Transmembrane Transmembrane helix
MRPGSLLQLT
MRPGSLLQLTLLLALPRSLWGRGCTSPPCECHQEDDFRVTCKELHQIPSLPPSTQTLKLIETHLKTIPSLAFSSLPNISRIYLSIDATLQRLEPHSFYNLSKMTHIEIRNTRSLTYIDPDALTELPLLKFLGIFNTGLRIFPDLTKIYSTDVFFILEITDNPYMTSVPENAFQGLCNETLTLKLYNNGFTSIQGHAFNGTKLDAVYLNKNKYLTAIDKDAFGGVYSGPTLLDVSSTSVTALPSKGLEHLKELIAKNTWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLMCNESSIRNLRQRKSVNVMRG...
adenylate cyclase-activating G protein-coupled receptor signaling pathway adult locomotory behavior B cell differentiation cell surface receptor signaling pathway cellular response to glycoprotein cellular response to thyrotropin-releasing hormone cochlea morphogenesis dopaminergic neuron differentiation hormone-mediat...
response to antibiotic translation
ribosome; small ribosomal subunit
rRNA binding structural constituent of ribosome tRNA binding
Bacillus subtilis
3D-structure Antibiotic resistance Direct protein sequencing Reference proteome Ribonucleoprotein Ribosomal protein RNA-binding rRNA-binding tRNA-binding
MPTINQLIRK
MPTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVENRAQGRSKYGTKKPKAK
response to antibiotic translation ribosome; small ribosomal subunit rRNA binding structural constituent of ribosome tRNA binding Bacillus subtilis 3D-structure Antibiotic resistance Direct protein sequencing Reference proteome Ribonucleoprotein Ribosomal protein RNA-binding rRNA-binding tRNA-binding MPTINQLIRK MPTINQL...
mRNA catabolic process ncRNA processing response to cold
cytosol
3'-5' RNA helicase activity 3'-5'-RNA exonuclease activity exoribonuclease II activity ribonuclease R activity RNA binding RNA exonuclease activity, producing 5'-phosphomonoesters RNA nuclease activity
Escherichia coli
Acetylation Cytoplasm Direct protein sequencing Exonuclease Hydrolase Nuclease Reference proteome RNA-binding Stress response Virulence
MSQDPFQERE
MSQDPFQEREAEKYANPIPSREFILEHLTKREKPASRDELAVELHIEGEEQLEGLRRRLRAMERDGQLVFTRRQCYALPERLDLVKGTVIGHRDGYGFLRVEGRKDDLYLSSEQMKTCIHGDQVLAQPLGADRKGRREARIVRVLVPKTSQIVGRYFTEAGVGFVVPDDSRLSFDILIPPDQIMGARMGFVVVVELTQRPTRRTKAVGKIVEVLGDNMGTGMAVDIALRTHEIPYIWPQAVEQQVAGLKEEVPEEAKAGRVDLRDLPLVTIDGEDARDFDDAVYCEKKRGGGWRLWVAIADVSYYVRPSTPLDREARNRG...
mRNA catabolic process ncRNA processing response to cold cytosol 3'-5' RNA helicase activity 3'-5'-RNA exonuclease activity exoribonuclease II activity ribonuclease R activity RNA binding RNA exonuclease activity, producing 5'-phosphomonoesters RNA nuclease activity Escherichia coli Acetylation Cytoplasm Direct protein...
ribosome biogenesis transcriptional attenuation
cytosol
ATP binding ATP hydrolysis activity ATP-dependent activity, acting on RNA poly(A) binding RNA helicase activity RNA strand annealing activity
Escherichia coli
3D-structure ATP-binding Cytoplasm Helicase Hydrolase Nucleotide-binding Reference proteome Ribosome biogenesis RNA-binding
MTVTTFSELE
MTVTTFSELELDESLLEALQDKGFTRPTAIQAAAIPPALDGRDVLGSAPTGTGKTAAYLLPALQHLLDFPRKKSGPPRILILTPTRELAMQVSDHARELAKHTHLDIATITGGVAYMNHAEVFSENQDIVVATTGRLLQYIKEENFDCRAVETLILDEADRMLDMGFAQDIEHIAGETRWRKQTLLFSATLEGDAIQDFAERLLEDPVEVSANPSTRERKKIHQWYYRADDLEHKTALLVHLLKQPEATRSIVFVRKRERVHELANWLREAGINNCYLEGEMVQGKRNEAIKRLTEGRVNVLVATDVAARGIDIPDVSHV...
ribosome biogenesis transcriptional attenuation cytosol ATP binding ATP hydrolysis activity ATP-dependent activity, acting on RNA poly(A) binding RNA helicase activity RNA strand annealing activity Escherichia coli 3D-structure ATP-binding Cytoplasm Helicase Hydrolase Nucleotide-binding Reference proteome Ribosome biog...
calcium ion-regulated exocytosis of neurotransmitter cellular response to calcium ion chemical synaptic transmission clathrin-dependent synaptic vesicle endocytosis larval locomotory behavior neurotransmitter secretion positive regulation of vesicle fusion regulation of calcium ion-dependent exocytosis regulation of do...
axon; dense core granule; exocytic vesicle; membrane; neuromuscular junction; plasma membrane; synaptic vesicle; synaptic vesicle membrane; terminal bouton
calcium ion binding calcium-dependent phospholipid binding clathrin binding phosphatidylserine binding protein homodimerization activity SNARE binding syntaxin binding
Drosophila melanogaster
Alternative splicing Calcium Cytoplasmic vesicle Membrane Metal-binding Reference proteome Repeat RNA editing Synapse Transmembrane Transmembrane helix
MPPNAKSETD
MPPNAKSETDAKPEAEPAPASEPAADLESVDQKLEETHHSKFREVDRQEQEVLAEKAAEAASQRIAQVESTTRSATTEAQESTTTAVPVIKKIEHVGEVVTEVIAERTGLPTWGVVAIIILVFLVVFGIIFFCVRRFLKKRRTKDGKGKKGVDMKSVQLLGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGE...
calcium ion-regulated exocytosis of neurotransmitter cellular response to calcium ion chemical synaptic transmission clathrin-dependent synaptic vesicle endocytosis larval locomotory behavior neurotransmitter secretion positive regulation of vesicle fusion regulation of calcium ion-dependent exocytosis regulation of do...
deoxyribonucleotide biosynthetic process DNA replication
cytoplasm; nucleus; ribonucleoside-diphosphate reductase complex
ATP binding identical protein binding nucleotide binding ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor
Saccharomyces cerevisiae
3D-structure Allosteric enzyme ATP-binding Cytoplasm Deoxyribonucleotide synthesis Disulfide bond Isopeptide bond Nucleotide-binding Oxidoreductase Phosphoprotein Reference proteome Ubl conjugation
MYVYKRDGRK
MYVYKRDGRKEPVQFDKITARISRLCYGLDPKHIDAVKVTQRIISGVYEGVTTIELDNLAAETCAYMTTVHPDYATLAARIAISNLHKQTTKQFSKVVEDLYRYVNAATGKPAPMISDDVYNIVMENKDKLNSAIVYDRDFQYSYFGFKTLERSYLLRINGQVAERPQHLIMRVALGIHGRDIEAALETYNLMSLKYFTHASPTLFNAGTPKPQMSSCFLVAMKEDSIEGIYDTLKECALISKTAGGIGLHIHNIRSTGSYIAGTNGTSNGLIPMIRVFNNTARYVDQGGNKRPGAFALYLEPWHADIFDFIDIRKNHGK...
deoxyribonucleotide biosynthetic process DNA replication cytoplasm; nucleus; ribonucleoside-diphosphate reductase complex ATP binding identical protein binding nucleotide binding ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor Saccharomyces cerevisiae 3D-structure Allosteric enzyme ATP...
collateral sprouting of injured axon compound eye development dendrite morphogenesis dorsal closure embryo development ending in birth or egg hatching establishment or maintenance of cell polarity follicle cell of egg chamber migration G2/M transition of mitotic cell cycle germ cell development imaginal disc fusion, th...
cytoplasm; nucleoplasm; nucleus; transcription factor AP-1 complex
DNA binding DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity, RNA polymerase II-specific DNA-binding transcription factor binding protein heterodimerization activity RNA polymerase II cis-regulatory region sequence-specific DNA binding
Drosophila melanogaster
Activator Alternative promoter usage Alternative splicing Direct protein sequencing DNA-binding Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation
MKNLNGRTHN
MKNLNGRTHNACYHPYYHQSLHFAQQQQQQQQHHLQQQQQHMQQQQQQQQAPQQQLRHQQRQLPTQPAYQQSQSVAHNAFPLRSSSNNYGHVASSAYAASSGSHNSNNAAAMAAVCQMQNFFNQQQQQQQQLEFNNNCMPINYYQQQQQQHYPSESQSSASGWNPETPGQAQLALTATTCNTTAAATCNTTAAATTSTTATSAAAGSDNNHSDNFAMDASEIATFLANELFLQQLGNFETGQSVLTLTTPTLTPTTTRNIEDTLGHLLSDTQTDRVAGCAGFAVPKVLPNAIDVLGMGIPTGVSSLPLQQTFDLSLGQGS...
collateral sprouting of injured axon compound eye development dendrite morphogenesis dorsal closure embryo development ending in birth or egg hatching establishment or maintenance of cell polarity follicle cell of egg chamber migration G2/M transition of mitotic cell cycle germ cell development imaginal disc fusion, th...
malate metabolic process
chloroplast
malate dehydrogenase (NADP+) activity
Pisum sativum
Chloroplast Direct protein sequencing Disulfide bond NADP Oxidoreductase Plastid Transit peptide
MALTQLNSTC
MALTQLNSTCSKPQLHSSSQLSFLSRTRTRTLPRHYHSTFAPLHRTQHARISCSVAPNQVQVPAAQTQDPKGKPDCYGVFCLTYDLKAEEETKSWKKLINIAVSGAAGMISNHLLFKLASGEVFGPDQPIALKLLGSERSIQALEGVAMELEDSLFPLLREVVISIDPYEVFQDAEWALLIGAKPRGPGVERAALLDINGQIFAEQGKALNAVASRNAKVIVVGNPCNTNALICLKNAPNIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARIDGLPVKEVIKDNKWLEEEFTEKVQKR...
malate metabolic process chloroplast malate dehydrogenase (NADP+) activity Pisum sativum Chloroplast Direct protein sequencing Disulfide bond NADP Oxidoreductase Plastid Transit peptide MALTQLNSTC MALTQLNSTCSKPQLHSSSQLSFLSRTRTRTLPRHYHSTFAPLHRTQHARISCSVAPNQVQVPAAQTQDPKGKPDCYGVFCLTYDLKAEEETKSWKKLINIAVSGAAGMISNHLLFKLASGE...
proteolysis
extracellular region
serine-type carboxypeptidase activity
Hordeum vulgare
Carboxypeptidase Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Protease Secreted Signal Zymogen
MVTTPRLVSL
MVTTPRLVSLLLLLALCAAAAGALRLPPDASFPGAQAERLIRALNLLPKDSSSSSGRHGARVGEGNEDVAPGQLLERRVTLPGLPEGVADLGHHAGYYRLPNTHDARMFYFFFESRGKKEDPVVIWLTGGPGCSSELAVFYENGPFTIANNMSLVWNKFGWDKISNIIFVDQPTGTGFSYSSDDRDTRHDETGVSNDLYDFLQVFFKKHPEFIKNDFFITGESYAGHYIPAFASRVHQGNKKNEGTHINLKGFAIGNGLTDPAIQYKAYTDYALEMNLIQKADYERINKFIPPCEFAIKLCGTNGKASCMAAYMVCNTIF...
proteolysis extracellular region serine-type carboxypeptidase activity Hordeum vulgare Carboxypeptidase Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Protease Secreted Signal Zymogen MVTTPRLVSL MVTTPRLVSLLLLLALCAAAAGALRLPPDASFPGAQAERLIRALNLLPKDSSSSSGRHGARVGEGNEDVAPGQLLERRVTLPGLPEGVADLGHHAGYYRLPNTHDARM...
cellular response to interleukin-4 translation
cytoplasm; cytosolic large ribosomal subunit; cytosolic ribosome; nucleolus; protein-containing complex; ribosome; synapse
5S rRNA binding RNA binding structural constituent of ribosome
Rattus norvegicus
3D-structure Acetylation Cytoplasm Direct protein sequencing Isopeptide bond Methylation Nucleus Phosphoprotein Reference proteome Ribonucleoprotein Ribosomal protein Ubl conjugation
MSHRKFSAPR
MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDDTGKKQLEKDFNSMKKYCQVIRIIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGF...
cellular response to interleukin-4 translation cytoplasm; cytosolic large ribosomal subunit; cytosolic ribosome; nucleolus; protein-containing complex; ribosome; synapse 5S rRNA binding RNA binding structural constituent of ribosome Rattus norvegicus 3D-structure Acetylation Cytoplasm Direct protein sequencing Isopepti...
cytoplasmic translation
A band; cytoplasm; cytoplasmic ribonucleoprotein granule; cytosolic large ribosomal subunit; cytosolic ribosome; nucleus; polysomal ribosome; postsynaptic density; rough endoplasmic reticulum; synapse
5.8S rRNA binding mRNA binding RNA binding structural constituent of ribosome tRNA binding
Rattus norvegicus
3D-structure Acetylation Cytoplasm Direct protein sequencing Endoplasmic reticulum Isopeptide bond Phosphoprotein Reference proteome Ribonucleoprotein Ribosomal protein Ubl conjugation
MAGEKAEKPD
MAGEKAEKPDKKEQKPAAKKAGGDATAPRALPAGAVKKSSSKAKKLRKSKPHCSRNPVLVRGIGRYSRSAMYSRKALYKRKYSAAKTKVEKKKKKEKVLATVTKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRRLRSSITPGTVLIILTGRHRGKRVVFLKQLGSGLLLVTGPLALNRVPLRRTHQKFVIATSTKVDISKVKIPKHLTDAYFKKKPLRKPRHQEGEIFDTEKEKYEITEQRKADQKAVDSQILPKIKAVPQLQGYLRSQFSLTNGMYPHKLVF
cytoplasmic translation A band; cytoplasm; cytoplasmic ribonucleoprotein granule; cytosolic large ribosomal subunit; cytosolic ribosome; nucleus; polysomal ribosome; postsynaptic density; rough endoplasmic reticulum; synapse 5.8S rRNA binding mRNA binding RNA binding structural constituent of ribosome tRNA binding Ratt...
positive regulation of transcription by RNA polymerase II regulation of DNA-templated transcription regulation of transcription by RNA polymerase II termination of RNA polymerase I transcription termination of RNA polymerase II transcription transcriptional start site selection at RNA polymerase II promoter
chromatin; nucleoplasm; nucleus
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific DNA binding transcription cis-regulatory region binding
Saccharomyces cerevisiae
DNA-binding Isopeptide bond Nucleus Phosphoprotein Reference proteome Repeat Transcription Transcription regulation Ubl conjugation
MPSGHNDKNA
MPSGHNDKNANQESVEEAVLKYVGVGLDHQNHDPQLHTKDLENKHSKKQNIVESSSDVDVNNNDDSNRNEDNNDDSENISALNANESSSNVDHANSNEQHNAVMDWYLRQTAHNQQDDEDDENNNNTDNGNDSNNHFSQSDIVVDDDDDKNKKDAGVGVDDDHQSMAMAAVAAAYTLSKNNNNNNSIANDSNSRKRQHDNGNNHENSQKKRKNNNDDDDRQIGNVDPELTTLGDADDNDTNNDVIDRDQLVHKAIIDADSITQHPDFQQYLNTAADTDDNEKLKHIKDHLMRTHGLNHQNKNHNDDTDDLSNSTKQYSEL...
positive regulation of transcription by RNA polymerase II regulation of DNA-templated transcription regulation of transcription by RNA polymerase II termination of RNA polymerase I transcription termination of RNA polymerase II transcription transcriptional start site selection at RNA polymerase II promoter chromatin; ...
anaphase-promoting complex-dependent catabolic process anterior/posterior axis specification, embryo embryo development ending in birth or egg hatching meiotic cell cycle positive regulation of metaphase/anaphase transition of meiotic cell cycle positive regulation of proteasomal ubiquitin-dependent protein catabolic p...
Cul2-RING ubiquitin ligase complex
cyclin binding
Caenorhabditis elegans
Developmental protein Meiosis Reference proteome Ubl conjugation pathway
MDHNAALTTC
MDHNAALTTCSTSAIPRLARLATERIAELIENDALPEFDHKVIASCSNDIFEVLRQKKKLNHQTLQTMCSTSRFQINKIDLMGNKVELQDLELCSNQNLVSFRLGDIDYFPNTNKIQVADVLDTALNRTSRQQLRHLDLSGRHRITSNWPTYVARKLPRLESLAFANRSTANETLSQIGASLLNLRFLDISSTCVTDISCISSLRNLEVLIMYNLNILKGDVTETLSNLTKLRVLDISRKVNTDYLQETSQDAHLDLALGIYNRSVEAIESGTATPWAELRAIDMSGLSIVQFGTDRALAFVEKIIEAHPKLEQISLLAT...
anaphase-promoting complex-dependent catabolic process anterior/posterior axis specification, embryo embryo development ending in birth or egg hatching meiotic cell cycle positive regulation of metaphase/anaphase transition of meiotic cell cycle positive regulation of proteasomal ubiquitin-dependent protein catabolic p...
adult behavior cellular response to histamine chloride transmembrane transport gamma-aminobutyric acid signaling pathway inhibitory synapse assembly post-embryonic development regulation of postsynaptic membrane potential synaptic transmission, GABAergic
axon; chloride channel complex; dendrite membrane; GABA-A receptor complex; GABA-ergic synapse; neuron projection; plasma membrane; postsynapse; postsynaptic membrane; synapse
chloride channel activity GABA-A receptor activity GABA-gated chloride ion channel activity inhibitory extracellular ligand-gated monoatomic ion channel activity transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
Gallus gallus
Cell membrane Chloride Chloride channel Disulfide bond Glycoprotein Ion channel Ion transport Membrane Postsynaptic cell membrane Reference proteome Signal Synapse Transmembrane Transmembrane helix Transport
MTPSNPTRLG
MTPSNPTRLGSTALLNPAFSLKMMVWALVFLSLIQCSTQKGDDDYEDYTSNKTWVLTPKVHESDVTLILNGLLEGYDNKLRPDIGVKPTVIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDAHSCPLEFSSYGYPREEIIYQWKRSSVEVGDTRSWRLYQFSFTGLRNTTEVVKTTSGDYVVMSVYFNLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTI...
adult behavior cellular response to histamine chloride transmembrane transport gamma-aminobutyric acid signaling pathway inhibitory synapse assembly post-embryonic development regulation of postsynaptic membrane potential synaptic transmission, GABAergic axon; chloride channel complex; dendrite membrane; GABA-A recepto...
glycine biosynthetic process, by transamination of glyoxylate glyoxylate catabolic process glyoxylate metabolic process L-alanine catabolic process L-cysteine catabolic process L-serine metabolic process Notch signaling pathway oxalic acid secretion
cytosol; intracellular membrane-bounded organelle; peroxisomal matrix; peroxisome
alanine-glyoxylate transaminase activity amino acid binding identical protein binding protein homodimerization activity protein self-association pyridoxal phosphate binding serine-pyruvate transaminase activity transaminase activity
Homo sapiens
3D-structure Acetylation Aminotransferase Disease variant Peroxisome Phosphoprotein Pyridoxal phosphate Reference proteome Transferase
MASHKLLVTP
MASHKLLVTPPKALLKPLSIPNQLLLGPGPSNLPPRIMAAGGLQMIGSMSKDMYQIMDEIKEGIQYVFQTRNPLTLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSFYLDIKWLANFWGCDDQPRMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPT...
glycine biosynthetic process, by transamination of glyoxylate glyoxylate catabolic process glyoxylate metabolic process L-alanine catabolic process L-cysteine catabolic process L-serine metabolic process Notch signaling pathway oxalic acid secretion cytosol; intracellular membrane-bounded organelle; peroxisomal matrix;...
canonical glycolysis glycolytic process
cytosol; membrane; phosphopyruvate hydratase complex; plasma membrane
identical protein binding magnesium ion binding phosphopyruvate hydratase activity protein-containing complex binding
Mus musculus
Acetylation Cytoplasm Direct protein sequencing Glycolysis Lyase Magnesium Metal-binding Phosphoprotein Reference proteome
MAMQKIFARE
MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKARYLGKGVLKAVEHINKTLGPALLEKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGNPDLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMRIGAEVYHHLKGVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHISGEKLGELYKNFIQNYPVVSIEDPFDQDDWATWTSFLSGVDIQIVGDDL...
canonical glycolysis glycolytic process cytosol; membrane; phosphopyruvate hydratase complex; plasma membrane identical protein binding magnesium ion binding phosphopyruvate hydratase activity protein-containing complex binding Mus musculus Acetylation Cytoplasm Direct protein sequencing Glycolysis Lyase Magnesium Meta...
feeding behavior glucose metabolic process locomotory behavior negative regulation of cytosolic calcium ion concentration negative regulation of hormone secretion outflow tract morphogenesis peristalsis positive regulation of vasoconstriction regulation of blood pressure regulation of multicellular organism growth regu...
axon; glutamatergic synapse; neuron projection; neuronal dense core vesicle; plasma membrane; presynaptic membrane; synaptic vesicle
neuropeptide binding neuropeptide receptor activity neuropeptide Y receptor activity pancreatic polypeptide receptor activity peptide YY receptor activity
Rattus norvegicus
Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Lipoprotein Membrane Palmitate Phosphoprotein Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MNSTLFSRVE
MNSTLFSRVENYSVHYNVSENSPFLAFENDDCHLPLAVIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAVMCLPFTFVYTLMDHWVFGETMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYIGITVIWVLAVASSLPFVIYQILTDEPFQNVSLAAFKDKYVCFDKFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKIRDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYG...
feeding behavior glucose metabolic process locomotory behavior negative regulation of cytosolic calcium ion concentration negative regulation of hormone secretion outflow tract morphogenesis peristalsis positive regulation of vasoconstriction regulation of blood pressure regulation of multicellular organism growth regu...
mitochondrial respiratory chain complex III assembly positive regulation of mitochondrial translation protein stabilization
Cbp3p-Cbp6 complex; mitochondrial membrane; mitochondrial ribosome; mitochondrion
mRNA binding ribosome binding
Saccharomyces cerevisiae
Chaperone Membrane Mitochondrion Reference proteome Transit peptide Transmembrane Transmembrane helix
MMSVNRFTSG
MMSVNRFTSGRLPVFLRKSPFYYSRAYLHQTCVFKQNKETAQDSPELLAKSSHLNSKPLDVSNKAPVKTAQNKIPLAHSKYESSKYELPKWKEALGELVIRAFHLDMDRVRAGPVAGSYYYKICKEQGLQYEDEPLSETAKYFYEDLKLPRTFSQWFQITVLHEWILFVRMRAMPFKYGRNYQQKLVDRTFSDIELRLFEEMKVNSGRIADQYLKDFNTQLRGAIFAYDEGFATDDGTLATAVWRNLFGGRKNIDMVHLESVVRYIYSQLYVLSRLSDREFATGKFKFVPPGVKVEKLTPKQEEELKAKTIAKYEALDKD...
mitochondrial respiratory chain complex III assembly positive regulation of mitochondrial translation protein stabilization Cbp3p-Cbp6 complex; mitochondrial membrane; mitochondrial ribosome; mitochondrion mRNA binding ribosome binding Saccharomyces cerevisiae Chaperone Membrane Mitochondrion Reference proteome Transi...
SRP-dependent cotranslational protein targeting to membrane SRP-dependent cotranslational protein targeting to membrane, translocation
cytosol; endoplasmic reticulum; signal recognition particle, endoplasmic reticulum targeting
7S RNA binding ATP hydrolysis activity endoplasmic reticulum signal peptide binding GTP binding GTPase activity
Schizosaccharomyces pombe
Cytoplasm Endoplasmic reticulum GTP-binding Hydrolase Nucleotide-binding Reference proteome Ribonucleoprotein RNA-binding Signal recognition particle
MVFADLGRRL
MVFADLGRRLNSALGDFSKATSVNEELVDTLLKNICTALLETDVNVRLVQELRSNIKKKINVSTLPQGINGKRIVQKAVFDELCSLVDPKVDAFTPKKGRPSVIMMVGLQGSGKTTTCSKLALHYQRRGLKSCLVAADTFRAGAFDQLKQNAIKARVPYFGSYTETDPVVIAKEGVDKFKNDRFDVIIVDTSGRHQQEQELFAEMVEISDAIRPDQTIMILDASIGQAAESQSKAFKETADFGAVIITKLDGHAKGGGALSAVAATKTPIVFIGTGEHINDLERFSPRSFISKLLGLGDLEGLMEHVQSLDFDKKNMVKN...
SRP-dependent cotranslational protein targeting to membrane SRP-dependent cotranslational protein targeting to membrane, translocation cytosol; endoplasmic reticulum; signal recognition particle, endoplasmic reticulum targeting 7S RNA binding ATP hydrolysis activity endoplasmic reticulum signal peptide binding GTP bind...
actin filament polymerization activation of phospholipase A2 activity activation of phospholipase C activity angiogenesis antibacterial humoral response antifungal humoral response antimicrobial humoral immune response mediated by antimicrobial peptide cell differentiation cell migration central nervous system developm...
actin cytoskeleton; angiogenin-PRI complex; basement membrane; chromosome; cytoplasmic vesicle; extracellular region; extracellular space; growth cone; neuronal cell body; nucleolus; nucleus
actin binding copper ion binding DNA binding endonuclease activity heparin binding peptide binding protein homodimerization activity RNA binding RNA nuclease activity signaling receptor binding tRNA-specific ribonuclease activity
Mus musculus
3D-structure Angiogenesis Cytoplasmic vesicle Developmental protein Differentiation Direct protein sequencing Disulfide bond DNA-binding Endonuclease Hydrolase Nuclease Nucleus Protein synthesis inhibitor Pyrrolidone carboxylic acid Reference proteome Secreted Signal Stress response
MAISPGPLFL
MAISPGPLFLIFVLGLVVIPPTLAQDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSNIKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFRHVVIACENGLPVHFDESFFSL
actin filament polymerization activation of phospholipase A2 activity activation of phospholipase C activity angiogenesis antibacterial humoral response antifungal humoral response antimicrobial humoral immune response mediated by antimicrobial peptide cell differentiation cell migration central nervous system developm...
negative regulation of arachidonic acid secretion negative regulation of prostaglandin secretion positive regulation of blood pressure positive regulation of heart rate proton motive force-driven mitochondrial ATP synthesis response to muscle activity
cell surface; extracellular space; mitochondrial proton-transporting ATP synthase complex; mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)
protein-containing complex binding proton transmembrane transporter activity
Rattus norvegicus
Acetylation CF(0) Direct protein sequencing Hydrogen ion transport Ion transport Membrane Mitochondrion Mitochondrion inner membrane Phosphoprotein Reference proteome Transit peptide Transport
MTVQRIFRLS
MTVQRIFRLSSVLRSAVSVHLRRNIGVTAVAFNKELDPVQKLFLDKIREYKAKRLASGGPVDTGPEYQQEVDRELFKLKQMYGKGEMDKFPTFNFEDPKFEVLDKPQS
negative regulation of arachidonic acid secretion negative regulation of prostaglandin secretion positive regulation of blood pressure positive regulation of heart rate proton motive force-driven mitochondrial ATP synthesis response to muscle activity cell surface; extracellular space; mitochondrial proton-transporting...
cellular response to estradiol stimulus cellular response to glucocorticoid stimulus cellular response to oxygen levels cellular response to starvation cellular response to tumor necrosis factor myoblast fate determination myoblast fusion myotube differentiation involved in skeletal muscle regeneration negative regulat...
euchromatin; myofibril; nucleoplasm; transcription regulator complex
bHLH transcription factor binding chromatin DNA binding DNA-binding transcription activator activity DNA-binding transcription activator activity, RNA polymerase II-specific E-box binding nuclear receptor binding promoter-specific chromatin binding protein homodimerization activity ubiquitin protein ligase binding
Coturnix japonica
Activator Developmental protein Differentiation DNA-binding Myogenesis Nucleus Reference proteome Transcription Transcription regulation
MDLLGPMEMT
MDLLGPMEMTEGSLCSFAAADDFYDDPCFNTSDMHFFEDLDPRLVHVGGLLKPEEHPHHHGHHHGHPHEEEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSTNPNQRLPKVEILRNAIRYIESLQALLREQEDAYYPVLEHYSGESDASSPRSNCSDGMMEYSGPPCSSRRRNSYDSSYYTESPNDPKHGKSSVVSSLDCLSSIVERISTDNSTCPILPPAEAVAEGSPCSPQEGASLNDSGAQIPSPTNCTPLPQDSSSSSNPIYQVL
cellular response to estradiol stimulus cellular response to glucocorticoid stimulus cellular response to oxygen levels cellular response to starvation cellular response to tumor necrosis factor myoblast fate determination myoblast fusion myotube differentiation involved in skeletal muscle regeneration negative regulat...
positive regulation of DNA-templated transcription
cytoplasm; ribonucleoprotein complex
RNA binding sequence-specific DNA binding
Xenopus laevis
Alternative splicing Cytoplasm Direct protein sequencing DNA-binding Phosphoprotein Reference proteome Ribonucleoprotein RNA-binding Transcription Transcription regulation
MSEAEAQEPE
MSEAEAQEPEPVPQPESEPEIQKPGIAAARNQANKKVLATQVQGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSRFAPNRRRFRRRFYRPRADTAGESGGEGVSPEQMSEGERGEETSPQQRPQRRRPPPFFYRRRFRRGPRPNNQQNQGAEVTEQSENKDPVAPTSEALASGDDPQRPPPRRFRQRFRRPFRPRPAPQQTPEGGDGETKAESGEDPRPEPQRQRNRPYVQRRRRQGATQVAATAQGEGKAEPTQHPASEEGTPSDSPTDDGAPV...
positive regulation of DNA-templated transcription cytoplasm; ribonucleoprotein complex RNA binding sequence-specific DNA binding Xenopus laevis Alternative splicing Cytoplasm Direct protein sequencing DNA-binding Phosphoprotein Reference proteome Ribonucleoprotein RNA-binding Transcription Transcription regulation MSE...
clathrin coat assembly involved in endocytosis endocytosis endosome organization G protein-coupled receptor internalization modulation of chemical synaptic transmission positive regulation of synaptic vesicle endocytosis positive regulation of synaptic vesicle recycling protein homooligomerization protein homotetrameri...
chromaffin granule; clathrin-coated pit; clathrin-coated vesicle; cytoplasm; endocytic vesicle; glutamatergic synapse; Golgi apparatus; membrane; membrane coat; microtubule; photoreceptor inner segment; photoreceptor ribbon synapse; plasma membrane; presynapse; presynaptic endocytic zone membrane; protein-containing co...
D2 dopamine receptor binding GDP binding GTP binding GTPase activity identical protein binding microtubule binding nitric-oxide synthase binding phosphatidylinositol-3,4,5-trisphosphate binding phosphatidylinositol-4,5-bisphosphate binding protein homodimerization activity protein kinase binding protein self-associatio...
Rattus norvegicus
3D-structure Alternative splicing Cell membrane Cell projection Coated pit Cytoplasmic vesicle Direct protein sequencing Endocytosis Golgi apparatus GTP-binding Hydrolase Membrane Methylation Microtubule Motor protein Nitration Nucleotide-binding Phosphoprotein Reference proteome Synapse
MGNRGMEDLI
MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPD...
clathrin coat assembly involved in endocytosis endocytosis endosome organization G protein-coupled receptor internalization modulation of chemical synaptic transmission positive regulation of synaptic vesicle endocytosis positive regulation of synaptic vesicle recycling protein homooligomerization protein homotetrameri...
actin cytoskeleton organization cell division endocytosis lipid tube assembly meiotic cell cycle peroxisome fission peroxisome organization protein retention in Golgi apparatus protein targeting to vacuole vacuolar transport
actin cortical patch; cytoplasm; cytosol; fungal-type vacuole membrane; late endosome; membrane; microtubule; mitochondrial outer membrane; mitochondrion; peroxisome
GTP binding GTPase activity microtubule binding
Saccharomyces cerevisiae
Cell cycle Cell division Cytoplasm Cytoskeleton GTP-binding Meiosis Microtubule Motor protein Nucleotide-binding Phosphoprotein Reference proteome
MDEHLISTIN
MDEHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIVTRRPLVLQLINRRPKKSEHAKVNQTANELIDLNINDDDKKKDESGKHQNEGQSEDNKEEWGEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIYSPHVLTLTLVDLPGLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKTIREALENERKFFENHPSYSSKAHYCGTPYLA...
actin cytoskeleton organization cell division endocytosis lipid tube assembly meiotic cell cycle peroxisome fission peroxisome organization protein retention in Golgi apparatus protein targeting to vacuole vacuolar transport actin cortical patch; cytoplasm; cytosol; fungal-type vacuole membrane; late endosome; membrane...
calcium ion-regulated exocytosis of neurotransmitter calcium-dependent activation of synaptic vesicle fusion cell differentiation cellular response to calcium ion chemical synaptic transmission detection of calcium ion fast, calcium ion-dependent exocytosis of neurotransmitter neurotransmitter secretion positive regula...
axon; chromaffin granule membrane; clathrin-coated endocytic vesicle membrane; clathrin-sculpted acetylcholine transport vesicle membrane; clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane; clathrin-sculpted glutamate transport vesicle membrane; clathrin-sculpted monoamine transport vesicle membrane;...
calcium ion binding calcium ion sensor activity calcium-dependent phospholipid binding calcium-dependent protein binding calmodulin binding clathrin binding identical protein binding low-density lipoprotein particle receptor binding phosphatidylinositol-4,5-bisphosphate binding phosphatidylserine binding protein hetero...
Homo sapiens
3D-structure Calcium Cytoplasm Cytoplasmic vesicle Differentiation Disease variant Glycoprotein Lipoprotein Membrane Metal-binding Palmitate Phosphoprotein Reference proteome Repeat Synapse Transmembrane Transmembrane helix
MVSESHHEAL
MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQN...
calcium ion-regulated exocytosis of neurotransmitter calcium-dependent activation of synaptic vesicle fusion cell differentiation cellular response to calcium ion chemical synaptic transmission detection of calcium ion fast, calcium ion-dependent exocytosis of neurotransmitter neurotransmitter secretion positive regula...
adenosine biosynthetic process adenosine metabolic process ADP catabolic process AMP catabolic process ATP metabolic process calcium ion homeostasis inhibition of non-skeletal tissue mineralization leukocyte cell-cell adhesion negative regulation of inflammatory response positive regulation of lipid biosynthetic proces...
cell surface; external side of plasma membrane; membrane; plasma membrane; synaptic membrane
5'-deoxynucleotidase activity 5'-nucleotidase activity ferrous iron binding GMP 5'-nucleotidase activity identical protein binding IMP 5'-nucleotidase activity nucleotide binding thymidylate 5'-phosphatase activity XMP 5'-nucleosidase activity zinc ion binding
Rattus norvegicus
Cell membrane Direct protein sequencing Disulfide bond Glycoprotein GPI-anchor Hydrolase Lipoprotein Membrane Metal-binding Nucleotide-binding Reference proteome Signal Zinc
MRPAAATAPK
MRPAAATAPKWLLLALSALLPLWPTAKSWELTIMHTNDVHSRLEQTSDDSTKCLNASLCVGGVARLFTKVQQIRKEEPNVLLLDAGDQYQGTIWFTVYKGLEVAHFMNLLGYDAMALGNHEFDNGVEGLIDPLLRNVKFPILSANIKARGPLAPQISGLYLPYKVLSVGGEVVGIVGYTSKETPFLSNPGTNLVFEDEVTALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHTNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKVEFDDKGNVVTSYGNPILLNSTIREDA...
adenosine biosynthetic process adenosine metabolic process ADP catabolic process AMP catabolic process ATP metabolic process calcium ion homeostasis inhibition of non-skeletal tissue mineralization leukocyte cell-cell adhesion negative regulation of inflammatory response positive regulation of lipid biosynthetic proces...
adenosine biosynthetic process ADP catabolic process AMP catabolic process ATP metabolic process calcium ion homeostasis DNA metabolic process inhibition of non-skeletal tissue mineralization leukocyte cell-cell adhesion negative regulation of inflammatory response response to ATP response to inorganic substance
cell surface; cytosol; external side of plasma membrane; extracellular exosome; membrane; nucleoplasm; plasma membrane
5'-deoxynucleotidase activity 5'-nucleotidase activity GMP 5'-nucleotidase activity identical protein binding IMP 5'-nucleotidase activity nucleotide binding thymidylate 5'-phosphatase activity XMP 5'-nucleosidase activity zinc ion binding
Homo sapiens
3D-structure Alternative splicing Cell membrane Direct protein sequencing Disease variant Disulfide bond Glycoprotein GPI-anchor Hydrolase Lipoprotein Membrane Metal-binding Nucleotide-binding Reference proteome Signal Zinc
MCPRAARAPA
MCPRAARAPATLLLALGAVLWPAAGAWELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKIEFDERGNVISSHGNPILLNSSIPEDPSI...
adenosine biosynthetic process ADP catabolic process AMP catabolic process ATP metabolic process calcium ion homeostasis DNA metabolic process inhibition of non-skeletal tissue mineralization leukocyte cell-cell adhesion negative regulation of inflammatory response response to ATP response to inorganic substance cell s...
heme A biosynthetic process
mitochondrial membrane; mitochondrion
protoheme IX farnesyltransferase activity
Saccharomyces cerevisiae
Heme biosynthesis Membrane Mitochondrion Reference proteome Transferase Transit peptide Transmembrane Transmembrane helix
MSYFPRTYAH
MSYFPRTYAHLMRNVLAHNKGNIYLQIGTQLHDTQIKIRFNGVRYISRNHGGKQQHINTAPIEFTPNFGYGDRTSNCNKKVESTAMKTLRCTDDISTSSGSEATTDASTQLPFNVKLVDPMVRKSKRPSHAISEGLNMKTLKKKVIMPYLQLTKPRLTILVMLSAICSYALSPYPASVNELLCLTVGTTLCSGSANAINMGREPEFDRQMVRTQARPVVRGDVTPTQAFEFAALIGTLGVSILYFGVNPTVAILGASNIALYGWAYTSMKRKHIINTWLGALVGMVPPLMGWAAASPLSHPGSWCLAGLLFAWQFPHFNT...
heme A biosynthetic process mitochondrial membrane; mitochondrion protoheme IX farnesyltransferase activity Saccharomyces cerevisiae Heme biosynthesis Membrane Mitochondrion Reference proteome Transferase Transit peptide Transmembrane Transmembrane helix MSYFPRTYAH MSYFPRTYAHLMRNVLAHNKGNIYLQIGTQLHDTQIKIRFNGVRYISRNHGGK...
glycolytic process phosphorylation
cytoplasm; cytosol; pyruvate kinase complex
AMP binding ATP binding identical protein binding kinase activity magnesium ion binding potassium ion binding pyruvate kinase activity
Escherichia coli
3D-structure Acetylation Allosteric enzyme ATP-binding Direct protein sequencing Glycolysis Kinase Magnesium Metal-binding Nucleotide-binding Potassium Pyruvate Reference proteome Transferase
MSRRLRRTKI
MSRRLRRTKIVTTLGPATDRDNNLEKVIAAGANVVRMNFSHGSPEDHKMRADKVREIAAKLGRHVAILGDLQGPKIRVSTFKEGKVFLNIGDKFLLDANLGKGEGDKEKVGIDYKGLPADVVPGDILLLDDGRVQLKVLEVQGMKVFTEVTVGGPLSNNKGINKLGGGLSAEALTEKDKADIKTAALIGVDYLAVSFPRCGEDLNYARRLARDAGCDAKIVAKVERAEAVCSQDAMDDIILASDVVMVARGDLGVEIGDPELVGIQKALIRRARQLNRAVITATQMMESMITNPMPTRAEVMDVANAVLDGTDAVMLSAE...
glycolytic process phosphorylation cytoplasm; cytosol; pyruvate kinase complex AMP binding ATP binding identical protein binding kinase activity magnesium ion binding potassium ion binding pyruvate kinase activity Escherichia coli 3D-structure Acetylation Allosteric enzyme ATP-binding Direct protein sequencing Glycolys...
DNA-templated transcription DNA-templated viral transcription
DNA-directed RNA polymerase complex; host cell cytoplasm; virion component
DNA binding DNA-directed 5'-3' RNA polymerase activity zinc ion binding
Vaccinia virus )
Alternative initiation DNA-directed RNA polymerase Early protein Host cytoplasm Metal-binding Nucleotidyltransferase Reference proteome Transcription Transferase Virion Zinc Zinc-finger
MENVYISSYS
MENVYISSYSSNEQTSMAVTATDIRELLSQYVDDANLEDLIEWAMEKSSKYYIKNIGNTKSNIEETKFESKNNIGIEYSKDSRNKLSYRNKPSIATNLEYKTLCDMIKGTSGTEKEFLRYLLFGIKCIKKGVEYNIDKIKDVSYNDYFNVLDEKYNTPCPNCKSRNTTPMMIQTRAADEPPLVRHACRDCKQHFKPPKFRAFRNLNVTTQSIHENKEITEILPDNNPSPPESPEPASPIDDGLIRATFDRNDEPPEDDE
DNA-templated transcription DNA-templated viral transcription DNA-directed RNA polymerase complex; host cell cytoplasm; virion component DNA binding DNA-directed 5'-3' RNA polymerase activity zinc ion binding Vaccinia virus )Alternative initiation DNA-directed RNA polymerase Early protein Host cytoplasm Metal-binding...
evasion of host immune response perturbation by virus of host apoptosis suppression by virus of host apoptotic process suppression by virus of host ISG15-protein conjugation suppression by virus of host PKR signaling suppression by virus of host type I interferon production suppression by virus of host type I interfero...
cytoplasm
double-stranded RNA adenosine deaminase activity double-stranded RNA binding protein sequestering activity protein serine/threonine kinase inhibitor activity RNA binding
Vaccinia virus )
3D-structure Alternative initiation Direct protein sequencing Host-virus interaction Inhibition of host innate immune response by virus Inhibition of host interferon signaling pathway by virus Inhibition of host IRF3 by virus Inhibition of host IRF7 by virus Inhibition of host ISG15 by virus Inhibition of host PKR by v...
MSKIYIDERS
MSKIYIDERSNAEIVCEAIKTIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMTTEADKPDADAMADVIIDDVSREKSMREDHKSFDDVIPAKKIIDWKGANPVTVINEYCQITRRDWSFRIESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLAVDKLLGYVIIRF
evasion of host immune response perturbation by virus of host apoptosis suppression by virus of host apoptotic process suppression by virus of host ISG15-protein conjugation suppression by virus of host PKR signaling suppression by virus of host type I interferon production suppression by virus of host type I interfero...
amyloid fibril formation antigen processing and presentation of endogenous peptide antigen via MHC class I antigen processing and presentation of exogenous peptide antigen via MHC class II cellular response to iron ion cellular response to nicotine immune response intracellular iron ion homeostasis learning or memory n...
cytosol; extracellular region; Golgi apparatus; HFE-transferrin receptor complex; late endosome membrane; lysosomal membrane; MHC class I peptide loading complex; MHC class I protein complex; MHC class II protein complex
MHC class II protein complex binding peptide antigen binding protein homodimerization activity structural molecule activity
Gallus gallus
3D-structure Direct protein sequencing Disulfide bond Immunity Immunoglobulin domain MHC I Reference proteome Secreted Signal
MGKAAAVVLV
MGKAAAVVLVTLVALLGLAQADLTPKVQVYSRFPASAGTKNVLNCFAAGFHPPKISITLMKDGVPMEGAQYSDMSFNDDWTFQRLVHADFTPSSGSTYACKVEHETLKEPQVYKWDPEF
amyloid fibril formation antigen processing and presentation of endogenous peptide antigen via MHC class I antigen processing and presentation of exogenous peptide antigen via MHC class II cellular response to iron ion cellular response to nicotine immune response intracellular iron ion homeostasis learning or memory n...
vitamin D metabolic process
axon; cytoplasm; extracellular space; perinuclear region of cytoplasm
actin binding calcidiol binding vitamin D binding vitamin transmembrane transporter activity
Mus musculus
Actin-binding Direct protein sequencing Disulfide bond Glycoprotein Phosphoprotein Reference proteome Repeat Secreted Signal Transport Vitamin D
MKRVLVLLLA
MKRVLVLLLALAFGHALERGRDYEKDKVCNELAMLGKEDFRSLSLILYSRKFSSSTFEQVNQLVKEVVSLTEECCAEGADPTCYDTRTSELSVKSCESDAPFPVHPGTPECCTKEGLERKLCMAALSHQPQEFPTYVEPTNDEICEAFRRDPKGFADQFLYEYSSNYGQAPLPLLVAYTKNYLSMVGSCCTSANPTVCFVKERLQMKHLSLLTTMSNRVCSQYAAYGKEKSRLSHLIKLAQKVPTANLENVLPLAEDFTEILSRCCESTSEDCMASELPEHTIKICQNLSKKNSKFEECCQENTPMNIFMCTYFMPAAEP...
vitamin D metabolic process axon; cytoplasm; extracellular space; perinuclear region of cytoplasm actin binding calcidiol binding vitamin D binding vitamin transmembrane transporter activity Mus musculus Actin-binding Direct protein sequencing Disulfide bond Glycoprotein Phosphoprotein Reference proteome Repeat Secrete...
heterochromatin formation nuclear envelope organization nuclear migration nuclear pore localization protein localization to nuclear envelope
lamin filament; nuclear envelope; nuclear lamina; nuclear membrane; nuclear periphery; nucleus
identical protein binding structural constituent of cytoskeleton
Mus musculus
Acetylation Alternative splicing Coiled coil Direct protein sequencing Intermediate filament Isopeptide bond Lipoprotein Methylation Nucleus Phosphoprotein Prenylation Reference proteome Ubl conjugation
MASLPPHAGP
MASLPPHAGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELENDRLLLRISEKEEVTTREVSGIKTLYESELADARRVLDETARERARLQIEIGKVQAELEEARKSAKKREGELTVAQGRVKDLESLFHRSEAELATALSDKQGLETEVAELRAQLAKAEDGHAVAKKQLEKETLMRVDLENRCQSLQEELAFSKSVFEEEVRETRRRHERRLVEVDSSRQQEYDFKMAQALEDLRSQHDEQVRLYRVELEQTYQAKLDNAKLLSDQNDKAAHAAREELKEARMRVESLSYQLLGLQKQASAAENHIHELEEAL...
heterochromatin formation nuclear envelope organization nuclear migration nuclear pore localization protein localization to nuclear envelope lamin filament; nuclear envelope; nuclear lamina; nuclear membrane; nuclear periphery; nucleus identical protein binding structural constituent of cytoskeleton Mus musculus Acetyl...
cellular response to dexamethasone stimulus cellular response to ethanol cellular response to glucose stimulus cellular response to insulin stimulus egg-laying behavior eggshell formation embryo development ending in birth or egg hatching embryonic organ morphogenesis gluconeogenesis glucose catabolic process to lactat...
cytosol; mitochondrial matrix
GTP binding manganese ion binding phosphoenolpyruvate carboxykinase (GTP) activity
Gallus gallus
3D-structure Decarboxylase Direct protein sequencing Gluconeogenesis GTP-binding Lyase Manganese Metal-binding Mitochondrion Nucleotide-binding Reference proteome Transit peptide
MFWLRGGAQS
MFWLRGGAQSCRGGETEDRMQRGMWGVGLARRRLSTSLSALPAAARDFVEEAVRLCRPREVLLCDGSEEEGKELLRGLQDDGVLHPLPKYDNCWLARTDPRDVARVESKTVLVTPEQSDAVPPPPPSGGPPQLGNWMSPNAFQAAVQERFPGCMAGRPLYVIPFSMGPPTSPLAKLGVQVTDSPYVVLSMRIMTRVGPAVLQRLDDDFVRCLHSVGRPLPLTEPLVSSWPCDRSPVLVAHIPSERRIVSFGSGYGGNSLLGKKCFALRIASRMAQQQGWLAEHMLILGVTSPSGEKRYMAAAFPSACGKTNLAMMTPSLP...
cellular response to dexamethasone stimulus cellular response to ethanol cellular response to glucose stimulus cellular response to insulin stimulus egg-laying behavior eggshell formation embryo development ending in birth or egg hatching embryonic organ morphogenesis gluconeogenesis glucose catabolic process to lactat...
lipid A biosynthetic process response to antibiotic
cytoplasm; cytosol
identical protein binding N-acyltransferase activity UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase activity
Escherichia coli
3D-structure Acyltransferase Antibiotic resistance Direct protein sequencing Lipid A biosynthesis Lipid biosynthesis Lipid metabolism Reference proteome Repeat Transferase
MPSIRLADLA
MPSIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALV...
lipid A biosynthetic process response to antibiotic cytoplasm; cytosol identical protein binding N-acyltransferase activity UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase activity Escherichia coli 3D-structure Acyltransferase Antibiotic resistance Direct protein sequencing Lipid A biosynthesis Lipid biosy...
meiotic DNA double-strand break formation reciprocal meiotic recombination
condensed nuclear chromosome; nucleus
identical protein binding
Saccharomyces cerevisiae
Chromosome DNA recombination Meiosis Nucleus Phosphoprotein Reference proteome
MVARGRTDEI
MVARGRTDEISTDVSEANSEHSLMITETSSPFRSIFSHSGKVANAGALEESDKQILEWAGKLELESMELRENSDKLIKVLNENSKTLCKSLNKFNQLLEQDAATNGNVKTLIKDLASQIENQLDKVSTAMLSKGDEKKTKSDSSYRQVLVEEISRYNSKITRHVTNKQHETEKSMRCTQEMLFNVGSQLEDVHKVLLSLSKDMHSLQTRQTALEMAFREKADHAYDRPDVSLNGTTLLHDMDEAHDKQRKKSVPPPRMMVTRSMKRRRSSSPTLSTSQNHNSEDNDDASHRLKRAARTIIPWEELRPDTLESEL
meiotic DNA double-strand break formation reciprocal meiotic recombination condensed nuclear chromosome; nucleus identical protein binding Saccharomyces cerevisiae Chromosome DNA recombination Meiosis Nucleus Phosphoprotein Reference proteome MVARGRTDEI MVARGRTDEISTDVSEANSEHSLMITETSSPFRSIFSHSGKVANAGALEESDKQILEWAGKLELE...
angiogenesis animal organ morphogenesis cartilage condensation cell differentiation fibroblast growth factor receptor signaling pathway myoblast differentiation positive regulation of cell division positive regulation of cell population proliferation positive regulation of gene expression positive regulation of protein...
cytoplasm; extracellular space; sarcolemma
fibroblast growth factor receptor binding growth factor activity
Mus musculus
Angiogenesis Developmental protein Differentiation Disulfide bond Glycoprotein Growth factor Mitogen Proto-oncogene Reference proteome Secreted Signal
MALGQRLFIT
MALGQRLFITMSRGAGRVQGTLQALVFLGVLVGMVVPSPAGARANGTLLDSRGWGTLLSRSRAGLAGEISGVNWESGYLVGIKRQRRLYCNVGIGFHLQVPPDGRISGTHEENPYSLLEISTVERGVVSLFGVKSALFIAMNSKGRLYTTPSFHDECKFRETLLPNNYNAYESDLYRGTYIALSKYGRVKRGSKVSPIMTVTHFLPRI
angiogenesis animal organ morphogenesis cartilage condensation cell differentiation fibroblast growth factor receptor signaling pathway myoblast differentiation positive regulation of cell division positive regulation of cell population proliferation positive regulation of gene expression positive regulation of protein...
enkephalin processing insulin processing islet amyloid polypeptide processing nervous system development peptide hormone processing protein autoprocessing protein processing proteolysis
dendrite; endoplasmic reticulum lumen; extracellular space; intracellular membrane-bounded organelle; membrane; neuron projection; neuronal cell body; nucleoplasm; perikaryon; secretory granule; secretory granule lumen; transport vesicle
endopeptidase activity serine-type endopeptidase activity
Mus musculus
Cleavage on pair of basic residues Cytoplasmic vesicle Disulfide bond Glycoprotein Hydrolase Protease Reference proteome Secreted Serine protease Signal Zymogen
MEGGCGSQWK
MEGGCGSQWKAAGFLFCVMVFASAERPVFTNHFLVELHKDGEEEARQVAAEHGFGVRKLPFAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNADASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDG...
enkephalin processing insulin processing islet amyloid polypeptide processing nervous system development peptide hormone processing protein autoprocessing protein processing proteolysis dendrite; endoplasmic reticulum lumen; extracellular space; intracellular membrane-bounded organelle; membrane; neuron projection; neu...
deoxyribonucleotide biosynthetic process DNA replication
cytoplasm; mitochondrion; ribonucleoside-diphosphate reductase complex
ATP binding ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor
Saccharomyces cerevisiae
Allosteric enzyme ATP-binding Cytoplasm Deoxyribonucleotide synthesis Disulfide bond Isopeptide bond Nucleotide-binding Oxidoreductase Phosphoprotein Reference proteome Ubl conjugation
MYVIKRDGRK
MYVIKRDGRKEPVQFDKITSRITRLSYGLDPNRIDAVKVTQRIISGVYSGVTTVELDNLAAETCAYMTTVHPDYATLAARIAISNLHKQTTKQFSKVIEDLHDWINPATGKHAPMISDEIYNIVMENKDTLNSAIVYDRDFQYTYFGFKTLERSYLLRLNGEVAERPQHLVMRVALGIHGSDIESVLKTYNLMSLRYFTHASPTLFNAGTPHPQMSSCFLIAMKDDSIEGIYDTLKECAMISKTAGGVGLHINNIRSTGSYIAGTNGTSNGLIPMIRVFNNTARYVDQGGNKRPGAFALFLEPWHADIFDFVDIRKTHGK...
deoxyribonucleotide biosynthetic process DNA replication cytoplasm; mitochondrion; ribonucleoside-diphosphate reductase complex ATP binding ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor Saccharomyces cerevisiae Allosteric enzyme ATP-binding Cytoplasm Deoxyribonucleotide synthesis Dis...
angiogenesis polyamine biosynthetic process putrescine catabolic process spermidine acetylation
cytosol
diamine N-acetyltransferase activity identical protein binding N-acetyltransferase activity spermidine binding
Homo sapiens
3D-structure Acyltransferase Cytoplasm Direct protein sequencing Reference proteome Transferase
MAKFVIRPAT
MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
angiogenesis polyamine biosynthetic process putrescine catabolic process spermidine acetylation cytosol diamine N-acetyltransferase activity identical protein binding N-acetyltransferase activity spermidine binding Homo sapiens 3D-structure Acyltransferase Cytoplasm Direct protein sequencing Reference proteome Transfer...
ameloblast differentiation BMP signaling pathway cell differentiation cellular response to growth factor stimulus female gonad development gamete generation hair follicle morphogenesis hematopoietic progenitor cell differentiation keratinocyte proliferation negative regulation of activin receptor signaling pathway nega...
cytoplasm; extracellular space; nucleus
activin binding activin receptor antagonist activity heparan sulfate proteoglycan binding
Rattus norvegicus
3D-structure Disulfide bond Glycoprotein Reference proteome Repeat Secreted Signal
MVCARHQPGG
MVCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQSLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSIS...
ameloblast differentiation BMP signaling pathway cell differentiation cellular response to growth factor stimulus female gonad development gamete generation hair follicle morphogenesis hematopoietic progenitor cell differentiation keratinocyte proliferation negative regulation of activin receptor signaling pathway nega...
B cell lineage commitment cell development chromatin remodeling gastrulation gene expression immunoglobulin V(D)J recombination lymphocyte differentiation natural killer cell differentiation negative regulation of transcription by RNA polymerase II Peyer's patch development positive regulation of B cell proliferation p...
chromatin; cytoplasm; cytosol; euchromatin; nucleosome; nucleus; protein-containing complex; RNA polymerase II transcription regulator complex; transcription regulator complex
bHLH transcription factor binding chromatin binding cis-regulatory region sequence-specific DNA binding DNA binding DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific DNA-binding transcr...
Rattus norvegicus
Alternative splicing DNA-binding Isopeptide bond Methylation Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation Ubl conjugation
MMNQSQRMAP
MMNQSQRMAPVGSDKELSDLLDFSMMFPLPVANGKGRPASLAGTQFAGSGLEDRPSSESWGNSEQNSSSFDPSRAYSEGAHFSDSHSSLPPSTFLGAGLGGKGSERNAYATFGRDTSVGTLSQAGFLPGELGLSSPGPLSPSGVKSSSQYYTSFPSNPRRRAADGGLDTQPKKVRKVPPGLPSSVYPSSSGDNYSRDATAYPSAKTPSSAYPSPFYVADGSLHPSAELWSPPGQVGFGPMLGDGSAPLPLAPGSSSVSSGAFGGLQQQDRMGYQLHGSEVNGTLPAVSSFSAAPGTYSGTSGHTPPVSGADSLLGTRGTT...
B cell lineage commitment cell development chromatin remodeling gastrulation gene expression immunoglobulin V(D)J recombination lymphocyte differentiation natural killer cell differentiation negative regulation of transcription by RNA polymerase II Peyer's patch development positive regulation of B cell proliferation p...
heterochromatin formation silent mating-type cassette heterochromatin formation
chromatin silencing complex; chromosome, centromeric region
chromatin binding
Saccharomyces cerevisiae
3D-structure Centromere Chromosome Nucleus Reference proteome Repressor Transcription Transcription regulation
MLQINSRLAV
MLQINSRLAVIDGWLVDTVKRKPINFRSPEVRLLLPNDDDYKKLSQQNLVDWTRLKKDSNSVLVGVKSMELFKHIKLVLREFFLLEDGRIILKRIRSKLRYKVVKKLTCKCCRLYLPKWGTVYIHPMLKDKEKPLAGVCEFSLDVNPDREYPLIEINVSHQYIIIEGFLLYLNERRLYRWNDNNLRSQVGLTKWAHLRKTYNPVSLDILYSLNSNFYFVKDDLLFQLLGKRVFVKFCKVMENGKCGKAPLWYRVKRTTTAKATHIAYAISNSTAPDSFKSKNNDYRFIVREKPIVENTISNLDYSDIKKQQFTEAEVVKR...
heterochromatin formation silent mating-type cassette heterochromatin formation chromatin silencing complex; chromosome, centromeric region chromatin binding Saccharomyces cerevisiae 3D-structure Centromere Chromosome Nucleus Reference proteome Repressor Transcription Transcription regulation MLQINSRLAV MLQINSRLAVIDGW...
cellular response to UV-A collagen catabolic process extracellular matrix organization positive regulation of protein-containing complex assembly proteolysis
extracellular matrix; extracellular space
metalloendopeptidase activity peptidase activity zinc ion binding
Sus scrofa
3D-structure Autocatalytic cleavage Calcium Collagen degradation Direct protein sequencing Disulfide bond Extracellular matrix Glycoprotein Hydrolase Metal-binding Metalloprotease Phosphoprotein Protease Reference proteome Repeat Secreted Signal Zinc Zymogen
MFSLLLLLLL
MFSLLLLLLLLCNTGSHGFPAATSETQEQDVEIVQKYLKNYYNLNSDGVPVEKKRNSGLVVEKLKQMQQFFGLKVTGKPDAETLNVMKQPRCGVPDVAEFVLTPGNPRWENTHLTYRIENYTPDLSREDVDRAIEKAFQLWSNVSPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTKNFRDYNLYRVAAHELGHSLGLSHSTDIGALMYPNYIYTGDVQLSQDDIDGIQAIYGPSENPVQPSGPQTPQVCDSKLTFDAITTLRGELMFFKDRFYMRTNSFYPEVELNFISVF...
cellular response to UV-A collagen catabolic process extracellular matrix organization positive regulation of protein-containing complex assembly proteolysis extracellular matrix; extracellular space metalloendopeptidase activity peptidase activity zinc ion binding Sus scrofa 3D-structure Autocatalytic cleavage Calcium...
ribosome biogenesis
cytosol
3'-5' RNA helicase activity ADP binding ATP binding ATP hydrolysis activity DNA/RNA helicase activity RNA helicase activity rRNA binding
Escherichia coli
3D-structure ATP-binding Cytoplasm Helicase Hydrolase Nucleotide-binding Reference proteome Ribosome biogenesis RNA-binding
MTAFSTLNVL
MTAFSTLNVLPPAQLTNLNELGYLTMTPVQAAALPAILAGKDVRVQAKTGSGKTAAFGLGLLQQIDASLFQTQALVLCPTRELADQVAGELRRLARFLPNTKILTLCGGQPFGMQRDSLQHAPHIIVATPGRLLDHLQKGTVSLDALNTLVMDEADRMLDMGFSDAIDDVIRFAPASRQTLLFSATWPEAIAAISGRVQRDPLAIEIDSTDALPPIEQQFYETSSKGKIPLLQRLLSLHQPSSCVVFCNTKKDCQAVCDALNEVGQSALSLHGDLEQRDRDQTLVRFANGSARVLVATDVAARGLDIKSLELVVNFELAW...
ribosome biogenesis cytosol 3'-5' RNA helicase activity ADP binding ATP binding ATP hydrolysis activity DNA/RNA helicase activity RNA helicase activity rRNA binding Escherichia coli 3D-structure ATP-binding Cytoplasm Helicase Hydrolase Nucleotide-binding Reference proteome Ribosome biogenesis RNA-binding MTAFSTLNVL MTA...
negative stranded viral RNA replication suppression by virus of host gene expression suppression by virus of host PKR signaling suppression by virus of host transcription suppression by virus of host transcription initiation from RNA polymerase II promoter suppression by virus of host type I interferon production suppr...
host cell cytoplasm; host cell nucleus
protein serine/threonine kinase inhibitor activity
Rift valley fever virus
3D-structure Eukaryotic host gene expression shutoff by virus Eukaryotic host transcription shutoff by virus Host cytoplasm Host gene expression shutoff by virus Host nucleus Host-virus interaction Inhibition of eukaryotic host transcription initiation by virus Inhibition of host innate immune response by virus Inhibit...
MDYFPVISVD
MDYFPVISVDLQSGRRVVSVEYFRGDGPPRIPYSMVGPCCVFLMHHRPSHEVRLRFSDFYNVGEFPYRVGLGDFASNVAPPPAKPFQRLIDLIGHMTLSDFTRFPNLKEAISWPLGEPSLAFFDLSSTRVHRNDDIRRDQIATLAMRSCKITNDLEDSFVGLHRMIATEAILRGIDLCLLPGFDLMYEVAHVQCVRLLQAAKEDISNAVVPNSALIVLMEESLMLRSSLPSMMGRNNWIPVIPPIPDVEMESEEESDDDGFVEVD
negative stranded viral RNA replication suppression by virus of host gene expression suppression by virus of host PKR signaling suppression by virus of host transcription suppression by virus of host transcription initiation from RNA polymerase II promoter suppression by virus of host type I interferon production suppr...
apoptotic process DNA catabolic process neutrophil activation involved in immune response regulation of acute inflammatory response regulation of neutrophil mediated cytotoxicity
extracellular region; nuclear envelope; nucleus; zymogen granule
actin binding deoxyribonuclease I activity DNA binding DNA nuclease activity
Rattus norvegicus
Actin-binding Apoptosis Calcium Cytoplasmic vesicle Disulfide bond Endonuclease Glycoprotein Hydrolase Nuclease Nucleus Reference proteome Secreted Signal
MRYTGLMGIL
MRYTGLMGILLTLVNLLQLAATLRIAAFNIRTFGDTKMSNATLSSYIVKILSRYDIAVVQEVRDTHLVAVGKLLDELNRDIPDNYRYIISEPLGRKSYKEQYLFVYRPSQVSVLDSYHYDDGCEPCGNDTFSREPAIVKFFSPYTEVREFAIVPLHSAPTEAVSEIDALYDVYLDVRQKWGLEDIMFMGDFNAGCSYVTSSQWSSIRLRTSPIFQWLIPDSADTTATSTHCAYDRIVVAGALLQAAVVPSSAVPFDFQAEYRLTNQMAEAISDHYPVEVTLRKT
apoptotic process DNA catabolic process neutrophil activation involved in immune response regulation of acute inflammatory response regulation of neutrophil mediated cytotoxicity extracellular region; nuclear envelope; nucleus; zymogen granule actin binding deoxyribonuclease I activity DNA binding DNA nuclease activity...
activation of GTPase activity angiogenesis cell surface receptor signaling pathway ephrin receptor signaling pathway negative regulation of cell migration negative regulation of protein kinase activity peptidyl-tyrosine phosphorylation positive regulation of angiogenesis positive regulation of cell migration positive r...
plasma membrane; receptor complex
ATP binding fibronectin binding protein kinase activity protein kinase binding transmembrane receptor protein tyrosine kinase activity transmembrane-ephrin receptor activity
Homo sapiens
3D-structure Alternative splicing Angiogenesis ATP-binding Cell adhesion Cell membrane Glycoprotein Kinase Membrane Nucleotide-binding Phosphoprotein Receptor Reference proteome Repeat Signal Transferase Transmembrane Transmembrane helix Tyrosine-protein kinase Ubl conjugation
MERRWPLGLG
MERRWPLGLGLVLLLCAPLPPGARAKEVTLMDTSKAQGELGWLLDPPKDGWSEQQQILNGTPLYMYQDCPMQGRRDTDHWLRSNWIYRGEEASRVHVELQFTVRDCKSFPGGAGPLGCKETFNLLYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDLVSGSVKLNVERCSLGRLTRRGLYLAFHNPGACVALVSVRVFYQRCPETLNGLAQFPDTLPGPAGLVEVAGTCLPHARASPRPSGAPRMHCSPDGEWLVPVGRCHCEPGYEEGGSGEACVACPSGSYRMDMDTPHCLTCPQQSTAESEGATICTCESGHYRA...
activation of GTPase activity angiogenesis cell surface receptor signaling pathway ephrin receptor signaling pathway negative regulation of cell migration negative regulation of protein kinase activity peptidyl-tyrosine phosphorylation positive regulation of angiogenesis positive regulation of cell migration positive r...
G protein-coupled receptor signaling pathway learning or memory motor behavior phospholipase C-activating G protein-coupled receptor signaling pathway positive regulation of behavioral fear response positive regulation of respiratory gaseous exchange psychomotor behavior regulation of cell population proliferation resp...
plasma membrane
bombesin receptor activity G protein-coupled peptide receptor activity G protein-coupled receptor activity neuropeptide binding neuropeptide receptor activity
Mus musculus
Cell membrane Direct protein sequencing Disulfide bond G-protein coupled receptor Glycoprotein Lipoprotein Membrane Palmitate Phosphoprotein Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MAPNNCSHLN
MAPNNCSHLNLDVDPFLSCNDTFNQSLSPPKMDNWFHPGFIYVIPAVYGLIIVIGLIGNITLIKIFCTVKSMRNVPNLFISSLALGDLLLLVTCAPVDASKYLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAALIWIVSMLLAIPEAVFSDLHPFHVKDTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLAIISVYYYFIARNLIQSAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLHFVTSICARLLAFTNSCVNP...
G protein-coupled receptor signaling pathway learning or memory motor behavior phospholipase C-activating G protein-coupled receptor signaling pathway positive regulation of behavioral fear response positive regulation of respiratory gaseous exchange psychomotor behavior regulation of cell population proliferation resp...
activation of phospholipase C activity amyloid-beta clearance astrocyte activation cellular defense response chemotaxis cognition complement component C5a signaling pathway complement receptor mediated signaling pathway defense response to Gram-positive bacterium immune response inflammatory response microglial cell ac...
apical part of cell; basolateral plasma membrane; plasma membrane; secretory granule membrane
complement component C5a receptor activity G protein-coupled receptor activity
Homo sapiens
3D-structure Cell membrane Chemotaxis Cytoplasmic vesicle Disulfide bond G-protein coupled receptor Glycoprotein Membrane Phosphoprotein Receptor Reference proteome Sulfation Transducer Transmembrane Transmembrane helix
MDSFNYTTPD
MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNMYASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLR...
activation of phospholipase C activity amyloid-beta clearance astrocyte activation cellular defense response chemotaxis cognition complement component C5a signaling pathway complement receptor mediated signaling pathway defense response to Gram-positive bacterium immune response inflammatory response microglial cell ac...
adenylate cyclase-activating G protein-coupled receptor signaling pathway cellular response to lipopolysaccharide G protein-coupled receptor signaling pathway inflammatory response negative regulation of cell migration involved in sprouting angiogenesis positive regulation of angiogenesis positive regulation of blood c...
acrosomal vesicle; nuclear speck; plasma membrane
guanyl-nucleotide exchange factor activity thromboxane A2 receptor activity
Homo sapiens
Alternative splicing Cell membrane Direct protein sequencing Disease variant Disulfide bond G-protein coupled receptor Glycoprotein Membrane Phosphoprotein Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MWPNGSSLGP
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTRSSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPLLLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPGSWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSEVEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWNQILDPWVYILFRRAVLRRLQ...
adenylate cyclase-activating G protein-coupled receptor signaling pathway cellular response to lipopolysaccharide G protein-coupled receptor signaling pathway inflammatory response negative regulation of cell migration involved in sprouting angiogenesis positive regulation of angiogenesis positive regulation of blood c...