Biological Process
stringlengths
7
1.01k
Cellular Component
stringlengths
6
867
Molecular Function
stringlengths
11
871
Organism
stringlengths
8
73
Keywords
stringlengths
1
810
Sequence 10
stringlengths
5
10
Sequence
stringlengths
5
1.02k
Combined
stringlengths
136
3.91k
proteasome-mediated ubiquitin-dependent protein catabolic process protein polyubiquitination ubiquitin-dependent ERAD pathway ubiquitin-dependent protein catabolic process vesicle organization
cytosol; nucleus
ATP binding proteasome binding ubiquitin conjugating enzyme activity ubiquitin-protein transferase activity
Saccharomyces cerevisiae
3D-structure ATP-binding Isopeptide bond Nucleotide-binding Reference proteome Stress response Transferase Ubl conjugation Ubl conjugation pathway
MSRAKRIMKE
MSRAKRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDRESFNKTAALWTRLYASETSNGQKGNVEESDLYGIDHDLIDEFESQGFEKDKIVEVLRRLGVKSLDPNDNNTANRIIEELLK
proteasome-mediated ubiquitin-dependent protein catabolic process protein polyubiquitination ubiquitin-dependent ERAD pathway ubiquitin-dependent protein catabolic process vesicle organization cytosol; nucleus ATP binding proteasome binding ubiquitin conjugating enzyme activity ubiquitin-protein transferase activity Sa...
glucose metabolic process insulin receptor signaling pathway phosphatidylinositol-mediated signaling positive regulation of cell growth regulation of insulin-like growth factor receptor signaling pathway response to insulin response to organic cyclic compound tissue regeneration
extracellular space; Golgi apparatus
insulin-like growth factor binding insulin-like growth factor I binding insulin-like growth factor II binding
Rattus norvegicus
Direct protein sequencing Disulfide bond Growth factor binding Phosphoprotein Reference proteome Secreted Signal
MPEFLTVVSW
MPEFLTVVSWPFLILLSFQVRVVAGAPQPWHCAPCTAERLELCPPVPASCPEISRPAGCGCCPTCALPLGAACGVATARCAQGLSCRALPGEPRPLHALTRGQGACVLEPAAPATSSLSGSQHEEAKAAVASEDELAESPEMTEEQLLDSFHLMAPSREDQPILWNAISTYSSMRAREITDLKKWKEPCQRELYKVLERLAAAQQKAGDEIYKFYLPNCNKNGFYHSKQCETSLDGEAGLCWCVYPWSGKKIPGSLETRGDPNCHQYFNVQN
glucose metabolic process insulin receptor signaling pathway phosphatidylinositol-mediated signaling positive regulation of cell growth regulation of insulin-like growth factor receptor signaling pathway response to insulin response to organic cyclic compound tissue regeneration extracellular space; Golgi apparatus ins...
intracellular signal transduction MAPK cascade positive regulation of insulin-like growth factor receptor signaling pathway positive regulation of MAPK cascade regulation of cell growth regulation of glucose metabolic process regulation of growth regulation of insulin-like growth factor receptor signaling pathway respo...
extracellular space
insulin-like growth factor binding insulin-like growth factor I binding insulin-like growth factor II binding
Rattus norvegicus
Direct protein sequencing Disulfide bond Glycoprotein Growth factor binding Phosphoprotein Reference proteome Secreted Signal
MLPFGLVAAL
MLPFGLVAALLLAAGPRPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPRCGSGMRCYPPRGVEKPLRTLMHGQGVCTELSEIEAIQESLQTSDKDESEHPNNSFNPCSAHDHRCLQKHMAKVRDRSKMKVVGTPREEPRPVPQGSCQSELHRALERLAASQSRTHEDLFIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSLQE
intracellular signal transduction MAPK cascade positive regulation of insulin-like growth factor receptor signaling pathway positive regulation of MAPK cascade regulation of cell growth regulation of glucose metabolic process regulation of growth regulation of insulin-like growth factor receptor signaling pathway respo...
binding of sperm to zona pellucida blastocyst formation egg coat formation humoral immune response mediated by circulating immunoglobulin negative regulation of binding of sperm to zona pellucida negative regulation of DNA-templated transcription oocyte development positive regulation of acrosomal vesicle exocytosis po...
collagen-containing extracellular matrix; egg coat; extracellular matrix; extracellular region; extracellular space; plasma membrane
acrosin binding carbohydrate binding extracellular matrix structural constituent identical protein binding receptor ligand activity structural constituent of egg coat
Homo sapiens
Alternative splicing Cell membrane Cleavage on pair of basic residues Disease variant Disulfide bond Extracellular matrix Fertilization Glycoprotein Membrane Pyrrolidone carboxylic acid Receptor Reference proteome Secreted Signal Transmembrane Transmembrane helix
MELSYRLFIC
MELSYRLFICLLLWGSTELCYPQPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLFGTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDPRPVGNLSIVRTNRAEIPIECRYPRQGNVSSQAILPTWLPFRTTVFSEEKLTFSLRLMEENWNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPTPDQNASPYHTIVDFHGCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEGSADICQ...
binding of sperm to zona pellucida blastocyst formation egg coat formation humoral immune response mediated by circulating immunoglobulin negative regulation of binding of sperm to zona pellucida negative regulation of DNA-templated transcription oocyte development positive regulation of acrosomal vesicle exocytosis po...
amyloid-beta clearance cellular response to organic cyclic compound cholesterol transport establishment of localization in cell lipoprotein transport negative regulation of gene expression phagocytosis, engulfment plasma lipoprotein particle clearance positive regulation of cholesterol storage positive regulation of ma...
collagen trimer; endocytic vesicle membrane; low-density lipoprotein particle; membrane; plasma membrane
amyloid-beta binding cargo receptor activity low-density lipoprotein particle binding scavenger receptor activity
Homo sapiens
3D-structure Alternative splicing Coiled coil Collagen Disulfide bond Endocytosis Glycoprotein LDL Membrane Phosphoprotein Receptor Reference proteome Signal-anchor Transmembrane Transmembrane helix
MEQWDHFHNQ
MEQWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSLQEKLKSFKAALIALYLLVFAVLIPLIGIVAAQLLKWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQEEISKLEERVYNVSAEIMAMKEEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQGPPGPPGEKGDRGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGSRGLP...
amyloid-beta clearance cellular response to organic cyclic compound cholesterol transport establishment of localization in cell lipoprotein transport negative regulation of gene expression phagocytosis, engulfment plasma lipoprotein particle clearance positive regulation of cholesterol storage positive regulation of ma...
amyloid-beta clearance cholesterol transport establishment of localization in cell lipoprotein transport negative regulation of gene expression phagocytosis, engulfment plasma lipoprotein particle clearance positive regulation of cholesterol storage positive regulation of macrophage derived foam cell differentiation pr...
collagen trimer; low-density lipoprotein particle; plasma membrane
amyloid-beta binding enzyme binding Hsp70 protein binding Hsp90 protein binding identical protein binding low-density lipoprotein particle binding molecular sequestering activity scavenger receptor activity serine-type endopeptidase activity
Bos taurus
Alternative splicing Coiled coil Collagen Direct protein sequencing Disulfide bond Endocytosis Glycoprotein LDL Membrane Phosphoprotein Receptor Reference proteome Signal-anchor Transmembrane Transmembrane helix
MAQWDDFPDQ
MAQWDDFPDQQEDTDSCTESVKFDARSVTALLPPHPKNGPTLQERMKSYKTALITLYLIVFVVLVPIIGIVAAQLLKWETKNCTVGSVNADISPSPEGKGNGSEDEMRFREAVMERMSNMESRIQYLSDNEANLLDAKNFQNFSITTDQRFNDVLFQLNSLLSSIQEHENIIGDISKSLVGLNTTVLDLQFSIETLNGRVQENAFKQQEEMRKLEERIYNASAEIKSLDEKQVYLEQEIKGEMKLLNNITNDLRLKDWEHSQTLKNITLLQGPPGPPGEKGDRGPPGQNGIPGFPGLIGTPGLKGDRGISGLPGVRGFPG...
amyloid-beta clearance cholesterol transport establishment of localization in cell lipoprotein transport negative regulation of gene expression phagocytosis, engulfment plasma lipoprotein particle clearance positive regulation of cholesterol storage positive regulation of macrophage derived foam cell differentiation pr...
acute-phase response apoptotic process cell differentiation cell population proliferation cellular lipid metabolic process cellular response to linoleic acid chondrocyte differentiation chondrocyte hypertrophy defense response to bacterium embryo development ending in birth or egg hatching fatty acid homeostasis fatty ...
extracellular space
arachidonic acid binding fatty acid binding linoleic acid binding oleic acid binding stearic acid binding
Gallus gallus
3D-structure Antibiotic Antimicrobial Direct protein sequencing Disulfide bond Immunity Innate immunity Iron Reference proteome Secreted Signal Transport
MRTLALSLAL
MRTLALSLALALLCLLHTEAAATVPDRSEVAGKWYIVALASNTDFFLREKGKMKMVMARISFLGEDELEVSYAAPSPKGCRKWETTFKKTSDDGELYYSEEAEKTVEVLDTDYKSYAVIFATRVKDGRTLHMMRLYSRSREVSPTAMAIFRKLARERNYTDEMVAVLPSQEECSVDEV
acute-phase response apoptotic process cell differentiation cell population proliferation cellular lipid metabolic process cellular response to linoleic acid chondrocyte differentiation chondrocyte hypertrophy defense response to bacterium embryo development ending in birth or egg hatching fatty acid homeostasis fatty ...
bile acid metabolic process fatty acid beta-oxidation fatty acid beta-oxidation using acyl-CoA oxidase phenylacetate catabolic process response to nutrient response to steroid hormone response to xenobiotic stimulus very long-chain fatty acid metabolic process
cytosol; peroxisome
acetate CoA-transferase activity acetyl-CoA C-acetyltransferase activity acetyl-CoA C-acyltransferase activity acetyl-CoA C-myristoyltransferase activity palmitoyl-CoA oxidase activity
Rattus norvegicus
Acetylation Acyltransferase Alternative splicing Direct protein sequencing Fatty acid metabolism Lipid metabolism Peroxisome Reference proteome Transferase Transit peptide
MSESVGRTSA
MSESVGRTSAMHRLQVVLGHLAGRPESSSALQAAPCSATFPQASASDVVVVHGRRTPIGRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPECLGDISVGNVLEPGAGAVMARIAQFLSGIPETVPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSNRGNPGNISSRLLESDKARDCLIPMGITSENVAERFGISRQKQDAFALASQQKAASAQSKGCFRAEIVPVTTTVLDDKGDRKTITVSQDEGVRPSTTMEGLAKLKPAFKDGGSTTAGNSSQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVV...
bile acid metabolic process fatty acid beta-oxidation fatty acid beta-oxidation using acyl-CoA oxidase phenylacetate catabolic process response to nutrient response to steroid hormone response to xenobiotic stimulus very long-chain fatty acid metabolic process cytosol; peroxisome acetate CoA-transferase activity acetyl...
B cell differentiation B cell homeostatic proliferation B cell lineage commitment chromatin organization defense response to bacterium DN2 thymocyte differentiation DNA recombination mature B cell differentiation involved in immune response negative regulation of T cell differentiation in thymus organ growth positive r...
DNA recombinase complex; nucleoplasm; nucleus
chromatin binding methylated histone binding phosphatidylinositol binding phosphatidylinositol-3,4,5-trisphosphate binding phosphatidylinositol-3,4-bisphosphate binding phosphatidylinositol-3,5-bisphosphate binding phosphatidylinositol-4,5-bisphosphate binding sequence-specific DNA binding ubiquitin protein ligase acti...
Mus musculus
3D-structure Chromatin regulator DNA recombination Metal-binding Nucleus Reference proteome Zinc Zinc-finger
MSLQMVTVGH
MSLQMVTVGHNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHFDIKQNHLKLKPAIFSKDSCYLPPLRYPATCSYKGSIDSDKHQYIIHGGKTPNNELSDKIYIMSVACKNNKKVTFRCTEKDLVGDVPEPRYGHSIDVVYSRGKSMGVLFGGRSYMPSTQRTTEKWNSVADCLPHVFLIDFEFGCATSYILPELQDGLSFHVSIARNDTVYILGGHSLASNIRPANLYRIRVDLPLGTPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLENQKRMVCSLVSLGDNTIEISEMETPDWTSDIKHSKIWFGS...
B cell differentiation B cell homeostatic proliferation B cell lineage commitment chromatin organization defense response to bacterium DN2 thymocyte differentiation DNA recombination mature B cell differentiation involved in immune response negative regulation of T cell differentiation in thymus organ growth positive r...
monoatomic ion transport negative regulation of monoatomic ion transport neuropeptide signaling pathway positive regulation of juvenile hormone biosynthetic process regulation of heart rate
extracellular region
neuropeptide hormone activity
Manduca sexta
Alternative splicing Amidation Cleavage on pair of basic residues Direct protein sequencing Hormone Ion transport Neuropeptide Secreted Signal Transport
MNLTMQLAVI
MNLTMQLAVIVAVCLCLAEGAPDVRLTRTKQQRPTRGFKNVEMMTARGFGKRDRPHPRAERDVDHQAPSARPNRGTPTFKSPTVGIARDFGKRASQYGNEEEIRVTRGTFKPNSNILIARGYGKRTQLPQIDGVYGLDNFWEMLETSPEREVQEVDEKTLESIPLDWFVNEMLNNPDFARSVVRKFIDLNQDGMLSSEELLRNF
monoatomic ion transport negative regulation of monoatomic ion transport neuropeptide signaling pathway positive regulation of juvenile hormone biosynthetic process regulation of heart rate extracellular region neuropeptide hormone activity Manduca sexta Alternative splicing Amidation Cleavage on pair of basic residue...
negative regulation of angiogenesis negative regulation of collagen fibril organization negative regulation of endothelial cell migration negative regulation of vascular endothelial growth factor signaling pathway positive regulation of macroautophagy positive regulation of mitochondrial depolarization positive regulat...
collagen-containing extracellular matrix; extracellular space
collagen fibril binding extracellular matrix binding glycosaminoglycan binding protein homodimerization activity
Bos taurus
3D-structure Direct protein sequencing Disulfide bond Extracellular matrix Glycoprotein Leucine-rich repeat Proteoglycan Reference proteome Repeat Secreted Signal
MKATIIFLLV
MKATIIFLLVAQVSWAGPFQQKGLFDFMLEDEASGIGPEEHFPEVPEIEPMGPVCPFRCQCHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNT...
negative regulation of angiogenesis negative regulation of collagen fibril organization negative regulation of endothelial cell migration negative regulation of vascular endothelial growth factor signaling pathway positive regulation of macroautophagy positive regulation of mitochondrial depolarization positive regulat...
apoptotic process behavioral fear response epithelial cell differentiation learning monoatomic anion transport negative regulation of apoptotic process negative regulation of calcium import into the mitochondrion negative regulation of reactive oxygen species metabolic process neuron-neuron synaptic transmission positi...
extracellular exosome; membrane; membrane raft; mitochondrial membrane; mitochondrial nucleoid; mitochondrial outer membrane; mitochondrial permeability transition pore complex; mitochondrion; nucleus; plasma membrane; pore complex; synapse
ceramide binding cholesterol binding identical protein binding oxysterol binding phosphatidylcholine binding porin activity protein kinase binding transmembrane transporter binding voltage-gated monoatomic anion channel activity
Homo sapiens
3D-structure Acetylation Apoptosis Cell membrane Direct protein sequencing Host-virus interaction Ion transport Isopeptide bond Lipid-binding Membrane Mitochondrion Mitochondrion outer membrane Phosphoprotein Porin Reference proteome Transmembrane Transmembrane beta strand Transport Ubl conjugation
MAVPPTYADL
MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
apoptotic process behavioral fear response epithelial cell differentiation learning monoatomic anion transport negative regulation of apoptotic process negative regulation of calcium import into the mitochondrion negative regulation of reactive oxygen species metabolic process neuron-neuron synaptic transmission positi...
epicardial cell to mesenchymal cell transition peptidyl-tyrosine phosphorylation positive regulation of cell differentiation positive regulation of cell population proliferation positive regulation of DNA-templated transcription positive regulation of MAP kinase activity positive regulation of phospholipase C activity ...
cytoplasmic vesicle; cytosol; nucleus; plasma membrane; receptor complex
ATP binding fibroblast growth factor binding fibroblast growth factor receptor activity heparin binding
Gallus gallus
ATP-binding Cell membrane Cytoplasm Cytoplasmic vesicle Disulfide bond Glycoprotein Immunoglobulin domain Kinase Membrane Nucleotide-binding Nucleus Phosphoprotein Receptor Reference proteome Repeat Signal Transferase Transmembrane Transmembrane helix Tyrosine-protein kinase Ubl conjugation
MFTWRCLILW
MFTWRCLILWAVLVTATLSAARPAPTLPDQALPKANIEVESHSAHPGDLLQLRCRLRDDVQSINWVRDGVQLPENNRTRITGEEVEVRDAVPEDSGLYACMTNSPSGSETTYFSVNVSDALPSAEDDDDEDDSSSEEKEADNTKPNQAVAPYWTYPEKMEKKLHAVPAAKTVKFKCPSGGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENKYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFVCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKE...
epicardial cell to mesenchymal cell transition peptidyl-tyrosine phosphorylation positive regulation of cell differentiation positive regulation of cell population proliferation positive regulation of DNA-templated transcription positive regulation of MAP kinase activity positive regulation of phospholipase C activity ...
intermediate filament cytoskeleton organization
axon; C-fiber; intermediate filament; neurofilament; neuronal cell body; perikaryon; photoreceptor outer segment; photoreceptor outer segment membrane; plasma membrane; terminal bouton; type III intermediate filament
protein-containing complex binding structural molecule activity
Rattus norvegicus
Cell projection Coiled coil Cytoplasm Cytoskeleton Direct protein sequencing Intermediate filament Nitration Phosphoprotein Reference proteome
MSHHSSGLRS
MSHHSSGLRSSISSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSGSPSSSARLGSFRAPRAGALRLPSERLDFSMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRELRRELELLGRERDRVQVERDGLAEDLGALKQRLEEETRKREDAEHNLVLFRKDVDDATLSRLELERKIESLMDEIEFLKKLHEEELRDLQVSVESQQVQQVEVEATVKPELTAALRDIRAQYENIAAKNLQEAEEWYKSKYADLSDAANRNHEALRQAKQEMNESRRQIQSLT...
intermediate filament cytoskeleton organization axon; C-fiber; intermediate filament; neurofilament; neuronal cell body; perikaryon; photoreceptor outer segment; photoreceptor outer segment membrane; plasma membrane; terminal bouton; type III intermediate filament protein-containing complex binding structural molecule ...
articular cartilage development bone development
cell surface; extracellular matrix; extracellular region; extracellular space; sarcolemma; transport vesicle
cytokine binding extracellular matrix binding glycosaminoglycan binding
Bos taurus
3D-structure Direct protein sequencing Disulfide bond Extracellular matrix Glycoprotein Leucine-rich repeat Proteoglycan Reference proteome Repeat Secreted Signal
MWPLWPLAAL
MWPLWPLAALLALSQALPFEQKAFWDFTLDDGLPMLNDEEASGAETTSGIPDLDSLPPTYSAMCPFGCHCHLRVVQCSDLGLKAVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHTNNITKVGVND...
articular cartilage development bone development cell surface; extracellular matrix; extracellular region; extracellular space; sarcolemma; transport vesicle cytokine binding extracellular matrix binding glycosaminoglycan binding Bos taurus 3D-structure Direct protein sequencing Disulfide bond Extracellular matrix Glyc...
articular cartilage development bone development
cell surface; collagen-containing extracellular matrix; extracellular exosome; extracellular matrix; extracellular region; extracellular space; Golgi lumen; lysosomal lumen; sarcolemma; transport vesicle
cytokine binding extracellular matrix binding extracellular matrix structural constituent extracellular matrix structural constituent conferring compression resistance glycosaminoglycan binding
Homo sapiens
Aortic aneurysm Direct protein sequencing Disease variant Disulfide bond Dwarfism Extracellular matrix Glycoprotein Leucine-rich repeat Proteoglycan Reference proteome Repeat Secreted Signal
MWPLWRLVSL
MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDF...
articular cartilage development bone development cell surface; collagen-containing extracellular matrix; extracellular exosome; extracellular matrix; extracellular region; extracellular space; Golgi lumen; lysosomal lumen; sarcolemma; transport vesicle cytokine binding extracellular matrix binding extracellular matrix ...
proteolysis regulation of angiotensin levels in blood
cytoplasm; extracellular space; intracellular membrane-bounded organelle
peptidase activity serine-type endopeptidase activity
Mus musculus
Direct protein sequencing Disulfide bond Hydrolase Protease Reference proteome Serine protease Signal Zymogen
MQALLFLMAL
MQALLFLMALLLPSGAGAEEIIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE
proteolysis regulation of angiotensin levels in blood cytoplasm; extracellular space; intracellular membrane-bounded organelle peptidase activity serine-type endopeptidase activity Mus musculus Direct protein sequencing Disulfide bond Hydrolase Protease Reference proteome Serine protease Signal Zymogen MQALLFLMAL MQALL...
bone mineralization cell adhesion cellular response to growth factor stimulus extracellular matrix organization osteoblast differentiation positive regulation of cell adhesion
extracellular region; extracellular space; membrane; vesicle
integrin binding small molecule binding
Homo sapiens
Biomineralization Cell adhesion Direct protein sequencing Glycoprotein Phosphoprotein Reference proteome Secreted Sialic acid Signal Sulfation
MKTALILLSI
MKTALILLSILGMACAFSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQGSSDSSEENGDDSSEEEEEEEETSNEGENNEESNEDEDSEAENTTLSATTLGYGEDATPGTGYTGLAAIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYESENGEPRGDNYRAYEDEYSYFKGQGYDGYDGQNYYHHQ
bone mineralization cell adhesion cellular response to growth factor stimulus extracellular matrix organization osteoblast differentiation positive regulation of cell adhesion extracellular region; extracellular space; membrane; vesicle integrin binding small molecule binding Homo sapiens Biomineralization Cell adhesio...
cysteine metabolic process L-cysteine catabolic process L-cysteine metabolic process lactation response to amino acid response to cAMP response to ethanol response to glucagon response to glucocorticoid response to organonitrogen compound taurine biosynthetic process
cytosol
cysteine dioxygenase activity ferrous iron binding nickel cation binding zinc ion binding
Rattus norvegicus
3D-structure Dioxygenase Direct protein sequencing Iron Metal-binding Oxidoreductase Reference proteome Thioether bond
MERTELLKPR
MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN
cysteine metabolic process L-cysteine catabolic process L-cysteine metabolic process lactation response to amino acid response to cAMP response to ethanol response to glucagon response to glucocorticoid response to organonitrogen compound taurine biosynthetic process cytosol cysteine dioxygenase activity ferrous iron b...
cellular response to nerve growth factor stimulus microtubule depolymerization negative regulation of microtubule depolymerization negative regulation of microtubule polymerization negative regulation of neuron projection development neuron projection development positive regulation of microtubule depolymerization posi...
cytoplasm; endosome; Golgi apparatus; growth cone; lamellipodium; membrane; neuron projection; neuronal cell body; perinuclear region of cytoplasm; vesicle
calcium-dependent protein binding tubulin binding
Rattus norvegicus
Cell projection Coiled coil Cytoplasm Endosome Golgi apparatus Lipoprotein Membrane Palmitate Phosphoprotein Reference proteome Ubl conjugation
MAKTAMAYKE
MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEAAEGRRKSQEAQVLKQLAEKREHEREVLQKALEENNNFSKMAEEKLILKMEQIKENREANLAAIIERLQEKERHAAEVRRNKELQVELSG
cellular response to nerve growth factor stimulus microtubule depolymerization negative regulation of microtubule depolymerization negative regulation of microtubule polymerization negative regulation of neuron projection development neuron projection development positive regulation of microtubule depolymerization posi...
post-translational protein targeting to membrane, translocation
endoplasmic reticulum; membrane; rough endoplasmic reticulum membrane; Sec62/Sec63 complex; translocon complex
protein transmembrane transporter activity
Saccharomyces cerevisiae
3D-structure Acetylation Endoplasmic reticulum Membrane Protein transport Reference proteome Translocation Transmembrane Transmembrane helix Transport
MSAVGPGSNA
MSAVGPGSNAGASVNGGSATAIATLLRNHKELKQRQGLFQAKQTDFFRYKRFVRALHSEEYANKSARQPEIYPTIPSNKIEDQLKSREIFIQLIKAQMVIPVKKLHSQECKEHGLKPSKDFPHLIVSNKAQLEADEYFVWNYNPRTYMDYLIVIGVVSIILALVCYPLWPRSMRRGSYYVSLGAFGILAGFFAVAILRLILYVLSLIVYKDVGGFWIFPNLFEDCGVLESFKPLYGFGEKDTYSYKKKLKRMKKKQAKRESNKKKAINEKAEQN
post-translational protein targeting to membrane, translocation endoplasmic reticulum; membrane; rough endoplasmic reticulum membrane; Sec62/Sec63 complex; translocon complex protein transmembrane transporter activity Saccharomyces cerevisiae 3D-structure Acetylation Endoplasmic reticulum Membrane Protein transport Re...
allantoin catabolic process glyoxylate cycle purine nucleobase metabolic process tricarboxylic acid cycle
cytoplasm; cytosol; peroxisomal matrix; peroxisome
malate synthase activity
Saccharomyces cerevisiae
Glyoxylate bypass Peroxisome Purine metabolism Reference proteome Transferase Tricarboxylic acid cycle
MVKISLDNTA
MVKISLDNTALYADIDTTPQFEPSKTTVADILTKDALEFIVLLHRTFNSTRKQLLANRSNLQSKLDSGEYRFDFLPETEQIRNDPTWQGAIPAPGLINRSSEITGPPLRNMLVNALNAEVTTYMTDFEDSSSPTWENMIYGQVNLYDAIRNQIDFKTPRKEYRLKDDISRLPTLIVRPRGWHMVEKHLYIDDEPISASIFDFGLYFYHNAKELVKIGKGPYFYLPKMEHHMEVKLWNDIFCVAQDFIGMPRGTIRATVLIETLPAAFQMEEIIYQIREHSSGLNCGRWDYIFSTIKKLRNLPEHVLPNRDLVTMTSPFMD...
allantoin catabolic process glyoxylate cycle purine nucleobase metabolic process tricarboxylic acid cycle cytoplasm; cytosol; peroxisomal matrix; peroxisome malate synthase activity Saccharomyces cerevisiae Glyoxylate bypass Peroxisome Purine metabolism Reference proteome Transferase Tricarboxylic acid cycle MVKISLDNT...
cell cycle cell division nucleus organization poly(A)+ mRNA export from nucleus protein import into nucleus response to pheromone ribosomal subunit export from nucleus rRNA export from nucleus
chromatin; cytoplasm; nucleus
guanyl-nucleotide exchange factor activity
Saccharomyces cerevisiae
3D-structure Cell cycle Cell division Guanine-nucleotide releasing factor Mitosis Nucleus Pheromone response Phosphoprotein Reference proteome Repeat Transport
MVKRTVATNG
MVKRTVATNGDASGAHRAKKMSKTHASHIINAQEDYKHMYLSVQPLDIFCWGTGSMCELGLGPLAKNKEVKRPRLNPFLPRDEAKIISFAVGGMHTLALDEESNVWSWGCNDVGALGRDTSNAKEQLKDMDADDSSDDEDGDLNELESTPAKIPRESFPPLAEGHKVVQLAATDNMSCALFSNGEVYAWGTFRCNEGILGFYQDKIKIQKTPWKVPTFSKYNIVQLAPGKDHILFLDEEGMVFAWGNGQQNQLGRKVMERFRLKTLDPRPFGLRHVKYIASGENHCFALTKDNKLVSWGLNQFGQCGVSEDVEDGALVTK...
cell cycle cell division nucleus organization poly(A)+ mRNA export from nucleus protein import into nucleus response to pheromone ribosomal subunit export from nucleus rRNA export from nucleus chromatin; cytoplasm; nucleus guanyl-nucleotide exchange factor activity Saccharomyces cerevisiae 3D-structure Cell cycle Cell...
pyridoxal phosphate catabolic process
cytosol
magnesium ion binding phosphatase activity phosphotransferase activity, alcohol group as acceptor pyridoxal phosphatase activity sugar-phosphatase activity
Escherichia coli
Hydrolase Magnesium Metal-binding Reference proteome
MTTRVIALDL
MTTRVIALDLDGTLLTPKKTLLPSSIEALARAREAGYQLIIVTGRHHVAIHPFYQALALDTPAICCNGTYLYDYHAKTVLEADPMPVIKALQLIEMLNEHHIHGLMYVDDAMVYEHPTGHVIRTSNWAQTLPPEQRPTFTQVASLAETAQQVNAVWKFALTHDDLPQLQHFGKHVEHELGLECEWSWHDQVDIARGGNSKGKRLTKWVEAQGWSMENVVAFGDNFNDISMLEAAGTGVAMGNADDAVKARANIVIGDNTTDSIAQFIYSHLI
pyridoxal phosphate catabolic process cytosol magnesium ion binding phosphatase activity phosphotransferase activity, alcohol group as acceptor pyridoxal phosphatase activity sugar-phosphatase activity Escherichia coli Hydrolase Magnesium Metal-binding Reference proteome MTTRVIALDL MTTRVIALDLDGTLLTPKKTLLPSSIEALARAREAGY...
acetylcholine catabolic process acetylcholine metabolic process acetylcholine receptor signaling pathway cell adhesion choline metabolic process osteoblast development positive regulation of axonogenesis positive regulation of cold-induced thermogenesis positive regulation of dendrite morphogenesis receptor internaliza...
axon; basement membrane; cell surface; dendrite; endoplasmic reticulum lumen; extracellular region; extracellular space; Golgi apparatus; membrane; neuromuscular junction; neuronal cell body; nuclear envelope; perinuclear region of cytoplasm; plasma membrane; postsynaptic membrane; presynaptic membrane; side of membran...
acetylcholine binding acetylcholinesterase activity choline binding cholinesterase activity collagen binding hydrolase activity identical protein binding laminin binding protein homodimerization activity protein self-association serine hydrolase activity
Mus musculus
3D-structure Alternative splicing Cell membrane Disulfide bond Glycoprotein GPI-anchor Hydrolase Lipoprotein Membrane Neurotransmitter degradation Reference proteome Secreted Serine esterase Signal Synapse
MRPPWYPLHT
MRPPWYPLHTPSLAFPLLFLLLSLLGGGARAEGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVL...
acetylcholine catabolic process acetylcholine metabolic process acetylcholine receptor signaling pathway cell adhesion choline metabolic process osteoblast development positive regulation of axonogenesis positive regulation of cold-induced thermogenesis positive regulation of dendrite morphogenesis receptor internaliza...
basement membrane disassembly cytokine precursor processing extracellular matrix disassembly positive regulation of angiogenesis protein catabolic process protein processing regulation of inflammatory response
cytoplasm; cytoplasmic ribonucleoprotein granule; cytosol; extracellular region; extracellular space; intracellular membrane-bounded organelle; secretory granule
endopeptidase activity peptide binding serine-type endopeptidase activity serine-type peptidase activity
Mus musculus
Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Protease Reference proteome Secreted Serine protease Signal Zymogen
MHLLTLHLLL
MHLLTLHLLLLLLGSSTKAGEIIGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILREN
basement membrane disassembly cytokine precursor processing extracellular matrix disassembly positive regulation of angiogenesis protein catabolic process protein processing regulation of inflammatory response cytoplasm; cytoplasmic ribonucleoprotein granule; cytosol; extracellular region; extracellular space; intracel...
inflammatory response proteolysis
extracellular region; extracellular space
heparin binding identical protein binding peptidase activity serine-type endopeptidase activity
Mus musculus
Alternative splicing Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Phosphoprotein Protease Reference proteome Secreted Serine protease Signal Zymogen
MLKRRLLLLW
MLKRRLLLLWALSLLASLVYSAPRPANQRVGIVGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQWVLTAAHCVGPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELEVPVNVSTHIHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGNTRRDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAQPNKPGIYTRVTYYLDWIHRYVPEHS
inflammatory response proteolysis extracellular region; extracellular space heparin binding identical protein binding peptidase activity serine-type endopeptidase activity Mus musculus Alternative splicing Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Phosphoprotein Protease Reference proteome Secrete...
cell adhesion
plasma membrane
carbohydrate binding signaling receptor binding transmembrane signaling receptor activity
Homo sapiens
Disulfide bond Glycoprotein Lectin Membrane Phosphoprotein Reference proteome Signal-anchor Transmembrane Transmembrane helix
MAEAITYADL
MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYA...
cell adhesion plasma membrane carbohydrate binding signaling receptor binding transmembrane signaling receptor activity Homo sapiens Disulfide bond Glycoprotein Lectin Membrane Phosphoprotein Reference proteome Signal-anchor Transmembrane Transmembrane helix MAEAITYADL MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGV...
negative regulation of axonogenesis negative regulation of protein targeting to membrane protein transport Rab protein signal transduction vesicle-mediated transport
cytoplasm; cytosol; Golgi apparatus
GTPase activator activity Rab GDP-dissociation inhibitor activity
Bos taurus
3D-structure Cytoplasm Golgi apparatus GTPase activation Phosphoprotein Reference proteome
MDEEYDVIVL
MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPETMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQNTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYVPDRVRKAGQVIRIICILSHPIKNTNDANSCQII...
negative regulation of axonogenesis negative regulation of protein targeting to membrane protein transport Rab protein signal transduction vesicle-mediated transport cytoplasm; cytosol; Golgi apparatus GTPase activator activity Rab GDP-dissociation inhibitor activity Bos taurus 3D-structure Cytoplasm Golgi apparatus GT...
cellular response to potassium ion signal transduction
cytosol; outer membrane-bounded periplasmic space; plasma membrane
ATP binding phosphorelay sensor kinase activity protein homodimerization activity transferase activity, transferring phosphorus-containing groups
Escherichia coli
3D-structure ATP-binding Cell inner membrane Cell membrane Kinase Membrane Nucleotide-binding Phosphoprotein Reference proteome Transferase Transmembrane Transmembrane helix Two-component regulatory system
MNNEPLRPDP
MNNEPLRPDPDRLLEQTAAPHRGKLKVFFGACAGVGKTWAMLAEAQRLRAQGLDIVVGVVETHGRKDTAAMLEGLAVLPLKRQAYRGRHISEFDLDAALARRPALILMDELAHSNAPGSRHPKRWQDIEELLEAGIDVFTTVNVQHLESLNDVVSGVTGIQVRETVPDPFFDAADDVVLVDLPPDDLRQRLKEGKVYIAGQAERAIEHFFRKGNLIALRELALRRTADRVDEQMRAWRGHPGEEKVWHTRDAILLCIGHNTGSEKLVRAAARLASRLGSVWHAVYVETPALHRLPEKKRRAILSALRLAQELGAETATLS...
cellular response to potassium ion signal transduction cytosol; outer membrane-bounded periplasmic space; plasma membrane ATP binding phosphorelay sensor kinase activity protein homodimerization activity transferase activity, transferring phosphorus-containing groups Escherichia coli 3D-structure ATP-binding Cell inner...
de novo' IMP biosynthetic process adenine biosynthetic process purine nucleotide biosynthetic process
cytosol
ATP binding metal ion binding phosphoribosylamine-glycine ligase activity phosphoribosylformylglycinamidine cyclo-ligase activity phosphoribosylglycinamide formyltransferase activity
Gallus gallus
Alternative splicing ATP-binding Ligase Magnesium Manganese Metal-binding Multifunctional enzyme Nucleotide-binding Purine biosynthesis Reference proteome Transferase
MADRVLVIGS
MADRVLVIGSGGREHALAWKLAQSPHVKQVFVAPGNAGTANSGKISNSAVSVSNHAALAQFCRDQEIRLVVVGPEVPLAAGIVDDLTAAGVRCFGPTARAAQLESSKSFTKSFLDRHGIPTARWKSFTDPKAACSFINSANFPALVVKASGLAAGKGVIVASNKEEACKAVNDIMQDKTFGTAGETVVVEELLEGEEVSCLCFTDGVTIAPMPPAQDHKRLKDGDEGPNTGGMGAYSPAPQISKDLLLKIRETVLQKTLDGMRKEGIPYLGVLYAGLMLTKDGPKVLEFNCRFGDPECQVILPLLKSDLYEVMQAVINKK...
de novo' IMP biosynthetic process adenine biosynthetic process purine nucleotide biosynthetic process cytosol ATP binding metal ion binding phosphoribosylamine-glycine ligase activity phosphoribosylformylglycinamidine cyclo-ligase activity phosphoribosylglycinamide formyltransferase activity Gallus gallus Alternative s...
glycolytic process tricarboxylic acid cycle
cytosol
dihydrolipoyllysine-residue acetyltransferase activity dihydrolipoyllysine-residue succinyltransferase activity
Bacillus subtilis
Acyltransferase Glycolysis Lipoyl Reference proteome Transferase
MAFEFKLPDI
MAFEFKLPDIGEGIHEGEIVKWFVKPNDEVDEDDVLAEVQNDKAVVEIPSPVKGKVLELKVEEGTVATVGQTIITFDAPGYEDLQFKGSDESDDAKTEAQVQSTAEAGQDVAKEEQAQEPAKATGAGQQDQAEVDPNKRVIAMPSVRKYAREKGVDIRKVTGSGNNGRVVKEDIDSFVNGGAQEAAPQETAAPQETAAKPAAAPAPEGEFPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTNLVAHRKQFKQVAADQGIKLTYLPYVVKALTSALKKFPVLNTSIDDKTDEVIQKHYFNIGIAADTEKGLLVPV...
glycolytic process tricarboxylic acid cycle cytosol dihydrolipoyllysine-residue acetyltransferase activity dihydrolipoyllysine-residue succinyltransferase activity Bacillus subtilis Acyltransferase Glycolysis Lipoyl Reference proteome Transferase MAFEFKLPDI MAFEFKLPDIGEGIHEGEIVKWFVKPNDEVDEDDVLAEVQNDKAVVEIPSPVKGKVLELKVE...
cysteinyl-tRNA aminoacylation
cytoplasm; cytosol
aminoacyl-tRNA ligase activity ATP binding cysteine-tRNA ligase activity ligase activity metal ion binding zinc ion binding
Escherichia coli
3D-structure Aminoacyl-tRNA synthetase ATP-binding Cytoplasm Direct protein sequencing Ligase Metal-binding Nucleotide-binding Protein biosynthesis Reference proteome Zinc
MLKIFNTLTR
MLKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRFLGYKLKYVRNITDIDDKIIKRANENGESFVAMVDRMIAEMHKDFDALNILRPDMEPRATHHIAEIIELTEQLIAKGHAYVADNGDVMFDVPTDPTYGVLSRQDLDQLQAGARVDVVDDKRNPMDFVLWKMSKEGEPSWPSPWGAGRPGWHIECSAMNCKQLGNHFDIHGGGSDLMFPHHENEIAQSTCAHDGQYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVLKYYDAETVRYFLMSGHYRSQLNYSEENLKQARAALERLY...
cysteinyl-tRNA aminoacylation cytoplasm; cytosol aminoacyl-tRNA ligase activity ATP binding cysteine-tRNA ligase activity ligase activity metal ion binding zinc ion binding Escherichia coli 3D-structure Aminoacyl-tRNA synthetase ATP-binding Cytoplasm Direct protein sequencing Ligase Metal-binding Nucleotide-binding Pro...
hemolymph coagulation protein processing
extracellular region; transport vesicle
metal ion binding serine-type endopeptidase activity serine-type peptidase activity
Tachypleus tridentatus
Calcium Cleavage on pair of basic residues Cytoplasmic vesicle Direct protein sequencing Disulfide bond Glycoprotein Hemolymph clotting Hydrolase Metal-binding Protease Pyrrolidone carboxylic acid Secreted Serine protease Signal Zymogen
MLVNNVFSLL
MLVNNVFSLLCFPLLMSVVRCSTLSRQRRQFVFPDEEELCSNRFTEEGTCKNVLDCRILLQKNDYNLLKESICGFEGITPKVCCPKSSHVISSTQAPPETTTTERPPKQIPPNLPEVCGIHNTTTTRIIGGREAPIGAWPWMTAVYIKQGGIRSVQCGGALVTNRHVITASHCVVNSAGTDVMPADVFSVRLGEHNLYSTDDDSNPIDFAVTSVKHHEHFVLATYLNDIAILTLNDTVTFTDRIRPICLPYRKLRYDDLAMRKPFITGWGTTAFNGPSSAVLREVQLPIWEHEACRQAYEKDLNITNVYMCAGFADGGKD...
hemolymph coagulation protein processing extracellular region; transport vesicle metal ion binding serine-type endopeptidase activity serine-type peptidase activity Tachypleus tridentatus Calcium Cleavage on pair of basic residues Cytoplasmic vesicle Direct protein sequencing Disulfide bond Glycoprotein Hemolymph clott...
cell adhesion cell population proliferation cellular response to low-density lipoprotein particle stimulus fusion of sperm to egg plasma membrane involved in single fertilization glial cell migration myoblast fusion involved in skeletal muscle regeneration negative regulation of cell population proliferation negative r...
clathrin-coated endocytic vesicle membrane; endocytic vesicle membrane; external side of plasma membrane; extracellular exosome; extracellular space; extracellular vesicle; focal adhesion; membrane; plasma membrane; platelet alpha granule membrane; protein-containing complex
integrin binding
Homo sapiens
3D-structure Cell adhesion Cell membrane Direct protein sequencing Disulfide bond Fertilization Glycoprotein Lipoprotein Membrane Palmitate Reference proteome Secreted Transmembrane Transmembrane helix
MPVKGGTKCI
MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
cell adhesion cell population proliferation cellular response to low-density lipoprotein particle stimulus fusion of sperm to egg plasma membrane involved in single fertilization glial cell migration myoblast fusion involved in skeletal muscle regeneration negative regulation of cell population proliferation negative r...
DNA transport transport of virus in host, cell to cell
host cell cytoplasm; host cell nucleus; host cell plasma membrane; membrane; viral capsid
single-stranded DNA binding structural molecule activity
Squash leaf curl virus
DNA-binding Host cell membrane Host cytoplasm Host membrane Host nucleus Host-virus interaction Membrane Transport Viral movement protein
MYSTSNRRGR
MYSTSNRRGRSQTQRGSHVRRTGVKRSYGAARGDDRRRPNVVSKTQVEPRMTIQRVQENQFGPEFVLSQNSALSTFVTYPSYVKTVPNRTRTYIKLKRVRFKGTLKIERGQGDTIMDGPSSNIEGVFSMVIVVDRKPHVSQSGRLHTFDELFGARIHCHGNLSVVPALKDRYYIRHVTKRVVSLEKDTLLIDLHGTTQLSNKRYNCWASFSDLERDSCNGVYGNITKNALLVYYCWLSDAQSKASTYVSFELDYLG
DNA transport transport of virus in host, cell to cell host cell cytoplasm; host cell nucleus; host cell plasma membrane; membrane; viral capsid single-stranded DNA binding structural molecule activity Squash leaf curl virus DNA-binding Host cell membrane Host cytoplasm Host membrane Host nucleus Host-virus interaction...
transport of virus in host, cell to cell
host cell endoplasmic reticulum membrane; host cell plasma membrane; membrane
DNA binding
Squash leaf curl virus
DNA-binding Host cell membrane Host endoplasmic reticulum Host membrane Host microsome Membrane Phosphoprotein Transport Viral movement protein
MGSQLVPPPS
MGSQLVPPPSAFNYIESQRDEFQLSHDLTEIVLQFPSTASQITARLSRSCMKIDHCVIEYRQQVPINASGTVIVEIHDKRMTDNESLQASWTFPIRCNIDLHYFSSSFFSLKDPIPWKLYYRVSDSNVHQMTHFAKFKGKLKLSSAKHSVDIPFRAPTVKILAKQFSEKDIDFWHVGYGKWERRLVKSASSSRFGLRGPIEINPGESWATKSAIGPTNRNADLDIEEELLPYRELNRLGTNILDPGESASIVGIQRSQSNITMSMSQLNELVRSTVHECIKTSCIPSTPKSLS
transport of virus in host, cell to cell host cell endoplasmic reticulum membrane; host cell plasma membrane; membrane DNA binding Squash leaf curl virus DNA-binding Host cell membrane Host endoplasmic reticulum Host membrane Host microsome Membrane Phosphoprotein Transport Viral movement protein MGSQLVPPPS MGSQLVPPPSA...
extracellular matrix organization growth plate cartilage chondrocyte morphogenesis protein-containing complex assembly regulation of bone mineralization
collagen-containing extracellular matrix; extracellular matrix; extracellular region; matrilin complex
calcium ion binding extracellular matrix structural constituent
Homo sapiens
Coiled coil Disulfide bond EGF-like domain Extracellular matrix Glycoprotein Reference proteome Repeat Secreted Signal
MRVLSGTSLM
MRVLSGTSLMLCSLLLLLQALCSPGLAPQSRGHLCRTRPTDLVFVVDSSRSVRPVEFEKVKVFLSQVIESLDVGPNATRVGMVNYASTVKQEFSLRAHVSKAALLQAVRRIQPLSTGTMTGLAIQFAITKAFGDAEGGRSRSPDISKVVIVVTDGRPQDSVQDVSARARASGVELFAIGVGSVDKATLRQIASEPQDEHVDYVESYSVIEKLSRKFQEAFCVVSDLCATGDHDCEQVCISSPGSYTCACHEGFTLNSDGKTCNVCSGGGGSSATDLVFLIDGSKSVRPENFELVKKFISQIVDTLDVSDKLAQVGLVQYS...
extracellular matrix organization growth plate cartilage chondrocyte morphogenesis protein-containing complex assembly regulation of bone mineralization collagen-containing extracellular matrix; extracellular matrix; extracellular region; matrilin complex calcium ion binding extracellular matrix structural constituent ...
epidermis development forebrain development glial cell differentiation keratinocyte differentiation myelination myelination in peripheral nervous system negative regulation of DNA-templated transcription negative regulation of transcription by RNA polymerase II positive regulation of DNA-templated transcription positiv...
nucleoplasm; nucleus; transcription regulator complex
DNA binding DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific DNA-binding transcription repressor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific DNA binding sequence-specific doubl...
Mus musculus
3D-structure Activator DNA-binding Homeobox Nucleus Reference proteome Repressor Transcription Transcription regulation
MATTAQYLPR
MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAGGGGTGRADDGGGGGGFHARLVHQGAAHAGAAWAQGGTAHHLGPAMSPSPGAGGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGGGGAGPGLHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHAGGLHAAAAHLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDS...
epidermis development forebrain development glial cell differentiation keratinocyte differentiation myelination myelination in peripheral nervous system negative regulation of DNA-templated transcription negative regulation of transcription by RNA polymerase II positive regulation of DNA-templated transcription positiv...
branched-chain amino acid catabolic process lipid metabolic process response to cAMP response to glucocorticoid response to nutrient
mitochondrial alpha-ketoglutarate dehydrogenase complex; mitochondrial matrix; mitochondrion; nucleolus; nucleoplasm
3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) activity protein-containing complex binding
Homo sapiens
3D-structure Acetylation Alternative splicing Direct protein sequencing Disease variant Lipid metabolism Maple syrup urine disease Mitochondrion Oxidoreductase Reference proteome Transit peptide
MAVVAAAAGW
MAVVAAAAGWLLRLRAAGAEGHWRRLPGAGLARGFLHPAATVEDAAQRRQVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVI...
branched-chain amino acid catabolic process lipid metabolic process response to cAMP response to glucocorticoid response to nutrient mitochondrial alpha-ketoglutarate dehydrogenase complex; mitochondrial matrix; mitochondrion; nucleolus; nucleoplasm 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring)...
glutamate biosynthetic process glyoxylate cycle isocitrate metabolic process NADP metabolic process tricarboxylic acid cycle
mitochondrial nucleoid; mitochondrion
isocitrate dehydrogenase (NADP+) activity magnesium ion binding NAD binding
Saccharomyces cerevisiae
3D-structure Direct protein sequencing Glyoxylate bypass Magnesium Manganese Metal-binding Mitochondrion NADP Oxidoreductase Reference proteome Transit peptide Tricarboxylic acid cycle
MSMLSRRLFS
MSMLSRRLFSTSRLAAFSKIKVKQPVVELDGDEMTRIIWDKIKKKLILPYLDVDLKYYDLSVESRDATSDKITQDAAEAIKKYGVGIKCATITPDEARVKEFNLHKMWKSPNGTIRNILGGTVFREPIVIPRIPRLVPRWEKPIIIGRHAHGDQYKATDTLIPGPGSLELVYKPSDPTTAQPQTLKVYDYKGSGVAMAMYNTDESIEGFAHSSFKLAIDKKLNLFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQMIKSKGGFIMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTF...
glutamate biosynthetic process glyoxylate cycle isocitrate metabolic process NADP metabolic process tricarboxylic acid cycle mitochondrial nucleoid; mitochondrion isocitrate dehydrogenase (NADP+) activity magnesium ion binding NAD binding Saccharomyces cerevisiae 3D-structure Direct protein sequencing Glyoxylate bypas...
angiogenesis apoptotic cell clearance cell adhesion single fertilization
acrosomal membrane; collagen-containing extracellular matrix; external side of plasma membrane; extracellular space
integrin binding phosphatidylserine binding
Mus musculus
3D-structure Alternative splicing Angiogenesis Cell adhesion Cytoplasmic vesicle Direct protein sequencing Disulfide bond EGF-like domain Fertilization Glycoprotein Membrane Reference proteome Repeat Secreted Signal
MQVSRVLAAL
MQVSRVLAALCGMLLCASGLFAASGDFCDSSLCLNGGTCLTGQDNDIYCLCPEGFTGLVCNETERGPCSPNPCYNDAKCLVTLDTQRGDIFTEYICQCPVGYSGIHCETETNYYNLDGEYMFTTAVPNTAVPTPAPTPDLSNNLASRCSTQLGMEGGAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASNYDSKPWIQVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGGDKEFLGNLDNNSLKVNMFNPTLEAQYIKLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIP...
angiogenesis apoptotic cell clearance cell adhesion single fertilization acrosomal membrane; collagen-containing extracellular matrix; external side of plasma membrane; extracellular space integrin binding phosphatidylserine binding Mus musculus 3D-structure Alternative splicing Angiogenesis Cell adhesion Cytoplasmic v...
endoplasmic reticulum unfolded protein response negative regulation of phospholipid biosynthetic process negative regulation of transcription by RNA polymerase II phospholipid biosynthetic process positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II
endoplasmic reticulum; nuclear envelope; nuclear membrane; nuclear periphery; nucleoplasm; nucleus
DNA binding phosphatidic acid binding transcription corepressor activity
Saccharomyces cerevisiae
DNA-binding Endoplasmic reticulum Lipid biosynthesis Lipid metabolism Nucleus Phospholipid biosynthesis Phospholipid metabolism Phosphoprotein Reference proteome Repressor Transcription Transcription regulation
MSENQRLGLS
MSENQRLGLSEEEVEAAEVLGVLKQSCRQKSQPSEDVSQADKMPASESSTTPLNILDRVSNKIISNVVTFYDEINTNKRPLKSIGRLLDDDDDEHDDYDYNDDEFFTNKRQKLSRAIAKGKDNLKEYKLNMSIESKKRLVTCLHLLKLANKQLSDKISCLQDLVEKEQVHPLHKQDGNARTTTGAGEDETSSDEDDDDEEFFDASEQVNASEQSIVVKMEVVGTVKKVYSLISKFTANSLPEPARSQVRESLLNLPTNWFDSVHSTSLPHHASFHYANCEEQKVEQQQQQQQQQQQQQLLQQQLLQQQQQKRNKDGDDSA...
endoplasmic reticulum unfolded protein response negative regulation of phospholipid biosynthetic process negative regulation of transcription by RNA polymerase II phospholipid biosynthetic process positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II endoplasmic reti...
adaptive immune response antigen processing and presentation of endogenous peptide antigen via MHC class I cytosol to endoplasmic reticulum transport defense response peptide transport protection from natural killer cell mediated cytotoxicity protein transport transmembrane transport
centriolar satellite; endoplasmic reticulum; endoplasmic reticulum membrane; membrane; MHC class I peptide loading complex; mitochondrion; phagocytic vesicle membrane; TAP complex
ABC-type peptide antigen transporter activity ADP binding ATP binding ATP hydrolysis activity metal ion binding MHC class I protein binding MHC class Ib protein binding nucleotide binding peptide antigen binding peptide transmembrane transporter activity protein homodimerization activity protein-containing complex bind...
Mus musculus
Adaptive immunity ATP-binding Endoplasmic reticulum Immunity Magnesium Membrane Metal-binding Nucleotide-binding Peptide transport Protein transport Reference proteome Translocase Transmembrane Transmembrane helix Transport
MAAHVWLAAA
MAAHVWLAAALLLLVDWLLLRPMLPGIFSLLVPEVPLLRVWVVGLSRWAILGLGVRGVLGVTAGAHGWLAALQPLVAALSLALPGLALFRELAAWGTLREGDSAGLLYWNSRPDAFAISYVAALPAAALWHKLGSLWAPSGNRDAGDMLCRMLGFLGPKKRRLYLVLVLLILSCLGEMAIPFFTGRITDWILQDKTVPSFTRNIWLMSILTIASTALEFASDGIYNITMGHMHGRVHREVFRAVLRQETGFFLKNPAGSITSRVTEDTANVCESISGTLSLLLWYLGRALCLLVFMFWGSPYLTLVTLINLPLLFLLPKK...
adaptive immune response antigen processing and presentation of endogenous peptide antigen via MHC class I cytosol to endoplasmic reticulum transport defense response peptide transport protection from natural killer cell mediated cytotoxicity protein transport transmembrane transport centriolar satellite; endoplasmic r...
ascospore formation double-strand break repair via nonhomologous end joining meiotic cell cycle mitotic sister chromatid segregation phosphorylation protein catabolic process signal transduction
cytoplasm
ATP binding cyclin binding enzyme inhibitor activity protein kinase activity protein serine kinase activity protein serine/threonine kinase activity protein serine/threonine/tyrosine kinase activity protein tyrosine kinase activity
Saccharomyces cerevisiae
Acetylation ATP-binding Direct protein sequencing Kinase Nucleotide-binding Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase
MSTEEQNGVP
MSTEEQNGVPLQRGSEFIADDVTSNKSNNTRRMLVKEYRKIGRGAFGTVVQAYLTQDKKNWLGPFAIKKVPAHTEYKSRELQILRIADHPNIVKLQYFFTHLSPQDNKVYQHLAMECLPETLQIEINRYVTNKLEMPLKHIRLYTYQIARGMLYLHGLGVCHRDIKPSNVLVDPETGVLKICDFGSAKKLEHNQPSISYICSRFYRAPELIIGCTQYTTQIDIWGLGCVMGEMLIGKAIFQGQEPLLQLREIAKLLGPPDKRFIFFSNPAYDGPLFSKPLFSGSSQQRFEKYFGHSGPDGIDLLMKILVYEPQQRLSPRR...
ascospore formation double-strand break repair via nonhomologous end joining meiotic cell cycle mitotic sister chromatid segregation phosphorylation protein catabolic process signal transduction cytoplasm ATP binding cyclin binding enzyme inhibitor activity protein kinase activity protein serine kinase activity protein...
apoptotic cell clearance bone development branching involved in salivary gland morphogenesis cellular response to cocaine cellular response to dopamine cellular response to serotonin dopamine secretion gene expression negative regulation of endoplasmic reticulum calcium ion concentration peptide cross-linking phospholi...
chromatin; collagen-containing extracellular matrix; cytosol; endoplasmic reticulum; extracellular exosome; extracellular matrix; focal adhesion; mitochondrion; nucleosome; nucleus; perinuclear region of cytoplasm; plasma membrane
calcium ion binding GTP binding histone dopaminyltransferase activity histone serotonyltransferase activity peptidase activity peptide histaminyltransferase activity peptide noradrenalinyltransferase activity protein-glutamine gamma-glutamyltransferase activity protein-glutamine glutaminase activity
Homo sapiens
3D-structure Acetylation Acyltransferase Alternative splicing Calcium Cell membrane Chromosome Cytoplasm Direct protein sequencing Disulfide bond Extracellular matrix GTP-binding Hydrolase Isopeptide bond Membrane Metal-binding Mitochondrion Nucleotide-binding Nucleus Phosphoprotein Protease Reference proteome S-nitros...
MAEELVLERC
MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPWNFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEF...
apoptotic cell clearance bone development branching involved in salivary gland morphogenesis cellular response to cocaine cellular response to dopamine cellular response to serotonin dopamine secretion gene expression negative regulation of endoplasmic reticulum calcium ion concentration peptide cross-linking phospholi...
cell-cell signaling cellular response to dexamethasone stimulus cellular response to glucagon stimulus cellular response to oxidative stress decidualization epididymis development female pregnancy gap junction assembly gap junction-mediated intercellular transport inner ear development response to estradiol response to...
astrocyte projection; cell body; cell junction; connexin complex; gap junction; lateral plasma membrane; perinuclear region of cytoplasm; plasma membrane
calcium ion binding gap junction channel activity gap junction channel activity involved in cell communication by electrical coupling identical protein binding
Rattus norvegicus
Calcium Cell junction Cell membrane Direct protein sequencing Disulfide bond Gap junction Hearing Membrane Metal-binding Reference proteome Transmembrane Transmembrane helix
MDWGTLQSIL
MDWGTLQSILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIMVSTPALLVAMHVAYRRHEKKRKFMKGEIKNEFKDIEEIKTQKVRIEGSLWWTYTTSIFFRVIFEAVFMYVFYIMYNGFFMQRLVKCNAWPCPNTVDCFISRPTEKTVFTVFMISVSGICILLNITELCYLFIRYCSGKSKRPV
cell-cell signaling cellular response to dexamethasone stimulus cellular response to glucagon stimulus cellular response to oxidative stress decidualization epididymis development female pregnancy gap junction assembly gap junction-mediated intercellular transport inner ear development response to estradiol response to...
axon guidance cell adhesion dendrite self-avoidance homophilic cell adhesion via plasma membrane adhesion molecules plasma membrane lactate transport
axon; plasma membrane; synapse
cell-cell adhesion mediator activity
Mus musculus
Cell membrane Disulfide bond Glycoprotein Immunoglobulin domain Membrane Phosphoprotein Reference proteome Repeat Signal Synapse Transmembrane Transmembrane helix
MRSHTGLRAL
MRSHTGLRALVAPGYPLLLLCLLAATRPDPAEGDPTDPTFTSLPVREEMMAKYSNLSLKSCNISVTEKSNVSVEENVILEKPSHVELKCVYTATKDLNLMNVTWKKDDEPLETTGDFNTTKMGNTLTSQYRFIVFNSKQLGKYSCVFGEKELRGTFNIHVPKAHGKKKSLIAYVGDSTVLKCVCQDCLPLNWTWYMGNETAQVPIDAHSNEKYIINGSHANETRLKIKHLLEEDGGSYWCRATFQLGESEEQNELVVLSFLVPLKPFLAILAEVILLVAIILLCEVYTHKKKNDPDAGKEFEQIEQLKSDDSNGIENNVP...
axon guidance cell adhesion dendrite self-avoidance homophilic cell adhesion via plasma membrane adhesion molecules plasma membrane lactate transport axon; plasma membrane; synapse cell-cell adhesion mediator activity Mus musculus Cell membrane Disulfide bond Glycoprotein Immunoglobulin domain Membrane Phosphoprotein R...
corpus callosum development optic nerve development potassium ion transmembrane transport potassium ion transport protein homooligomerization
axon; calyx of Held; glutamatergic synapse; membrane raft; plasma membrane; postsynaptic membrane; presynaptic membrane; voltage-gated potassium channel complex
delayed rectifier potassium channel activity outward rectifier potassium channel activity voltage-gated monoatomic ion channel activity
Homo sapiens
3D-structure Cell membrane Glycoprotein Ion channel Ion transport Lipoprotein Membrane Palmitate Phosphoprotein Potassium Potassium channel Potassium transport Reference proteome Transmembrane Transmembrane helix Transport Voltage-gated channel
MDERLSLLRS
MDERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDHLLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPASTSQDSFEAAGNSTSGSRAGASSFSDPFFVVETLCIIWFSFELLVRFFACPSK...
corpus callosum development optic nerve development potassium ion transmembrane transport potassium ion transport protein homooligomerization axon; calyx of Held; glutamatergic synapse; membrane raft; plasma membrane; postsynaptic membrane; presynaptic membrane; voltage-gated potassium channel complex delayed rectifier...
aggressive behavior behavioral fear response cellular response to cAMP cellular response to oxidative stress cellular response to transforming growth factor beta stimulus cellular response to virus cellular response to vitamin D chemical synaptic transmission G protein-coupled opioid receptor signaling pathway general ...
axon; axon terminus; cell body fiber; chromaffin granule lumen; dendrite; extracellular region; neuronal cell body; neuronal dense core vesicle lumen; perikaryon; plasma membrane; symmetric synapse; synaptic vesicle lumen
opioid peptide activity opioid receptor binding receptor ligand activity
Mus musculus
Cleavage on pair of basic residues Cytoplasmic vesicle Disulfide bond Endorphin Neuropeptide Opioid peptide Phosphoprotein Reference proteome Secreted Signal
MARFLRLCTW
MARFLRLCTWLLALGSCLLATVQAECSQDCAKCSYRLVRPGDINFLACTLECEGQLPSFKIWETCKDLLQVSRPEFPWDNIDMYKDSSKQDESHLLAKKYGGFMKRYGGFMKKMDELYPMEPEEEANGGEILAKRYGGFMKKDADEGDTLANSSDLLKELLGTGDNRAKDSHQQESTNNDEDMSKRYGGFMRSLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAESLPSDEEGENYSKEVPEIEKRYGGFMRF
aggressive behavior behavioral fear response cellular response to cAMP cellular response to oxidative stress cellular response to transforming growth factor beta stimulus cellular response to virus cellular response to vitamin D chemical synaptic transmission G protein-coupled opioid receptor signaling pathway general ...
protein farnesylation
protein farnesyltransferase complex
protein farnesyltransferase activity zinc ion binding
Saccharomyces cerevisiae
Cytoplasm Metal-binding Prenyltransferase Reference proteome Repeat Transferase Zinc
MRQRVGRSIA
MRQRVGRSIARAKFINTALLGRKRPVMERVVDIAHVDSSKAIQPLMKELETDTTEARYKVLQSVLEIYDDEKNIEPALTKEFHKMYLDVAFEISLPPQMTALDASQPWMLYWIANSLKVMDRDWLSDDTKRKIVDKLFTISPSGGPFGGGPGQLSHLASTYAAINALSLCDNIDGCWDRIDRKGIYQWLISLKEPNGGFKTCLEVGEVDTRGIYCALSIATLLNILTEELTEGVLNYLKNCQNYEGGFGSCPHVDEAHGGYTFCATASLAILRSMDQINVEKLLEWSSARQLQEERGFCGRSNKLVDGCYSFWVGGSAAI...
protein farnesylation protein farnesyltransferase complex protein farnesyltransferase activity zinc ion binding Saccharomyces cerevisiae Cytoplasm Metal-binding Prenyltransferase Reference proteome Repeat Transferase Zinc MRQRVGRSIA MRQRVGRSIARAKFINTALLGRKRPVMERVVDIAHVDSSKAIQPLMKELETDTTEARYKVLQSVLEIYDDEKNIEPALTKEFHKMY...
ascospore formation negative regulation of meiotic nuclear division positive regulation of meiotic nuclear division protein folding
cytoplasm; fungal biofilm matrix; mitochondrial intermembrane space; Set3 complex; yeast-form cell wall
cyclosporin A binding peptidyl-prolyl cis-trans isomerase activity
Candida albicans
Cytoplasm Isomerase Reference proteome Rotamase
MSTVYFDVSA
MSTVYFDVSADGQKLGKITFKLYDDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPQFMLQGGDFTNFNGTGGKSIYGTKFADENFVKRHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVTDGLDIVKKIESFGSGSGATSKKIVIEESGQL
ascospore formation negative regulation of meiotic nuclear division positive regulation of meiotic nuclear division protein folding cytoplasm; fungal biofilm matrix; mitochondrial intermembrane space; Set3 complex; yeast-form cell wall cyclosporin A binding peptidyl-prolyl cis-trans isomerase activity Candida albicans ...
ATP biosynthetic process proton transmembrane transport
cytoplasm; mitochondrial inner membrane; proton-transporting ATP synthase complex, coupling factor F(o)
metal ion binding
Bos taurus
3D-structure ATP synthesis CF(0) Direct protein sequencing Hydrogen ion transport Ion transport Leucine-rich repeat Magnesium Membrane Metal-binding Mitochondrion Mitochondrion inner membrane Reference proteome Repeat Transit peptide Transport
MMLFGKISQQ
MMLFGKISQQLCGLKKLPWSRDSRYFWGWLNAVFNKVDHDRIRDVGPDRAASEWLLRCGAMVRYHGQQRWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLQYVEKIRLCKCHYIEDGCLERLSQLENLQKSMLEMEIISCGNVTDKGIIALHHFRNLKYLFLSDLPGVKEKEKIVQAFKTSLPSLELKLDLK
ATP biosynthetic process proton transmembrane transport cytoplasm; mitochondrial inner membrane; proton-transporting ATP synthase complex, coupling factor F(o) metal ion binding Bos taurus 3D-structure ATP synthesis CF(0) Direct protein sequencing Hydrogen ion transport Ion transport Leucine-rich repeat Magnesium Membr...
homocysteine metabolic process positive regulation of GTPase activity post-embryonic development propionate metabolic process, methylmalonyl pathway succinyl-CoA biosynthetic process
cytoplasm; mitochondrial matrix; mitochondrion
cobalamin binding GTPase activity identical protein binding metal ion binding methylmalonyl-CoA mutase activity modified amino acid binding protein homodimerization activity
Homo sapiens
3D-structure Acetylation Cobalamin Cobalt Cytoplasm Direct protein sequencing Disease variant Isomerase Metal-binding Mitochondrion Phosphoprotein Reference proteome Transit peptide
MLRAKNQLFL
MLRAKNQLFLLSPHYLRQVKESSGSRLIQQRLLHQQQPLHPEWAALAKKQLKGKNPEDLIWHTPEGISIKPLYSKRDTMDLPEELPGVKPFTRGPYPTMYTFRPWTIRQYAGFSTVEESNKFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLEKMSVSMTMNGAVIPVLANFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMKIIADIFEYTAKHMPKFNSISISGYHMQEAGADAILELAYTLADGLEYSRTGLQAGLTIDEFAPRLSFFWGIGMNFYMEIA...
homocysteine metabolic process positive regulation of GTPase activity post-embryonic development propionate metabolic process, methylmalonyl pathway succinyl-CoA biosynthetic process cytoplasm; mitochondrial matrix; mitochondrion cobalamin binding GTPase activity identical protein binding metal ion binding methylmalony...
prostaglandin biosynthetic process
cytoplasm
nucleotide binding prostaglandin H2 endoperoxidase reductase activity
Leishmania major
3D-structure Cytoplasm Fatty acid biosynthesis Fatty acid metabolism Lipid biosynthesis Lipid metabolism NADP Nucleotide-binding Oxidoreductase Prostaglandin biosynthesis Prostaglandin metabolism Reference proteome
MAGVDKAMVT
MAGVDKAMVTLSNGVKMPQFGLGVWQSPAGEVTENAVKWALCAGYRHIDTAAIYKNEESVGAGLRASGVPREDVFITTKLWNTEQGYESTLAAFEESRQKLGVDYIDLYLIHWPRGKDILSKEGKKYLDSWRAFEQLYKEKKVRAIGVSNFHIHHLEDVLAMCTVTPMVNQVELHPLNNQADLRAFCDAKQIKVEAWSPLGQGKLLSNPILSAIGAKYNKTAAQVILRWNIQKNLITIPKSVHRERIEENADIFDFELGAEDVMSIDALNTNSRYGPDPDEAQF
prostaglandin biosynthetic process cytoplasm nucleotide binding prostaglandin H2 endoperoxidase reductase activity Leishmania major3D-structure Cytoplasm Fatty acid biosynthesis Fatty acid metabolism Lipid biosynthesis Lipid metabolism NADP Nucleotide-binding Oxidoreductase Prostaglandin biosynthesis Prostaglandin meta...
gene expression mast cell degranulation negative regulation of male germ cell proliferation prostaglandin biosynthetic process regulation of circadian sleep/wake cycle, sleep response to glucocorticoid
extracellular region; extracellular space; Golgi apparatus; nuclear envelope; nuclear membrane; perinuclear region of cytoplasm; rough endoplasmic reticulum
fatty acid binding prostaglandin-D synthase activity retinoid binding
Rattus norvegicus
Cytoplasm Direct protein sequencing Disulfide bond Endoplasmic reticulum Fatty acid biosynthesis Fatty acid metabolism Glycoprotein Golgi apparatus Isomerase Lipid biosynthesis Lipid metabolism Mast cell degranulation Membrane Nucleus Prostaglandin biosynthesis Prostaglandin metabolism Pyrrolidone carboxylic acid Refer...
MAALPMLWTG
MAALPMLWTGLVLLGLLGFPQTPAQGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKELLFMCQTVVAPSTEGGLNLTSTFLRKNQCETKVMVLQPAGVPGQYTYNSPHWGSFHSLSVVETDYDEYAFLFSKGTKGPGQDFRMATLYSRAQLLKEELKEKFITFSKDQGLTEEDIVFLPQPDKCIQE
gene expression mast cell degranulation negative regulation of male germ cell proliferation prostaglandin biosynthetic process regulation of circadian sleep/wake cycle, sleep response to glucocorticoid extracellular region; extracellular space; Golgi apparatus; nuclear envelope; nuclear membrane; perinuclear region of ...
bile acid biosynthetic process ceramide transport intracellular cholesterol transport phospholipid transport positive regulation of insulin secretion involved in cellular response to glucose stimulus positive regulation of secretory granule organization positive regulation of tyrosine phosphorylation of STAT protein sp...
cell junction; cytoplasm; cytosol; endoplasmic reticulum membrane; Golgi apparatus; Golgi membrane; intracellular membrane-bounded organelle; membrane; nucleolus; nucleoplasm; perinuclear endoplasmic reticulum; perinuclear region of cytoplasm; plasma membrane; trans-Golgi network
oxysterol binding phosphatidylinositol-4-phosphate binding protein domain specific binding sterol binding sterol transfer activity sterol transporter activity
Homo sapiens
3D-structure Acetylation Coiled coil Cytoplasm Endoplasmic reticulum Golgi apparatus Lipid transport Lipid-binding Membrane Phosphoprotein Reference proteome Transport
MAATELRGVV
MAATELRGVVGPGPAAIAALGGGGAGPPVVGGGGGRGDAGPGSGAASGTVVAAAAGGPGPGAGGVAAAGPAPAPPTGGSGGSGAGGSGSAREGWLFKWTNYIKGYQRRWFVLSNGLLSYYRSKAEMRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAKAVKMLAESDESGDEESVSQTDKTELQNTLRTLSSKVEDLSTCNDLIAKHGTALQRSLSELESLKLPAESNEKIKQVNERATLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQRIRLEETLEQLAKQHNHLER...
bile acid biosynthetic process ceramide transport intracellular cholesterol transport phospholipid transport positive regulation of insulin secretion involved in cellular response to glucose stimulus positive regulation of secretory granule organization positive regulation of tyrosine phosphorylation of STAT protein sp...
protein methylation protein repair
cytoplasm; cytosol; extracellular exosome; extracellular vesicle
cadherin binding protein-L-isoaspartate (D-aspartate) O-methyltransferase activity
Homo sapiens
3D-structure Acetylation Alternative splicing Cytoplasm Direct protein sequencing Methyltransferase Reference proteome S-adenosyl-L-methionine Transferase
MAWKSGGASH
MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSRWK
protein methylation protein repair cytoplasm; cytosol; extracellular exosome; extracellular vesicle cadherin binding protein-L-isoaspartate (D-aspartate) O-methyltransferase activity Homo sapiens 3D-structure Acetylation Alternative splicing Cytoplasm Direct protein sequencing Methyltransferase Reference proteome S-ade...
cellular response to hypoxia methylation negative regulation of cardiac muscle cell apoptotic process protein modification process response to ethanol S-adenosylhomocysteine metabolic process S-adenosylmethionine metabolic process
basolateral plasma membrane; brush border membrane; cytoplasm; cytosol; extracellular space; perikaryon
protein-L-isoaspartate (D-aspartate) O-methyltransferase activity S-adenosylmethionine-dependent methyltransferase activity
Rattus norvegicus
Acetylation Cytoplasm Direct protein sequencing Methyltransferase Reference proteome S-adenosyl-L-methionine Transferase
MAWKSGGASH
MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKSNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGHSGKVIGIDHIKELVDDSITNVKKDDPMLLSSGRVRLVVGDGRMGFAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSVKMKPLMGVIYVPLTDKEKQWSRWK
cellular response to hypoxia methylation negative regulation of cardiac muscle cell apoptotic process protein modification process response to ethanol S-adenosylhomocysteine metabolic process S-adenosylmethionine metabolic process basolateral plasma membrane; brush border membrane; cytoplasm; cytosol; extracellular spa...
proton motive force-driven mitochondrial ATP synthesis
mitochondrial proton-transporting ATP synthase complex; mitochondrial proton-transporting ATP synthase, catalytic core; mitochondrion; proton-transporting ATP synthase complex, catalytic core F(1)
ADP binding ATP binding ATP hydrolysis activity proton-transporting ATP synthase activity, rotational mechanism proton-transporting ATPase activity, rotational mechanism
Schizosaccharomyces pombe
ATP synthesis ATP-binding CF(1) Direct protein sequencing Hydrogen ion transport Ion transport Membrane Mitochondrion Mitochondrion inner membrane Nucleotide-binding Reference proteome Transit peptide Translocase Transport
MLKKQALSGI
MLKKQALSGIRRFSLATKQSFVKTSYKLPRKSWLNTAKFNTIRYASTEAAKHNKGSIKQVIGAVVDCQFEDADSLPSILNALEVKLPDNKRLVLEVAQHVGENTVRTIAMDGTEGLVRGTAVIDTGSPISIPVGPGTLGRIMNVIGEPVDERGPIKAVKYSPIHADAPSFEEQSTTPEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGYSVFTGVGERTREGNDLYREMQETGVIKLEGESKAALVFGQMNEPPGARARVALTGLTVAEYFRDIEGQDVLLFIDNIFRFTQAGSEVSALLGR...
proton motive force-driven mitochondrial ATP synthesis mitochondrial proton-transporting ATP synthase complex; mitochondrial proton-transporting ATP synthase, catalytic core; mitochondrion; proton-transporting ATP synthase complex, catalytic core F(1) ADP binding ATP binding ATP hydrolysis activity proton-transporting ...
C21-steroid hormone metabolic process hippocampus development response to corticosterone steroid biosynthetic process
cytoplasm; endoplasmic reticulum membrane; intracellular membrane-bounded organelle; mitochondrial membrane
3-beta-hydroxy-delta5-steroid dehydrogenase activity cholesterol dehydrogenase activity oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor steroid delta-isomerase activity
Rattus norvegicus
Endoplasmic reticulum Isomerase Membrane Mitochondrion Multifunctional enzyme NAD Oxidoreductase Reference proteome Steroidogenesis Transmembrane Transmembrane helix
MPGWSCLVTG
MPGWSCLVTGAGGFVGQRIIRMLVQEKELQEVRALDKVFRPETKEEFSKLQTKAKVTMLEGDILDAQYLRRACQGISVVIHTASVMDFSRVLPRQTILDVNLKGTQNLLEAGIHASVPAFIYCSTVDVAGPNSYKKTILNGREEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGTLHTCALRPMYIYGERGQFLSRIIIMALKNKGVLNVTGKFSIVNPVYVGNVAWAHILAARGLRDPKKSQNIQGQFYYISDDTPHQSYDDLNCTLSKEWGLRLDSSWSLPLPLLYWLAFLLETVSFLLRPFYNYRPPFNCHLV...
C21-steroid hormone metabolic process hippocampus development response to corticosterone steroid biosynthetic process cytoplasm; endoplasmic reticulum membrane; intracellular membrane-bounded organelle; mitochondrial membrane 3-beta-hydroxy-delta5-steroid dehydrogenase activity cholesterol dehydrogenase activity oxidor...
defense response to bacterium detection of chemical stimulus involved in sensory perception of bitter taste hydrogen peroxide catabolic process response to oxidative stress
basolateral plasma membrane; cytoplasm; extracellular exosome; extracellular region; extracellular space
heme binding lactoperoxidase activity metal ion binding thiocyanate peroxidase activity
Homo sapiens
Alternative splicing Antimicrobial Calcium Cytoplasm Direct protein sequencing Disulfide bond Glycoprotein Heme Hydrogen peroxide Iron Metal-binding Nitration Oxidoreductase Peroxidase Phosphoprotein Reference proteome Secreted Signal
MRVLLHLPAL
MRVLLHLPALLASLILLQAAASTTRAQTTRTSAISDTVSQAKVQVNKAFLDSRTRLKTAMSSETPTSRQLSEYLKHAKGRTRTAIRNGQVWEESLKRLRQKASLTNVTDPSLDLTSLSLEVGCGAPAPVVRCDPCSPYRTITGDCNNRRKPALGAANRALARWLPAEYEDGLSLPFGWTPGKTRNGFPLPLAREVSNKIVGYLNEEGVLDQNRSLLFMQWGQIVDHDLDFAPDTELGSSEYSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAREQINALTSFLDASFVYSSEPSLASRL...
defense response to bacterium detection of chemical stimulus involved in sensory perception of bitter taste hydrogen peroxide catabolic process response to oxidative stress basolateral plasma membrane; cytoplasm; extracellular exosome; extracellular region; extracellular space heme binding lactoperoxidase activity meta...
carbohydrate metabolic process fucosylation glycosphingolipid biosynthetic process inflammatory response L-fucose catabolic process Lewis x epitope biosynthetic process lymphocyte migration into lymph node oligosaccharide biosynthetic process oligosaccharide metabolic process positive regulation of leukocyte tethering ...
cell periphery; cell surface; Golgi apparatus; Golgi cisterna membrane; Golgi membrane; membrane; trans-Golgi network
4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity alpha-(1->3)-fucosyltransferase activity fucosyltransferase activity
Homo sapiens
Alternative initiation Glycoprotein Glycosyltransferase Golgi apparatus Inflammatory response Membrane Reference proteome Signal-anchor Transferase Transmembrane Transmembrane helix
MRRLWGAARK
MRRLWGAARKPSGAGWEKEWAEAPQEAPGAWSGRLGPGRSGRKGRAVPGWASWPAHLALAARPARHLGGAGQGPRPLHSGTAPFHSRASGERQRRLEPQLQHESRCRSSTPADAWRAEAALPVRAMGAPWGSPTAAAGGRRGWRRGRGLPWTVCVLAAAGLTCTALITYACWGQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESPSHSPGLRSLASNLFNWTLSY...
carbohydrate metabolic process fucosylation glycosphingolipid biosynthetic process inflammatory response L-fucose catabolic process Lewis x epitope biosynthetic process lymphocyte migration into lymph node oligosaccharide biosynthetic process oligosaccharide metabolic process positive regulation of leukocyte tethering ...
adenylate cyclase-activating adrenergic receptor signaling pathway adrenergic receptor signaling pathway female pregnancy G protein-coupled receptor signaling pathway negative regulation of uterine smooth muscle contraction platelet activation positive regulation of MAPK cascade positive regulation of neuron differenti...
axon; axon terminus; cytoplasm; glutamatergic synapse; neuronal cell body; plasma membrane; postsynaptic density membrane; postsynaptic membrane
alpha-2A adrenergic receptor binding alpha2-adrenergic receptor activity epinephrine binding G protein-coupled receptor activity protein heterodimerization activity protein homodimerization activity
Rattus norvegicus
Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Membrane Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MASPALAAAL
MASPALAAALAAAAAEGPNGSDAGEWGSGGGANASGTDWGPPPGQYSAGAVAGLAAVVGFLIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFGQVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISAVISFPPLVSFYRRPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLRTRTLSEKRGPAGPDGASPTTENGLGKAAGENGHCAPPRTEVEPDESSAAERRRRRGALRRGGRRREGAEGDTGSADGPGP...
adenylate cyclase-activating adrenergic receptor signaling pathway adrenergic receptor signaling pathway female pregnancy G protein-coupled receptor signaling pathway negative regulation of uterine smooth muscle contraction platelet activation positive regulation of MAPK cascade positive regulation of neuron differenti...
box C/D RNA 3'-end processing osteoblast differentiation ribosomal small subunit biogenesis rRNA methylation rRNA processing snoRNA localization
box C/D RNP complex; Cajal body; extracellular exosome; fibrillar center; granular component; membrane; nucleolus; nucleoplasm; nucleus; small-subunit processome
ATPase binding histone H2AQ104 methyltransferase activity RNA binding rRNA methyltransferase activity TFIID-class transcription factor complex binding
Homo sapiens
3D-structure Acetylation Isopeptide bond Methylation Methyltransferase Nucleus Phosphoprotein Reference proteome Ribonucleoprotein RNA-binding rRNA processing S-adenosyl-L-methionine Transferase Ubl conjugation
MKPGFSPRGG
MKPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVK...
box C/D RNA 3'-end processing osteoblast differentiation ribosomal small subunit biogenesis rRNA methylation rRNA processing snoRNA localization box C/D RNP complex; Cajal body; extracellular exosome; fibrillar center; granular component; membrane; nucleolus; nucleoplasm; nucleus; small-subunit processome ATPase bindin...
lipid catabolic process
extracellular region
metal ion binding triglyceride lipase activity
Burkholderia cepacia
3D-structure Calcium Direct protein sequencing Disulfide bond Hydrolase Lipid degradation Lipid metabolism Metal-binding Secreted Signal
MARTMRSRVV
MARTMRSRVVAGAVACAMSIAPFAGTTAVMTLATTHAAMAATAPAAGYAATRYPIILVHGLSGTDKYAGVLEYWYGIQEDLQQNGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLSSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQDVLAYDPTGLSSSVIAAFVNVFGILTSSSHNTNQDALAALQTLTTARAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTLSVFGVTGATDTSTLPLVDPANVLDLSTLALFGTGTVMINRGSGQNDGLVSKCSALYGK...
lipid catabolic process extracellular region metal ion binding triglyceride lipase activity Burkholderia cepacia 3D-structure Calcium Direct protein sequencing Disulfide bond Hydrolase Lipid degradation Lipid metabolism Metal-binding Secreted Signal MARTMRSRVV MARTMRSRVVAGAVACAMSIAPFAGTTAVMTLATTHAAMAATAPAAGYAATRYPIILVH...
de novo' AMP biosynthetic process 'de novo' IMP biosynthetic process 'de novo' XMP biosynthetic process adenine biosynthetic process brainstem development cerebellum development cerebral cortex development glycine metabolic process GMP biosynthetic process purine nucleotide biosynthetic process purine ribonucleoside mo...
cytosol; extracellular exosome
ATP binding metal ion binding phosphoribosylamine-glycine ligase activity phosphoribosylformylglycinamidine cyclo-ligase activity phosphoribosylglycinamide formyltransferase activity
Homo sapiens
3D-structure Acetylation Alternative splicing ATP-binding Ligase Magnesium Manganese Metal-binding Multifunctional enzyme Nucleotide-binding Phosphoprotein Purine biosynthesis Reference proteome Transferase
MAARVLIIGS
MAARVLIIGSGGREHTLAWKLAQSHHVKQVLVAPGNAGTACSEKISNTAISISDHTALAQFCKEKKIEFVVVGPEAPLAAGIVGNLRSAGVQCFGPTAEAAQLESSKRFAKEFMDRHGIPTAQWKAFTKPEEACSFILSADFPALVVKASGLAAGKGVIVAKSKEEACKAVQEIMQEKAFGAAGETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYCPAPQVSNDLLLKIKDTVLQRTVDGMQQEGTPYTGILYAGIMLTKNGPKVLEFNCRFGDPECQVILPLLKSDLYEVIQSTLDGL...
de novo' AMP biosynthetic process 'de novo' IMP biosynthetic process 'de novo' XMP biosynthetic process adenine biosynthetic process brainstem development cerebellum development cerebral cortex development glycine metabolic process GMP biosynthetic process purine nucleotide biosynthetic process purine ribonucleoside mo...
amino acid biosynthetic process amino acid catabolic process asparagine biosynthetic process glutamine metabolic process L-asparagine biosynthetic process
cytoplasm; cytosol
amino acid binding asparagine synthase (glutamine-hydrolyzing) activity aspartate-ammonia ligase activity ATP binding identical protein binding protein homodimerization activity
Escherichia coli
3D-structure Amino-acid biosynthesis Asparagine biosynthesis ATP-binding Direct protein sequencing Glutamine amidotransferase Ligase Nucleotide-binding Reference proteome
MCSIFGVFDI
MCSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDNAILAHERLSIVDVNAGAQPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEVILALYQEKGPEFLDDLQGMFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMKALVPVCRTIKEFPAGSYLWSQDGEIRSYYHRDWFDYDAVKDNVTDKNELRQALEDSVKSHLMSDVPYGVLLSGGLDSSIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDLKAAQEVANHLGTVHHEIHFTVQEGLDAIRDVIYHIETYD...
amino acid biosynthetic process amino acid catabolic process asparagine biosynthetic process glutamine metabolic process L-asparagine biosynthetic process cytoplasm; cytosol amino acid binding asparagine synthase (glutamine-hydrolyzing) activity aspartate-ammonia ligase activity ATP binding identical protein binding pr...
nucleoside catabolic process nucleotide biosynthetic process
cytoplasm; nucleus
ATP adenylyltransferase activity ATP binding bis(5'-nucleosyl)-tetraphosphatase activity sulfate adenylyltransferase (ADP) activity
Saccharomyces cerevisiae
3D-structure ATP-binding Cytoplasm Direct protein sequencing Hydrolase Nucleotide-binding Nucleotidyltransferase Nucleus Reference proteome Transferase
MIEENLKQKI
MIEENLKQKIHDKFVAAKKNGHLKVTHAESKKLKDPQTTTQYWVTFAPSLALKPDANKNSDSKAEDPFANPDEELVVTEDLNGDGEYKLLLNKFPVVPEHSLLVTSEFKDQRSALTPSDLMTAYNVLCSLQGDKDDDVTCERYLVFYNCGPHSGSSQDHKHLQIMQMPEKFIPFQDVLCNGKDHFLPTFNAEPLQDDKVSFAHFVLPLPESSDQVDEDLLAMCYVSLMQRALTFFQDWTNESPELTKSYNVLLTKKWICVVPRSHAKSGPPLMLNINSTGYCGMILVKDREKLENLTEDPHLVDKSLLQCGFPNTAGQKP...
nucleoside catabolic process nucleotide biosynthetic process cytoplasm; nucleus ATP adenylyltransferase activity ATP binding bis(5'-nucleosyl)-tetraphosphatase activity sulfate adenylyltransferase (ADP) activity Saccharomyces cerevisiae 3D-structure ATP-binding Cytoplasm Direct protein sequencing Hydrolase Nucleotide-...
axonogenesis cellular response to insulin stimulus endoplasmic reticulum tubular network organization endosomal transport establishment of neuroblast polarity establishment of protein localization to endoplasmic reticulum membrane Golgi to plasma membrane protein transport Golgi to plasma membrane transport polarized e...
cilium; endoplasmic reticulum membrane; endoplasmic reticulum tubular network; endosome; endosome membrane; Golgi apparatus; insulin-responsive compartment; phagocytic vesicle membrane; recycling endosome; recycling endosome membrane; trans-Golgi network
GDP binding GTP binding GTPase activity
Diplobatis ommata
Cell projection Cytoplasmic vesicle Endoplasmic reticulum Endosome Golgi apparatus GTP-binding Lipoprotein Membrane Nucleotide-binding Prenylation Protein transport Transport
MAKKTYDLLF
MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELHGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFENISKWLRNIDEHANEDVERMLLGNKCDMEDKRVVLKSKGEQIAREHAIRFFETSAKANINIEKAFLTLAEDILQKTPVKEPDRENVDISTTGGGTGLKKCCS
axonogenesis cellular response to insulin stimulus endoplasmic reticulum tubular network organization endosomal transport establishment of neuroblast polarity establishment of protein localization to endoplasmic reticulum membrane Golgi to plasma membrane protein transport Golgi to plasma membrane transport polarized e...
gluconeogenesis malate metabolic process protein import into peroxisome matrix tricarboxylic acid cycle
cytoplasm; cytosol; nuclear periphery
L-malate dehydrogenase activity
Saccharomyces cerevisiae
Cytoplasm Direct protein sequencing NAD Oxidoreductase Phosphoprotein Reference proteome Tricarboxylic acid cycle
MPHSVTPSIE
MPHSVTPSIEQDSLKIAILGAAGGIGQSLSLLLKAQLQYQLKESNRSVTHIHLALYDVNQEAINGVTADLSHIDTPISVSSHSPAGGIENCLHNASIVVIPAGVPRKPGMTRDDLFNVNAGIISQLGDSIAECCDLSKVFVLVISNPVNSLVPVMVSNILKNHPQSRNSGIERRIMGVTKLDIVRASTFLREINIESGLTPRVNSMPDVPVIGGHSGETIIPLFSQSNFLSRLNEDQLKYLIHRVQYGGDEVVKAKNGKGSATLSMAHAGYKCVVQFVSLLLGNIEQIHGTYYVPLKDANNFPIAPGADQLLPLVDGADY...
gluconeogenesis malate metabolic process protein import into peroxisome matrix tricarboxylic acid cycle cytoplasm; cytosol; nuclear periphery L-malate dehydrogenase activity Saccharomyces cerevisiae Cytoplasm Direct protein sequencing NAD Oxidoreductase Phosphoprotein Reference proteome Tricarboxylic acid cycle MPHSVT...
base-excision repair, AP site formation DNA dealkylation involved in DNA repair
nucleus; protein-DNA complex
alkylated DNA binding alkylbase DNA N-glycosylase activity damaged DNA binding DNA-3-methyladenine glycosylase activity DNA-3-methylguanine glycosylase activity DNA-7-methyladenine glycosylase activity DNA-7-methylguanine glycosylase activity
Saccharomyces cerevisiae
Direct protein sequencing DNA damage DNA repair Hydrolase Nucleus Phosphoprotein Reference proteome
MKLKREYDEL
MKLKREYDELIKADAVKEIAKELGSRPLEVALPEKYIARHEEKFNMACEHILEKDPSLFPILKNNEFTLYLKETQVPNTLEDYFIRLASTILSQQISGQAAESIKARVVSLYGGAFPDYKILFEDFKDPAKCAEIAKCGLSKRKMIYLESLAVYFTEKYKDIEKLFGQKDNDEEVIESLVTNVKGIGPWSAKMFLISGLKRMDVFAPEDLGIARGFSKYLSDKPELEKELMRERKVVKKSKIKHKKYNWKIYDDDIMEKCSETFSPYRSVFMFILWRLASTNTDAMMKAEENFVKS
base-excision repair, AP site formation DNA dealkylation involved in DNA repair nucleus; protein-DNA complex alkylated DNA binding alkylbase DNA N-glycosylase activity damaged DNA binding DNA-3-methyladenine glycosylase activity DNA-3-methylguanine glycosylase activity DNA-7-methyladenine glycosylase activity DNA-7-met...
nucleolar large rRNA transcription by RNA polymerase I ribosome biogenesis RNA-templated transcription termination of RNA polymerase I transcription termination of RNA polymerase III transcription transcription by RNA polymerase I transcription by RNA polymerase II transcription by RNA polymerase III transcription elon...
nucleoplasm; nucleus; RNA polymerase I complex; RNA polymerase II, core complex; RNA polymerase III complex
DNA binding RNA polymerase I activity zinc ion binding
Saccharomyces cerevisiae
3D-structure Direct protein sequencing DNA-directed RNA polymerase Isopeptide bond Metal-binding Nucleus Reference proteome Ribosome biogenesis Transcription Ubl conjugation Zinc
MIVPVRCFSC
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD
nucleolar large rRNA transcription by RNA polymerase I ribosome biogenesis RNA-templated transcription termination of RNA polymerase I transcription termination of RNA polymerase III transcription transcription by RNA polymerase I transcription by RNA polymerase II transcription by RNA polymerase III transcription elon...
phosphatidylcholine biosynthetic process phosphatidylethanolamine biosynthetic process
endoplasmic reticulum; Golgi apparatus; Golgi membrane
diacylglycerol cholinephosphotransferase activity ethanolaminephosphotransferase activity
Saccharomyces cerevisiae
Golgi apparatus Lipid biosynthesis Lipid metabolism Membrane Multifunctional enzyme Phospholipid biosynthesis Phospholipid metabolism Reference proteome Transferase Transmembrane Transmembrane helix
MGYFVPDSHI
MGYFVPDSHIENLKSYKYQSEDRSLVSKYFLKPFWQRFCHIFPTWMAPNIITLSGFAFIVINVLTVFYYDPNLNTDTPRWTYFSYALGVFLYQTFDGCDGVHARRINQSGPLGELFDHSIDAINSTLSIFIFASETGMGFSYNLMLSQFAMLTNFYLSTWEEYHTHTLYLSEFSGPVEGILIVCVSLILTGIYGKQVIWHTYLFTITVGDKVIDVDTLDIVFSLAVFGLVMNALSAKRNVDKYYRNSTSSANNITQIEQDSAIKGLLPFFAYYASIALLVWMQPSFITLSFILSVGFTGAFTVGRIIVCHLTKQSFPMFN...
phosphatidylcholine biosynthetic process phosphatidylethanolamine biosynthetic process endoplasmic reticulum; Golgi apparatus; Golgi membrane diacylglycerol cholinephosphotransferase activity ethanolaminephosphotransferase activity Saccharomyces cerevisiae Golgi apparatus Lipid biosynthesis Lipid metabolism Membrane M...
proteasomal protein catabolic process proteasomal ubiquitin-independent protein catabolic process proteasome-mediated ubiquitin-dependent protein catabolic process
endoplasmic reticulum membrane; nucleus; proteasome complex; proteasome core complex, beta-subunit complex
endopeptidase activator activity
Saccharomyces cerevisiae
3D-structure Acetylation Cytoplasm Direct protein sequencing Nucleus Phosphoprotein Proteasome Reference proteome
MDIILGIRVQ
MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ
proteasomal protein catabolic process proteasomal ubiquitin-independent protein catabolic process proteasome-mediated ubiquitin-dependent protein catabolic process endoplasmic reticulum membrane; nucleus; proteasome complex; proteasome core complex, beta-subunit complex endopeptidase activator activity Saccharomyces ce...
filamentous growth fungal-type cell wall (1->3)-beta-D-glucan biosynthetic process fungal-type cell wall organization heterochromatin formation regulation of response to endoplasmic reticulum stress
cellular bud scar; COPII-coated ER to Golgi transport vesicle; extracellular region; fungal-type cell wall; membrane raft; mitochondrion; nuclear periphery; plasma membrane; primary cell septum; side of membrane
1,3-beta-glucanosyltransferase activity
Saccharomyces cerevisiae
Cell membrane Cell wall Cell wall biogenesis/degradation Direct protein sequencing Disulfide bond Glycoprotein GPI-anchor Lipoprotein Membrane Reference proteome Secreted Signal Transferase
MLFKSLSKLA
MLFKSLSKLATAAAFFAGVATADDVPAIEVVGNKFFYSNNGSQFYIRGVAYQADTANETSGSTVNDPLANYESCSRDIPYLKKLNTNVIRVYAINTTLDHSECMKALNDADIYVIADLAAPATSINRDDPTWTVDLFNSYKTVVDTFANYTNVLGFFAGNEVTNNYTNTDASAFVKAAIRDVRQYISDKNYRKIPVGYSSNDDEDTRVKMTDYFACGDDDVKADFYGINMYEWCGKSDFKTSGYADRTAEFKNLSIPVFFSEYGCNEVTPRLFTEVEALYGSNMTDVWSGGIVYMYFEETNKYGLVSIDGNDVKTLDDFN...
filamentous growth fungal-type cell wall (1->3)-beta-D-glucan biosynthetic process fungal-type cell wall organization heterochromatin formation regulation of response to endoplasmic reticulum stress cellular bud scar; COPII-coated ER to Golgi transport vesicle; extracellular region; fungal-type cell wall; membrane raft...
cardiolipin metabolic process cellular response to iron ion starvation chromosome segregation establishment of mitotic sister chromatid cohesion meiotic chromosome segregation negative regulation of transcription by RNA polymerase II positive regulation of iron ion transport positive regulation of transcription by RNA ...
cytoplasm; nucleus
cis-regulatory region sequence-specific DNA binding DNA-binding transcription factor activity, RNA polymerase II-specific kinetochore binding metal ion binding
Saccharomyces cerevisiae
Activator Iron Metal-binding Nucleus Reference proteome Transcription Transcription regulation Zinc
MEGFNPADIE
MEGFNPADIEHASPINSSDSHSSSFVYALPKSASEYVVNHNEGRASASGNPAAVPSPIMTLNLKSTHSLNIDQHVHTSTSPTETIGHIHHVEKLNQNNLIHLDPVPNFEDKSDIKPWLQKIFYPQGIELVIERSDAFKVVFKCKAAKRGRNARRKRKDKPKGQDHEDEKSKINDDELEYASPSNATVTNGPQTSPDQTSSIKPKKKRCVSRFNNCPFRVRATYSLKRKRWSIVVMDNNHSHQLKFNPDSEEYKKFKEKLRKDNDVDAIKKFDELEYRTLANLPIPTATIPCDCGLTNEIQSFNVVLPTNSNVTSSASSST...
cardiolipin metabolic process cellular response to iron ion starvation chromosome segregation establishment of mitotic sister chromatid cohesion meiotic chromosome segregation negative regulation of transcription by RNA polymerase II positive regulation of iron ion transport positive regulation of transcription by RNA ...
animal organ development cell differentiation phosphorylation positive regulation of cell population proliferation regulation of macromolecule metabolic process
cytoplasmic vesicle; cytosol; nucleus; plasma membrane
ATP binding fibroblast growth factor receptor activity
Xenopus laevis
Alternative splicing ATP-binding Cell membrane Cytoplasm Cytoplasmic vesicle Disulfide bond Glycoprotein Immunoglobulin domain Kinase Membrane Nucleotide-binding Nucleus Phosphoprotein Receptor Reference proteome Repeat Signal Transferase Transmembrane Transmembrane helix Tyrosine-protein kinase Ubl conjugation
MFSGMSLLLW
MFSGMSLLLWGVLLGAALSVARPPSTLPDEVAPKTKTEVEPYSAQPGDRITLQCRLREDVQSINWVKNGVQLSETNRTRITGEEIQISNAGPEDNGVYACVTNGPSRTYTVLCSVNVSDALPSAEDDDEDDDNSSSEEKAAENSKPNRPLWSHPEKMEKKLHAVPAAKTVKFRCPANGTPTPTLRWLKNNRAFQQDQRIGGYKVRSQTWSLIMDSVVPSDKGNYTCIVENKYGAINHTYQLDVVERSPHRPILQAGLPANTSVTVGTTAEFSCKVYSDPQPHIQWLRHIEINGSRVASDGFPYVEILKTAGVNTSDKDME...
animal organ development cell differentiation phosphorylation positive regulation of cell population proliferation regulation of macromolecule metabolic process cytoplasmic vesicle; cytosol; nucleus; plasma membrane ATP binding fibroblast growth factor receptor activity Xenopus laevis Alternative splicing ATP-binding C...
cell cycle cell division cell wall organization peptidoglycan biosynthetic process regulation of cell shape
cytosol
ATP binding magnesium ion binding UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase activity
Escherichia coli
3D-structure ATP-binding Cell cycle Cell division Cell shape Cell wall biogenesis/degradation Cytoplasm Direct protein sequencing Ligase Magnesium Nucleotide-binding Peptidoglycan synthesis Reference proteome
MADRNLRDLL
MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGVAAIIAEAKDEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHEPSDNLRLVGVTGTNGKTTTTQLLAQWSQLLGEISAVMGTVGNGLLGKVIPTENTTGSAVDVQHELAGLVDQGATFCAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSEHHCGQAIINADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATEVNYHDSGATIRFSSSWGDGEIESHLMGAFNVSNLLLALATLL...
cell cycle cell division cell wall organization peptidoglycan biosynthetic process regulation of cell shape cytosol ATP binding magnesium ion binding UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase activity Escherichia coli 3D-structure ATP-binding Cell cycle Cell division Cell shape Cell wall biogene...
box C/D RNA 5'-end processing meiotic cell cycle nuclear-transcribed mRNA catabolic process RNA metabolic process rRNA processing termination of RNA polymerase II transcription termination of RNA polymerase II transcription, exosome-dependent U2 snRNA 3'-end processing U4 snRNA 3'-end processing
nucleolus; nucleoplasm; nucleus
double-stranded RNA binding double-stranded RNA-specific ribonuclease activity metal ion binding rDNA binding ribonuclease III activity RNA stem-loop binding
Schizosaccharomyces pombe
Endonuclease Hydrolase Magnesium Meiosis Metal-binding Nuclease Phosphoprotein Reference proteome RNA-binding
MGRFKRHHEG
MGRFKRHHEGDSDSSSSASDSLSRGRRSLGHKRSSHIKNRQYYILEKKIRKLMFAMKALLEETKHSTKDDVNLVIPGSTWSHIEGVYEMLKSRHDRQNEPVIEEPSSHPKNQKNQENNEPTSEEFEEGEYPPPLPPLRSEKLKEQVFMHISRAYEIYPNQSNPNELLDIHNERLEFLGDSFFNLFTTRIIFSKFPQMDEGSLSKLRAKFVGNESADKFARLYGFDKTLVLSYSAEKDQLRKSQKVIADTFEAYLGALILDGQEETAFQWVSRLLQPKIANITVQRPIDKLAKSKLFHKYSTLGHIEYRWVDGAGGSAEGY...
box C/D RNA 5'-end processing meiotic cell cycle nuclear-transcribed mRNA catabolic process RNA metabolic process rRNA processing termination of RNA polymerase II transcription termination of RNA polymerase II transcription, exosome-dependent U2 snRNA 3'-end processing U4 snRNA 3'-end processing nucleolus; nucleoplasm;...
cell cycle cell division positive regulation of mitotic metaphase/anaphase transition positive regulation of mitotic sister chromatid separation signaling
cytoplasm; cytosol; nucleus; PTW/PP1 phosphatase complex
protein phosphatase activator activity protein phosphatase regulator activity
Schizosaccharomyces pombe
Cell cycle Cell division Leucine-rich repeat Mitosis Nucleus Phosphoprotein Reference proteome Repeat
MSNVSSEDGI
MSNVSSEDGIAPETQLIIDDPDVQQIDADEDLLDDVPDDVDCVELIQSRIQSMASLGLERFKNLQSLCLRQNQIKKIESVPETLTELDLYDNLIVRIENLDNVKNLTYLDLSFNNIKTIRNINHLKGLENLFFVQNRIRRIENLEGLDRLTNLELGGNKIRVIENLDTLVNLEKLWVGKNKITKFENFEKLQKLSLLSIQSNRITQFENLACLSHCLRELYVSHNGLTSFSGIEVLENLEILDVSNNMIKHLSYLAGLKNLVELWASNNELSSFQEIEDELSGLKKLETVYFEGNPLQKTNPAVYRNKVRLCLPQLRQID...
cell cycle cell division positive regulation of mitotic metaphase/anaphase transition positive regulation of mitotic sister chromatid separation signaling cytoplasm; cytosol; nucleus; PTW/PP1 phosphatase complex protein phosphatase activator activity protein phosphatase regulator activity Schizosaccharomyces pombe Cel...
hydrogen peroxide catabolic process response to oxidative stress
extracellular region
heme binding lactoperoxidase activity metal ion binding
Arachis hypogaea
3D-structure Calcium Disulfide bond Glycoprotein Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase Pyrrolidone carboxylic acid Secreted Signal
MALPISKVDF
MALPISKVDFLIFMCLIGLGSAQLSSNFYATKCPNALSTIKSAVNSAVAKEARMGASLLRLHFHDCFVQGCDASVLLDDTSNFTGEKTAGPNANSIRGFEVIDTIKSQVESLCPGVVSCADILAVAARDSVVALGGASWNVLLGRRDSTTASLSSANSDLPAPFFNLSGLISAFSNKGFTTKELVTLSGAHTIGQAQCTAFRTRIYNESNIDPTYAKSLQANCPSVGGDTNLSPFDVTTPNKFDNAYYINLRNKKGLLHSDQQLFNGVSTDSQVTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQIRTNCRKTN
hydrogen peroxide catabolic process response to oxidative stress extracellular region heme binding lactoperoxidase activity metal ion binding Arachis hypogaea 3D-structure Calcium Disulfide bond Glycoprotein Heme Hydrogen peroxide Iron Metal-binding Oxidoreductase Peroxidase Pyrrolidone carboxylic acid Secreted Signal ...
angiotensin-activated signaling pathway cellular response to aldosterone intracellular sodium ion homeostasis intracellular steroid hormone receptor signaling pathway positive regulation of non-canonical NF-kappaB signal transduction positive regulation of transcription by RNA polymerase II potassium ion homeostasis pr...
endoplasmic reticulum membrane; GABA-ergic synapse; glutamatergic synapse; nucleus; postsynaptic density, intracellular component; presynaptic active zone cytoplasmic component; receptor complex
DNA-binding transcription factor activity double-stranded DNA binding estrogen response element binding histone acetyltransferase binding identical protein binding nuclear receptor activity nuclear steroid receptor activity protein-containing complex binding sequence-specific DNA binding sequence-specific double-strand...
Rattus norvegicus
Alternative splicing Cytoplasm DNA-binding Endoplasmic reticulum Lipid-binding Membrane Metal-binding Nucleus Phosphoprotein Receptor Reference proteome Steroid-binding Transcription Transcription regulation Zinc Zinc-finger
METKGYHSLP
METKGYHSLPEGLDMERRWSQVSQTLERSSLGPAERTTENNYMEIVNVSCVSGAIPNNSTQGSSKEKHELLPYIQQDNSRSGILPSDIKTELESKELSATVAESMGLYMDSVRDAEYTYDQQNQQGSLSPTKIYQNMEQLVKFYKENGHRSSTLSAMSRPLRSFMPDSAASMNGGALRAIVKSPIICHEKSSSVSSPLNMASSVCSPVGINSMSSSTTSFGSFPVHSPITQGTSLTCSPSVENRGSRSHSPTHASNVGSPLSSPLSSMKSPISSPPSHCSVKSPVSSPNNVPLRSSVSSPANLNNSRCSVSSPSNNTNNR...
angiotensin-activated signaling pathway cellular response to aldosterone intracellular sodium ion homeostasis intracellular steroid hormone receptor signaling pathway positive regulation of non-canonical NF-kappaB signal transduction positive regulation of transcription by RNA polymerase II potassium ion homeostasis pr...
endosomal lumen acidification Golgi lumen acidification proton transmembrane transport vacuolar acidification
fungal-type vacuole membrane; Golgi membrane; proton-transporting V-type ATPase complex; vacuolar proton-transporting V-type ATPase complex; vacuolar proton-transporting V-type ATPase, V1 domain
proton-transporting ATPase activity, rotational mechanism
Saccharomyces cerevisiae
3D-structure Acetylation Coiled coil Direct protein sequencing Hydrogen ion transport Ion transport Membrane Reference proteome Transport Vacuole
MSSAITALTP
MSSAITALTPNQVNDELNKMQAFIRKEAEEKAKEIQLKADQEYEIEKTNIVRNETNNIDGNFKSKLKKAMLSQQITKSTIANKMRLKVLSAREQSLDGIFEETKEKLSGIANNRDEYKPILQSLIVEALLKLLEPKAIVKALERDVDLIESMKDDIMREYGEKAQRAPLEEIVISNDYLNKDLVSGGVVVSNASDKIEINNTLEERLKLLSEEALPAIRLELYGPSKTRKFFD
endosomal lumen acidification Golgi lumen acidification proton transmembrane transport vacuolar acidification fungal-type vacuole membrane; Golgi membrane; proton-transporting V-type ATPase complex; vacuolar proton-transporting V-type ATPase complex; vacuolar proton-transporting V-type ATPase, V1 domain proton-transpor...
exit from mitosis intracellular signal transduction nuclear division phosphorylation regulation of cytokinesis regulation of protein localization to cell division site vacuolar acidification
cellular bud neck; nucleus; Sid2-Mob1 complex; spindle pole body
ATP binding protein kinase activity protein serine kinase activity protein serine/threonine kinase activity RNA binding
Saccharomyces cerevisiae
3D-structure ATP-binding Cell cycle Cytoplasm Cytoskeleton Kinase Nucleotide-binding Nucleus Phosphoprotein Reference proteome RNA-binding Serine/threonine-protein kinase Transferase
MLSKSEKNVD
MLSKSEKNVDLLAGNMSNLSFDGHGTPGGTGLFPNQNITKRRTRPAGINDSPSPVKPSFFPYEDTSNMDIDEVSQPDMDVSNSPKKLPPKFYERATSNKTQRVVSVCKMYFLEHYCDMFDYVISRRQRTKQVLEYLQQQSQLPNSDQIKLNEEWSSYLQREHQVLRKRRLKPKNRDFEMITQVGQGGYGQVYLARKKDTKEVCALKILNKKLLFKLNETKHVLTERDILTTTRSEWLVKLLYAFQDLQSLYLAMEFVPGGDFRTLLINTRCLKSGHARFYISEMFCAVNALHDLGYTHRDLKPENFLIDAKGHIKLTDFG...
exit from mitosis intracellular signal transduction nuclear division phosphorylation regulation of cytokinesis regulation of protein localization to cell division site vacuolar acidification cellular bud neck; nucleus; Sid2-Mob1 complex; spindle pole body ATP binding protein kinase activity protein serine kinase activi...
intracellular signal transduction negative regulation of endocytosis phosphorylation regulation of sphingolipid biosynthetic process
cytoplasm; cytosol; Golgi apparatus; plasma membrane
ATP binding protein serine kinase activity protein serine/threonine kinase activity
Saccharomyces cerevisiae
ATP-binding Cytoplasm Direct protein sequencing Kinase Nucleotide-binding Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase
MSSLTRLLQE
MSSLTRLLQEKRKNETSNSSPRTSADTLTTTPESQSLDLHSRNKSSSHIGSVSNSSSSDRNRANVPVPGSVTTVTQIYSEEDSSSTAGSSLDDRNQFSSSFLNANFAHTASFYGTSAQSRDRFGSLINDQGTAGLSSHGGSFAAQNRITSRLSTTSHTSGRAIPSLSSSIPYSVPNSNKDNNSSNSNSSSLSSSWLETYAGGMPNNISAIDSNVISSPKVDSVEPRFVISKQKLQKASMDSNNANATQSRSISRSGSFSSQLGNFFFSKNSKESSNSNSAGMSFSANSNGPSPNIKNPNVTNGSTPIPKPIRARQSSIYS...
intracellular signal transduction negative regulation of endocytosis phosphorylation regulation of sphingolipid biosynthetic process cytoplasm; cytosol; Golgi apparatus; plasma membrane ATP binding protein serine kinase activity protein serine/threonine kinase activity Saccharomyces cerevisiae ATP-binding Cytoplasm Di...
endoplasmic reticulum to Golgi vesicle-mediated transport intracellular protein transport positive regulation of SNARE complex assembly regulation of Ras protein signal transduction retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum vesicle fusion with Golgi apparatus
COPII-coated ER to Golgi transport vesicle; cytoplasm; cytosol; endoplasmic reticulum; Golgi membrane; membrane
SNARE binding syntaxin binding
Saccharomyces cerevisiae
3D-structure Cytoplasm Membrane Protein transport Reference proteome Repeat Transport
MAVEEIASRK
MAVEEIASRKDISLRDMQISAILKMLFLNKDLNNNDNITTITDDIFNQQEIIWKVLILDIKSTATISSVLRVNDLLKAGITVHSLIKQDRSPLPDVPAIYFVSPTKENIDIIVNDLKSDKYSEFYINFTSSLPRNLLEDLAQQVSITGKSDKIKQVYDQYLDFIVTEPELFSLEISNAYLTLNDPKTTEEEITGLCANIADGLFNTVLTINSIPIIRAAKGGPAEIIAEKLGTKLRDFVINTNSSSTSTLQGNDSLERGVLIILDRNIDFASMFSHSWIYQCMVFDIFKLSRNTVTIPLESKENGTDNTTAKPLATKKYD...
endoplasmic reticulum to Golgi vesicle-mediated transport intracellular protein transport positive regulation of SNARE complex assembly regulation of Ras protein signal transduction retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum vesicle fusion with Golgi apparatus COPII-coated ER to Golgi transpo...
endoplasmic reticulum to Golgi vesicle-mediated transport intracellular protein transport retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum vesicle fusion vesicle fusion with endoplasmic reticulum vesicle fusion with Golgi apparatus
cytoplasmic side of endoplasmic reticulum membrane; endoplasmic reticulum; endoplasmic reticulum membrane; endoplasmic reticulum-Golgi intermediate compartment; ER to Golgi transport vesicle membrane; Golgi apparatus; Golgi membrane; Golgi to ER transport vesicle membrane; membrane; SNARE complex
SNAP receptor activity
Saccharomyces cerevisiae
Coiled coil Endoplasmic reticulum ER-Golgi transport Golgi apparatus Membrane Phosphoprotein Protein transport Reference proteome Transmembrane Transmembrane helix Transport
MIKSTLIYRE
MIKSTLIYREDGLPLCTSVDNENDPSLFEQKQKVKIVVSRLTPQSATEATLESGSFEIHYLKKSMVYYFVICESGYPRNLAFSYLNDIAQEFEHSFANEYPKPTVRPYQFVNFDNFLQMTKKSYSDKKVQDNLDQLNQELVGVKQIMSKNIEDLLYRGDSLDKMSDMSSSLKETSKRYRKSAQKINFDLLISQYAPIVIVAFFFVFLFWWIFLK
endoplasmic reticulum to Golgi vesicle-mediated transport intracellular protein transport retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum vesicle fusion vesicle fusion with endoplasmic reticulum vesicle fusion with Golgi apparatus cytoplasmic side of endoplasmic reticulum membrane; endoplasmic ret...
deoxyribonucleoside triphosphate biosynthetic process DNA damage checkpoint signaling DNA repair DNA replication initiation meiotic recombination checkpoint signaling negative regulation of DNA damage checkpoint negative regulation of phosphorylation phosphorylation protein localization regulation of DNA repair
cytoplasm; cytosol; nucleus
ATP binding DNA replication origin binding protein kinase activity protein serine kinase activity protein serine/threonine kinase activity protein serine/threonine/tyrosine kinase activity protein tyrosine kinase activity
Saccharomyces cerevisiae
3D-structure ATP-binding Cell cycle DNA damage Kinase Nucleotide-binding Nucleus Phosphoprotein Reference proteome Repeat Serine/threonine-protein kinase Transferase Tyrosine-protein kinase
MENITQPTQQ
MENITQPTQQSTQATQRFLIEKFSQEQIGENIVCRVICTTGQIPIRDLSADISQVLKEKRSIKKVWTFGRNPACDYHLGNISRLSNKHFQILLGEDGNLLLNDISTNGTWLNGQKVEKNSNQLLSQGDEITVGVGVESDILSLVIFINDKFKQCLEQNKVDRIRSNLKNTSKIASPGLTSSTASSMVANKTGIFKDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDL...
deoxyribonucleoside triphosphate biosynthetic process DNA damage checkpoint signaling DNA repair DNA replication initiation meiotic recombination checkpoint signaling negative regulation of DNA damage checkpoint negative regulation of phosphorylation phosphorylation protein localization regulation of DNA repair cytopla...
cell redox homeostasis deoxyribonucleotide biosynthetic process endoplasmic reticulum to Golgi vesicle-mediated transport protein deglutathionylation protein transport retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum vacuole fusion, non-autophagic vacuole inheritance
cytoplasm; cytosol; fungal-type vacuole; Golgi membrane; membrane fusion priming complex; mitochondrial intermembrane space; mitochondrion; nucleus
disulfide oxidoreductase activity protein-disulfide reductase activity
Saccharomyces cerevisiae
3D-structure Cytoplasm Deoxyribonucleotide synthesis Direct protein sequencing Disulfide bond Electron transport Golgi apparatus Isopeptide bond Membrane Mitochondrion Nucleus Protein transport Redox-active center Reference proteome Transport Ubl conjugation
MVTQFKTASE
MVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA
cell redox homeostasis deoxyribonucleotide biosynthetic process endoplasmic reticulum to Golgi vesicle-mediated transport protein deglutathionylation protein transport retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum vacuole fusion, non-autophagic vacuole inheritance cytoplasm; cytosol; fungal-type...
phosphorylation photosynthesis pyruvate metabolic process
chloroplast
ATP binding kinase activity metal ion binding pyruvate, phosphate dikinase activity
Flaveria trinervia
3D-structure Alternative promoter usage ATP-binding Chloroplast Cytoplasm Kinase Magnesium Metal-binding Nucleotide-binding Phosphoprotein Photosynthesis Plastid Pyruvate Transferase Transit peptide
MMSSLSVEGM
MMSSLSVEGMLLKSARESCLPARVNQRRNGDLRRLNHHRQSSFVRCLTPARVSRPELRSSGLTPPRAVLNPVSPPVTTAKKRVFTFGKGRSEGNRDMKSLLGGKGANLAEMSSIGLSVPPGLTISTEACEEYQQNGKSLPPGLWDEISEGLDYVQKEMSASLGDPSKPLLLSVRSGAAISMPGMMDTVLNLGLNDEVVAGLAGKSGARFAYDSYRRFLDMFGNVVMGIPHSLFDEKLEQMKAEKGIHLDTDLTAADLKDLVEKYKNVYVEAKGEKFPTDPKKQLELAVNAVFDSWDSPRANKYRSINQITGLKGTAVNIQ...
phosphorylation photosynthesis pyruvate metabolic process chloroplast ATP binding kinase activity metal ion binding pyruvate, phosphate dikinase activity Flaveria trinervia 3D-structure Alternative promoter usage ATP-binding Chloroplast Cytoplasm Kinase Magnesium Metal-binding Nucleotide-binding Phosphoprotein Photosy...
adherens junction organization calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules cell adhesion cell morphogenesis cell-cell adhesion mediated by cadherin cell-cell junction assembly hair cycle process homophilic cell adhesion via plasma membrane adhesion molecules keratinization negative ...
adherens junction; catenin complex; cell junction; cytoplasm; plasma membrane
cadherin binding calcium ion binding
Homo sapiens
3D-structure Alternative splicing Calcium Cell adhesion Cell membrane Cleavage on pair of basic residues Disease variant Ectodermal dysplasia Glycoprotein Hypotrichosis Membrane Metal-binding Reference proteome Repeat Sensory transduction Signal Transmembrane Transmembrane helix Vision
MGLPRGPLAS
MGLPRGPLASLLLLQVCWLQCAASEPCRAVFREAEVTLEAGGAEQEPGQALGKVFMGCPGQEPALFSTDNDDFTVRNGETVQERRSLKERNPLKIFPSKRILRRHKRDWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD...
adherens junction organization calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules cell adhesion cell morphogenesis cell-cell adhesion mediated by cadherin cell-cell junction assembly hair cycle process homophilic cell adhesion via plasma membrane adhesion molecules keratinization negative ...
exocytosis Golgi to plasma membrane transport intracellular protein transport vesicle docking involved in exocytosis vesicle tethering involved in exocytosis
cellular bud neck; cellular bud tip; exocyst; incipient cellular bud site; mating projection tip; plasma membrane; prospore membrane
small GTPase binding
Saccharomyces cerevisiae
3D-structure Cell membrane Coiled coil Cytoplasm Exocytosis Membrane Phosphoprotein Protein transport Reference proteome Transport
MDQEGQPLLS
MDQEGQPLLSKDFQQVLLATASGNNSSWTERAVLNNESTDAVKHEPALGQNDVFDLDPLSFDKWVPFLRRALDKNQLDPVIDELENSIEDNFQGLELQLLQDSQMNDKLETSIDEIANIQGMVQDTLSSEISKFQIRLSESANELIVKKQMYVNNKKISLKISEATILITKVVRILELSSKCQELITERKFFKVLQNLDSLEKLYLQEFKNYNFQFLIEIYNSIPFLQKVTKDECINLIRNSLNLNLGKNLIKVGQEFVAIYENELLPQWLETRSKMKLTNFKFNSPIEISMRDESFLAKLNLGEFFQLDDFHDSIMIFQ...
exocytosis Golgi to plasma membrane transport intracellular protein transport vesicle docking involved in exocytosis vesicle tethering involved in exocytosis cellular bud neck; cellular bud tip; exocyst; incipient cellular bud site; mating projection tip; plasma membrane; prospore membrane small GTPase binding Saccharo...
antimicrobial humoral immune response mediated by antimicrobial peptide defense response to Gram-negative bacterium defense response to Gram-positive bacterium innate immune response
extracellular space
lipopolysaccharide binding
Bos taurus
Antibiotic Antimicrobial Direct protein sequencing Disulfide bond Pyrrolidone carboxylic acid Reference proteome Secreted Signal
METPRASLSL
METPRASLSLGRWSLWLLLLGLALPSASAQALSYREAVLRAVDQLNEQSSEPNIYRLLELDQPPQDDEDPDSPKRVSFRVKETVCSRTTQQPPEQCDFKENGLLKRCEGTVTLDQVRGNFDITCNNHQSIRITKQPWAPPQAARLCRIVVIRVCR
antimicrobial humoral immune response mediated by antimicrobial peptide defense response to Gram-negative bacterium defense response to Gram-positive bacterium innate immune response extracellular space lipopolysaccharide binding Bos taurus Antibiotic Antimicrobial Direct protein sequencing Disulfide bond Pyrrolidone c...
cellular response to leukemia inhibitory factor genomic imprinting in utero embryonic development positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II spermatid development
cytoplasm; nucleus; PcG protein complex; protein-containing complex; transcription regulator complex
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity, RNA polymerase II-specific metal ion binding RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific DNA binding sequence-specific double-stranded DNA binding
Mus musculus
Activator DNA-binding Isopeptide bond Metal-binding Nucleus Reference proteome Repeat Transcription Transcription regulation Ubl conjugation Zinc Zinc-finger
MNEQKMNEQM
MNEQKMNEQMKKTAKTSGQKGPGGRALDRLTLKQDEARPVQNTRVEAPRVTYTIRDESEISPETEEDGFPDGYLECIIRGEFSEPILEEDFLFKSFESLEEVEQNLSRQVLEASSLLESSLEYMTKGTKQEKTEVTQETPPLRVGASSLLAGGPAEKPEGGVYCGVLSMLECPQAGCKKKLRGKTALRKHMLVHGPRRHVCAECGKAFTESSKLKRHFLVHTGEKPYQCTFEGCGKRFSLDFNLRTHIRIHTGERRFVCPFDGCEKSFIQSNNQKIHILTHAKAGKKC
cellular response to leukemia inhibitory factor genomic imprinting in utero embryonic development positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II spermatid development cytoplasm; nucleus; PcG protein complex; protein-containing complex; transcription regulator ...
de novo' AMP biosynthetic process 'de novo' IMP biosynthetic process 'de novo' XMP biosynthetic process GMP biosynthetic process purine nucleobase biosynthetic process
cytoplasm; cytosol; extracellular exosome; membrane
5-amino-4-imidazole carboxylate lyase activity ATP binding cadherin binding identical protein binding phosphoribosylaminoimidazole carboxylase activity phosphoribosylaminoimidazolesuccinocarboxamide synthase activity
Homo sapiens
3D-structure Acetylation Alternative splicing ATP-binding Decarboxylase Direct protein sequencing Disease variant Ligase Lyase Multifunctional enzyme Nucleotide-binding Phosphoprotein Purine biosynthesis Reference proteome
MATAEVLNIG
MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDG...
de novo' AMP biosynthetic process 'de novo' IMP biosynthetic process 'de novo' XMP biosynthetic process GMP biosynthetic process purine nucleobase biosynthetic process cytoplasm; cytosol; extracellular exosome; membrane 5-amino-4-imidazole carboxylate lyase activity ATP binding cadherin binding identical protein bindin...
3'-phosphoadenosine 5'-phosphosulfate metabolic process phosphatidylinositol phosphate biosynthetic process sulfate assimilation
plasma membrane
3'(2'),5'-bisphosphate nucleotidase activity magnesium ion binding
Escherichia coli
Cell inner membrane Cell membrane Hydrolase Magnesium Membrane Metal-binding Reference proteome
MLDQVCQLAR
MLDQVCQLARNAGDAIMQVYDGTKPMDVVSKADNSPVTAADIAAHTVIMDGLRTLTPDVPVLSEEDPPGWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIDHGKPILGVVYAPVMNVMYSAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHADAELKEYLQQLGEHQTTSIGSSLKFCLVAEGQAQLYPRFGPTNIWDTAAGHAVAAAAGAHVHDWQGKPLDYTPRESFLNPGFRVSIY
3'-phosphoadenosine 5'-phosphosulfate metabolic process phosphatidylinositol phosphate biosynthetic process sulfate assimilation plasma membrane 3'(2'),5'-bisphosphate nucleotidase activity magnesium ion binding Escherichia coli Cell inner membrane Cell membrane Hydrolase Magnesium Membrane Metal-binding Reference prot...
arginine biosynthetic process via ornithine gamma-aminobutyric acid catabolic process
cytosol
4-aminobutyrate transaminase activity 4-aminobutyrate:2-oxoglutarate transaminase activity 5-aminovalerate transaminase activity N2-acetyl-L-ornithine:2-oxoglutarate 5-aminotransferase activity protein homodimerization activity pyridoxal phosphate binding
Escherichia coli
3D-structure Aminotransferase Direct protein sequencing Pyridoxal phosphate Reference proteome Transferase
MNSNKELMQR
MNSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISEDDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAGNPIACVAALEVLKVFEQENL...
arginine biosynthetic process via ornithine gamma-aminobutyric acid catabolic process cytosol 4-aminobutyrate transaminase activity 4-aminobutyrate:2-oxoglutarate transaminase activity 5-aminovalerate transaminase activity N2-acetyl-L-ornithine:2-oxoglutarate 5-aminotransferase activity protein homodimerization activit...
gluconeogenesis
cytosol
ATP binding calcium ion binding magnesium ion binding phosphoenolpyruvate carboxykinase (ATP) activity
Escherichia coli
3D-structure Acetylation Allosteric enzyme ATP-binding Calcium Cytoplasm Decarboxylase Direct protein sequencing Gluconeogenesis Lyase Magnesium Manganese Metal-binding Nucleotide-binding Reference proteome
MRVNNGLTPQ
MRVNNGLTPQELEAYGISDVHDIVYNPSYDLLYQEELDPSLTGYERGVLTNLGAVAVDTGIFTGRSPKDKYIVRDDTTRDTFWWADKGKGKNDNKPLSPETWQHLKGLVTRQLSGKRLFVVDAFCGANPDTRLSVRFITEVAWQAHFVKNMFIRPSDEELAGFKPDFIVMNGAKCTNPQWKEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLLPLKGIASMHCSANVGEKGDVAVFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIKLSKEAEPEIYNAIRRDALLENVTVREDGT...
gluconeogenesis cytosol ATP binding calcium ion binding magnesium ion binding phosphoenolpyruvate carboxykinase (ATP) activity Escherichia coli 3D-structure Acetylation Allosteric enzyme ATP-binding Calcium Cytoplasm Decarboxylase Direct protein sequencing Gluconeogenesis Lyase Magnesium Manganese Metal-binding Nucleot...
metabolic process regulation of DNA-templated transcription
cytosol
catalytic activity cyclic-di-GMP binding DNA binding DNA-binding transcription factor activity protein dimerization activity
Xanthomonas campestris pv. campestris
3D-structure Activator Allosteric enzyme c-di-GMP Cytoplasm DNA-binding Reference proteome Repressor Transcription Transcription regulation Virulence
MSLGNTTVVT
MSLGNTTVVTTTVRNATPSLTLDAGTIERFLAHSHRRRYPTRTDVFRPGDPAGTLYYVISGSVSIIAEEDDDRELVLGYFGSGEFVGEMGLFIESDTREVILRTRTQCELAEISYERLQQLFQTSLSPDAPRILYAIGVQLSKRLLDTTRKASRLAFLDVTDRIVRTLHDLSKEPEAMSHPQGTQLRVSRQELARLVGCSREMAGRVLKKLQADGLLHARGKTVVLYGTR
metabolic process regulation of DNA-templated transcription cytosol catalytic activity cyclic-di-GMP binding DNA binding DNA-binding transcription factor activity protein dimerization activity Xanthomonas campestris pv. campestris 3D-structure Activator Allosteric enzyme c-di-GMP Cytoplasm DNA-binding Reference proteom...