Biological Process
stringlengths
7
1.01k
Cellular Component
stringlengths
6
867
Molecular Function
stringlengths
11
871
Organism
stringlengths
8
73
Keywords
stringlengths
1
810
Sequence 10
stringlengths
5
10
Sequence
stringlengths
5
1.02k
Combined
stringlengths
136
3.91k
compound eye development dorsal/ventral pattern formation, imaginal disc epidermis morphogenesis eye-antennal disc development head involution imaginal disc-derived wing morphogenesis leg disc proximal/distal pattern formation Malpighian tubule stellate cell differentiation midgut development negative regulation of DNA...
cytoplasm; nucleoplasm; nucleus
DNA binding DNA-binding transcription factor activity, RNA polymerase II-specific DNA-binding transcription repressor activity, RNA polymerase II-specific metal ion binding
Drosophila melanogaster
Activator Cytoplasm Developmental protein DNA-binding Metal-binding Nucleus Phosphoprotein Reference proteome Repeat Repressor Transcription Transcription regulation Wnt signaling pathway Zinc Zinc-finger
MLHEALMLEI
MLHEALMLEIYRQALNAGALPTARPRSTESANSSERCPSHDSNSSEHGGGAGSGGVGHRLDAAALSTGVMPGEGPTTLHSSFPAVPQSLPSQPPSMEAYLHMVAAAAQQYGFPLAAAAAAGAGPRLPLPLANEAAAPFKLPPQASPTASSNNSEALDFRTNLYGRAESAEPPASEGEEEEFDDGANNPLDLSVGTRKRGHESEPQLGHIQVKKMFKSDSPPANSVASPSASQLLPGVNPYLAAVAAANIFRAGQFPDWNSKNDLVVDPLEKMSDIVKGGASGMGTKEKMHSSKATTPQAASQPPKSPVQPTPNQNSESGG...
compound eye development dorsal/ventral pattern formation, imaginal disc epidermis morphogenesis eye-antennal disc development head involution imaginal disc-derived wing morphogenesis leg disc proximal/distal pattern formation Malpighian tubule stellate cell differentiation midgut development negative regulation of DNA...
adenylate cyclase-activating adrenergic receptor signaling pathway octopamine or tyramine signaling pathway positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway sensory perception of smell
plasma membrane
G protein-coupled amine receptor activity octopamine receptor activity
Drosophila melanogaster
Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Membrane Receptor Reference proteome Signal Transducer Transmembrane Transmembrane helix
MPSADQILFV
MPSADQILFVNVTTTVAAAALTAAAAVSTTKSGSGNAARGYTDSDDDAGMGTEAVANISGSLVEGLTTVTAALSTAQADKDSAGECEGAVEELHASILGLQLAVPEWEALLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRVLLLISGVWLLSLLISSPPLIGWNDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLRERARANKLNTIALKSTELE...
adenylate cyclase-activating adrenergic receptor signaling pathway octopamine or tyramine signaling pathway positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway sensory perception of smell plasma membrane G protein-coupled amine receptor activity octopamine receptor activity Dr...
ciliary neurotrophic factor-mediated signaling pathway cytokine-mediated signaling pathway developmental growth endocrine pancreas development interleukin-6-mediated signaling pathway negative regulation of collagen biosynthetic process positive regulation of cell population proliferation positive regulation of chemoki...
apical plasma membrane; ciliary neurotrophic factor receptor complex; external side of plasma membrane; extracellular region; extracellular space; interleukin-6 receptor complex; neuronal cell body membrane; plasma membrane; receptor complex
ciliary neurotrophic factor binding ciliary neurotrophic factor receptor activity cytokine receptor activity enzyme binding interleukin-11 binding interleukin-11 receptor activity interleukin-6 binding interleukin-6 receptor activity interleukin-6 receptor binding protein homodimerization activity
Mus musculus
Cell membrane Disulfide bond Glycoprotein Immunoglobulin domain Membrane Receptor Reference proteome Repeat Secreted Signal Transmembrane Transmembrane helix
MLTVGCTLLV
MLTVGCTLLVALLAAPAVALVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTP...
ciliary neurotrophic factor-mediated signaling pathway cytokine-mediated signaling pathway developmental growth endocrine pancreas development interleukin-6-mediated signaling pathway negative regulation of collagen biosynthetic process positive regulation of cell population proliferation positive regulation of chemoki...
ciliary neurotrophic factor-mediated signaling pathway cytokine-mediated signaling pathway developmental growth endocrine pancreas development interleukin-6-mediated signaling pathway positive regulation of cell population proliferation positive regulation of chemokine production positive regulation of glomerular mesan...
apical plasma membrane; ciliary neurotrophic factor receptor complex; external side of plasma membrane; extracellular region; extracellular space; interleukin-6 receptor complex; neuronal cell body membrane; receptor complex
ciliary neurotrophic factor binding cytokine receptor activity enzyme binding interleukin-11 binding interleukin-11 receptor activity interleukin-6 binding interleukin-6 receptor activity protein homodimerization activity
Rattus norvegicus
Cell membrane Disulfide bond Glycoprotein Immunoglobulin domain Membrane Receptor Reference proteome Secreted Signal Transmembrane Transmembrane helix
MLAVGCTLLV
MLAVGCTLLVALLAAPAVALVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNATIHWVYSGSQSREWTTTGNTLVLRAVQVNDTGHYLCFLDDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAFCEWHPSSTPSPTTKAVMFAKKINTTNGKSDFQVPCQYSQQLKSFSCEVEILEGDKVYHIVSLCVANSVGSRSSHNVVFQSLKMVQPDPPANLVVSAIPGXPRWLKVSWQDPESWDPSYYLLQFELRYRPVWSKXFTVWPLQVAQHQCVIHDALRGVKHVVQVRGKEEFDIGQWSKWSPEVTGTPWLAEPRTTP...
ciliary neurotrophic factor-mediated signaling pathway cytokine-mediated signaling pathway developmental growth endocrine pancreas development interleukin-6-mediated signaling pathway positive regulation of cell population proliferation positive regulation of chemokine production positive regulation of glomerular mesan...
microtubule cytoskeleton organization mitotic cell cycle
cytoplasm; microtubule
GTP binding hydrolase activity metal ion binding structural constituent of cytoskeleton
Zea mays
Acetylation Cytoplasm Cytoskeleton GTP-binding Hydrolase Magnesium Metal-binding Microtubule Nucleotide-binding Reference proteome
MRECISVHIG
MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQVPGDKTAGHHDDAFSTFFSQTGAGKHVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVEYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLDIERPNYSNLNRLVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISSAKAFHEQLSVAEITSSAFEPASMMVKCDPRHGKYMACCLMYR...
microtubule cytoskeleton organization mitotic cell cycle cytoplasm; microtubule GTP binding hydrolase activity metal ion binding structural constituent of cytoskeleton Zea mays Acetylation Cytoplasm Cytoskeleton GTP-binding Hydrolase Magnesium Metal-binding Microtubule Nucleotide-binding Reference proteome MRECISVHIG M...
7,8-dihydroneopterin 3'-triphosphate biosynthetic process dihydrobiopterin metabolic process dopamine biosynthetic process negative regulation of blood pressure negative regulation of cardiac muscle cell apoptotic process negative regulation of cellular senescence neuromuscular process controlling posture positive regu...
cytoplasm; cytoplasmic vesicle; cytosol; mitochondrion; nuclear membrane; nucleoplasm; nucleus; protein-containing complex
calcium ion binding GTP binding GTP cyclohydrolase I activity GTP-dependent protein binding GTPase activity identical protein binding mitogen-activated protein kinase binding protein homodimerization activity protein-containing complex binding zinc ion binding
Rattus norvegicus
3D-structure Allosteric enzyme Cytoplasm Direct protein sequencing GTP-binding Hydrolase Metal-binding Nucleotide-binding Nucleus Phosphoprotein Reference proteome Tetrahydrobiopterin biosynthesis Zinc
MEKPRGVRCT
MEKPRGVRCTNGFPERELPRPGASRPAEKSRPPEAKGAQPADAWKAGRPRSEEDNELNLPNLAAAYSSILRSLGEDPQRQGLLKTPWRAATAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS
7,8-dihydroneopterin 3'-triphosphate biosynthetic process dihydrobiopterin metabolic process dopamine biosynthetic process negative regulation of blood pressure negative regulation of cardiac muscle cell apoptotic process negative regulation of cellular senescence neuromuscular process controlling posture positive regu...
gluconeogenesis lipid transport malate transmembrane transport oxaloacetate transport phosphate ion transmembrane transport succinate transmembrane transport sulfate transport thiosulfate transport
mitochondrial inner membrane; mitochondrion
antiporter activity malate transmembrane transporter activity oxaloacetate transmembrane transporter activity oxoglutarate:malate antiporter activity succinate transmembrane transporter activity sulfate transmembrane transporter activity thiosulfate transmembrane transporter activity
Bos taurus
Acetylation Antiport Direct protein sequencing Lipid transport Membrane Mitochondrion Mitochondrion inner membrane Phosphoprotein Reference proteome Repeat Transmembrane Transmembrane helix Transport
MAATASPGAS
MAATASPGASGMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALISILRAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPVDQRRGYKNVFNALFRIVQEEGVPTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKPEYKNGLDVLVKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG
gluconeogenesis lipid transport malate transmembrane transport oxaloacetate transport phosphate ion transmembrane transport succinate transmembrane transport sulfate transport thiosulfate transport mitochondrial inner membrane; mitochondrion antiporter activity malate transmembrane transporter activity oxaloacetate tra...
cellular response to histamine chloride transmembrane transport gamma-aminobutyric acid signaling pathway inhibitory synapse assembly regulation of postsynaptic membrane potential synaptic transmission, GABAergic
chloride channel complex; cytoplasmic vesicle membrane; dendrite membrane; GABA-A receptor complex; neuron projection; plasma membrane; postsynapse; postsynaptic membrane; synapse
chloride channel activity GABA-A receptor activity GABA-gated chloride ion channel activity inhibitory extracellular ligand-gated monoatomic ion channel activity
Bos taurus
Alternative splicing Cell membrane Cell projection Chloride Chloride channel Cytoplasmic vesicle Disulfide bond Glycoprotein Ion channel Ion transport Lipoprotein Membrane Palmitate Phosphoprotein Postsynaptic cell membrane Reference proteome Signal Synapse Transmembrane Transmembrane helix Transport
MSSPNIWSTG
MSSPNIWSTGSSVYSTPVFSQKMTLWILLLLSLYPGLTRQKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFGQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVSDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMTVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLST...
cellular response to histamine chloride transmembrane transport gamma-aminobutyric acid signaling pathway inhibitory synapse assembly regulation of postsynaptic membrane potential synaptic transmission, GABAergic chloride channel complex; cytoplasmic vesicle membrane; dendrite membrane; GABA-A receptor complex; neuron ...
acetylcholine catabolic process acetylcholine catabolic process in synaptic cleft acetylcholine receptor signaling pathway amyloid precursor protein metabolic process cell adhesion negative regulation of synaptic transmission, cholinergic nervous system development osteoblast development positive regulation of cold-ind...
basement membrane; cell surface; extracellular region; extracellular space; Golgi apparatus; membrane; neuromuscular junction; nucleus; perinuclear region of cytoplasm; plasma membrane; side of membrane; synapse; synaptic cleft
acetylcholine binding acetylcholinesterase activity amyloid-beta binding cholinesterase activity collagen binding hydrolase activity laminin binding protein homodimerization activity protein self-association serine hydrolase activity
Homo sapiens
3D-structure Alternative splicing Blood group antigen Cell membrane Direct protein sequencing Disulfide bond Glycoprotein GPI-anchor Hydrolase Lipoprotein Membrane Neurotransmitter degradation Nucleus Reference proteome Secreted Serine esterase Signal Synapse
MRPPQCLLHT
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVL...
acetylcholine catabolic process acetylcholine catabolic process in synaptic cleft acetylcholine receptor signaling pathway amyloid precursor protein metabolic process cell adhesion negative regulation of synaptic transmission, cholinergic nervous system development osteoblast development positive regulation of cold-ind...
dermatan sulfate catabolic process glycosaminoglycan catabolic process heparan sulfate proteoglycan catabolic process
cytoplasm; lysosomal lumen; lysosome
calcium ion binding iduronate-2-sulfatase activity
Homo sapiens
3D-structure Alternative splicing Calcium Direct protein sequencing Disease variant Disulfide bond Glycoprotein Hydrolase Lysosome Metal-binding Mucopolysaccharidosis Reference proteome Signal Zymogen
MPPPRTGRGL
MPPPRTGRGLLWLGLVLSSVCVALGSETQANSTTDALNVLLIIVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVCAPSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKENGYVTMSVGKVFHPGISSNHTDDSPYSWSFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTEQAIQLLEKMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPDPEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQRKIRQSYFASVSYLDTQVGRLLSALDD...
dermatan sulfate catabolic process glycosaminoglycan catabolic process heparan sulfate proteoglycan catabolic process cytoplasm; lysosomal lumen; lysosome calcium ion binding iduronate-2-sulfatase activity Homo sapiens 3D-structure Alternative splicing Calcium Direct protein sequencing Disease variant Disulfide bond Gl...
alpha-linolenic acid metabolic process bile acid biosynthetic process bile acid metabolic process fatty acid beta-oxidation fatty acid beta-oxidation using acyl-CoA oxidase inositol trisphosphate biosynthetic process intracellular cholesterol transport lipid hydroperoxide transport phospholipid transport positive regul...
cytoplasm; cytosol; endoplasmic reticulum; membrane; mitochondrion; nucleoplasm; peroxisomal matrix; peroxisome; protein-containing complex
acetyl-CoA C-acyltransferase activity acetyl-CoA C-myristoyltransferase activity cholesterol binding cholesterol transfer activity fatty-acyl-CoA binding long-chain fatty acyl-CoA binding oleic acid binding phosphatidylcholine transfer activity phosphatidylinositol transfer activity propanoyl-CoA C-acyltransferase acti...
Homo sapiens
3D-structure Acetylation Acyltransferase Alternative promoter usage Alternative splicing Cytoplasm Direct protein sequencing Endoplasmic reticulum Lipid metabolism Lipid transport Lipid-binding Mitochondrion Peroxisome Phosphoprotein Reference proteome Transferase Transport
MSSSPWEPAT
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALG...
alpha-linolenic acid metabolic process bile acid biosynthetic process bile acid metabolic process fatty acid beta-oxidation fatty acid beta-oxidation using acyl-CoA oxidase inositol trisphosphate biosynthetic process intracellular cholesterol transport lipid hydroperoxide transport phospholipid transport positive regul...
acute-phase response animal organ regeneration bilirubin conjugation biphenyl catabolic process cellular glucuronidation cellular response to estradiol stimulus cellular response to ethanol cellular response to glucocorticoid stimulus estrogen metabolic process flavone metabolic process flavonoid glucuronidation hetero...
cytochrome complex; endoplasmic reticulum; endoplasmic reticulum chaperone complex; endoplasmic reticulum membrane; perinuclear region of cytoplasm; plasma membrane
enzyme binding enzyme inhibitor activity glucuronosyltransferase activity protein heterodimerization activity protein homodimerization activity retinoic acid binding steroid binding
Homo sapiens
Alternative splicing Cytoplasm Disease variant Endoplasmic reticulum Glycoprotein Glycosyltransferase Lipid metabolism Membrane Reference proteome Signal Transferase Transmembrane Transmembrane helix
MAVESQGGRP
MAVESQGGRPLVLGLLLCVLGPVVSHAGKILLIPVDGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQREDVKESFVSLGHNVFENDSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCSPIVAQYLSLPTVFFLHALPCSLEFEATQCPNPFSYVPRPLSSHSDHMTFLQRVKNMLIAFSQNFLCDVVYSPYATLASEFLQREVTVQDLLSSASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAM...
acute-phase response animal organ regeneration bilirubin conjugation biphenyl catabolic process cellular glucuronidation cellular response to estradiol stimulus cellular response to ethanol cellular response to glucocorticoid stimulus estrogen metabolic process flavone metabolic process flavonoid glucuronidation hetero...
bilirubin conjugation cellular glucuronidation heme catabolic process negative regulation of cellular glucuronidation negative regulation of fatty acid metabolic process negative regulation of glucuronosyltransferase activity vitamin D3 metabolic process
endoplasmic reticulum; endoplasmic reticulum membrane
enzyme binding glucuronosyltransferase activity protein heterodimerization activity protein homodimerization activity
Homo sapiens
Alternative splicing Endoplasmic reticulum Glycoprotein Glycosyltransferase Lipid metabolism Membrane Reference proteome Signal Transferase Transmembrane Transmembrane helix
MARGLQVPLP
MARGLQVPLPRLATGLLLLLSVQPWAESGKVLVVPTDGSPWLSMREALRELHARGHQAVVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLKRYSRSMAIMNNVSLALHRCCVELLHNEALIRHLNATSFDVVLTDPVNLCGAVLAKYLSIPAVFFWRYIPCDLDFKGTQCPNPSSYIPKLLTTNSDHMTFLQRVKNMLYPLALSYICHTFSAPYASLASELFQREVSVVDLVSYASVWLFRGDFVMDYPRPIMPNMVFIGGINCANGKPLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKA...
bilirubin conjugation cellular glucuronidation heme catabolic process negative regulation of cellular glucuronidation negative regulation of fatty acid metabolic process negative regulation of glucuronosyltransferase activity vitamin D3 metabolic process endoplasmic reticulum; endoplasmic reticulum membrane enzyme bind...
cellular response to dexamethasone stimulus cholesterol metabolic process detection of UV erythrocyte differentiation heme A biosynthetic process heme B biosynthetic process heme biosynthetic process heme O biosynthetic process multicellular organismal-level iron ion homeostasis porphyrin-containing compound biosynthet...
mitochondrial inner membrane; mitochondrial matrix; mitochondrion
2 iron, 2 sulfur cluster binding ferrochelatase activity heme binding iron ion binding iron-responsive element binding protein homodimerization activity tetrapyrrole binding
Mus musculus
2Fe-2S Acetylation Direct protein sequencing Disease variant Heme biosynthesis Iron Iron-sulfur Lyase Membrane Metal-binding Mitochondrion Mitochondrion inner membrane Porphyrin biosynthesis Reference proteome Transit peptide
MLSASANMAA
MLSASANMAAALRAAGALLREPLVHGSSRACQPWRCQSGAAVAATTEKVHHAKTTKPQAQPERRKPKTGILMLNMGGPETLGEVQDFLQRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKMWTSKQGEGMVKLLDELSPATAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNEVGQKPTMKWSTIDRWPTHPLLIQCFADHILKELNHFPEEKRSEVVILFSAHSLPMSVVNRGDPYPQEVGATVHKVMEKLGYPNPYRLVWQSKVGPVPWLGPQTDEAIKG...
cellular response to dexamethasone stimulus cholesterol metabolic process detection of UV erythrocyte differentiation heme A biosynthetic process heme B biosynthetic process heme biosynthetic process heme O biosynthetic process multicellular organismal-level iron ion homeostasis porphyrin-containing compound biosynthet...
absorption of visible light cellular response to light stimulus G protein-coupled receptor signaling pathway light absorption phototransduction protein homotrimerization rhodopsin mediated signaling pathway visual perception
membrane; photoreceptor disc membrane; photoreceptor outer segment; plasma membrane
11-cis retinal binding G protein-coupled photoreceptor activity G-protein alpha-subunit binding protein homodimerization activity
Gallus gallus
Cell projection Chromophore Disulfide bond G-protein coupled receptor Glycoprotein Lipoprotein Membrane Palmitate Phosphoprotein Photoreceptor protein Receptor Reference proteome Retinal protein Sensory transduction Transducer Transmembrane Transmembrane helix Vision
MNGTEGQDFY
MNGTEGQDFYVPMSNKTGVVRSPFEYPQYYLAEPWKFSALAAYMFMLILLGFPVNFLTLYVTIQHKKLRTPLNYILLNLVVADLFMVFGGFTTTMYTSMNGYFVFGVTGCYIEGFFATLGGEIALWSLVVLAVERYVVVCKPMSNFRFGENHAIMGVAFSWIMAMACAAPPLFGWSRYIPEGMQCSCGIDYYTLKPEINNESFVIYMFVVHFMIPLAVIFFCYGNLVCTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTNQGSDFGPIFMTIPAFFAKSSAIYNPVIYIVMNKQFRNCMITT...
absorption of visible light cellular response to light stimulus G protein-coupled receptor signaling pathway light absorption phototransduction protein homotrimerization rhodopsin mediated signaling pathway visual perception membrane; photoreceptor disc membrane; photoreceptor outer segment; plasma membrane 11-cis reti...
absorption of UV light absorption of visible light cellular response to light stimulus G protein-coupled receptor signaling pathway light absorption phototransduction protein homotrimerization visual perception
cell body; photoreceptor inner segment membrane; photoreceptor outer segment; vesicle
chloride ion binding G protein-coupled photoreceptor activity protein homodimerization activity
Gallus gallus
Chromophore Direct protein sequencing Disulfide bond G-protein coupled receptor Glycoprotein Membrane Phosphoprotein Photoreceptor protein Receptor Reference proteome Retinal protein Sensory transduction Transducer Transmembrane Transmembrane helix Vision
MAAWEAAFAA
MAAWEAAFAARRRHEEEDTTRDSVFTYTNSNNTRGPFEGPNYHIAPRWVYNLTSVWMIFVVAASVFTNGLVLVATWKFKKLRHPLNWILVNLAVADLGETVIASTISVINQISGYFILGHPMCVVEGYTVSACGITALWSLAIISWERWFVVCKPFGNIKFDGKLAVAGILFSWLWSCAWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSDPGVQSYMVVLMVTCCFFPLAIIILCYLQVWLAIRAVAAQQKESESTQKAEKEVSRMVVVMIVAYCFCWGPYTFFACFAAANPGYAFHPLAAALPAYFAKSATIYNPIIYV...
absorption of UV light absorption of visible light cellular response to light stimulus G protein-coupled receptor signaling pathway light absorption phototransduction protein homotrimerization visual perception cell body; photoreceptor inner segment membrane; photoreceptor outer segment; vesicle chloride ion binding G ...
adenosine catabolic process DNA damage response hypoxanthine biosynthetic process hypoxanthine salvage inosine biosynthetic process purine nucleotide interconversion purine nucleotide salvage purine ribonucleoside monophosphate biosynthetic process
cytosol
2'-deoxyadenosine deaminase activity adenosine deaminase activity zinc ion binding
Escherichia coli
Hydrolase Metal-binding Nucleotide metabolism Reference proteome Zinc
MIDTTLPLTD
MIDTTLPLTDIHRHLDGNIRPQTILELGRQYNISLPAQSLETLIPHVQVIANEPDLVSFLTKLDWGVKVLASLDACRRVAFENIEDAARHGLHYVELRFSPGYMAMAHQLPVAGVVEAVIDGVREGCRTFGVQAKLIGIMSRTFGEAACQQELEAFLAHRDQITALDLAGDELGFPGSLFLSHFNRARDAGWHITVHAGEAAGPESIWQAIRELGAERIGHGVKAIEDRALMDFLAEQQIGIESCLTSNIQTSTVAELAAHPLKTFLEHGIRASINTDDPGVQGVDIIHEYTVAAPAAGLSREQIRQAQINGLEMAFLSA...
adenosine catabolic process DNA damage response hypoxanthine biosynthetic process hypoxanthine salvage inosine biosynthetic process purine nucleotide interconversion purine nucleotide salvage purine ribonucleoside monophosphate biosynthetic process cytosol 2'-deoxyadenosine deaminase activity adenosine deaminase activi...
DNA repair DNA replication DNA topological change DNA unwinding involved in DNA replication double-strand break repair via homologous recombination establishment of protein localization heteroduplex formation mitotic recombination nucleotide-excision repair protein ubiquitination reciprocal meiotic recombination sporul...
chromosome, telomeric region; condensed nuclear chromosome; cytoplasm; cytosol; DNA replication factor A complex; nucleus
double-stranded DNA binding metal ion binding mRNA binding sequence-specific DNA binding single-stranded DNA binding
Saccharomyces cerevisiae
3D-structure Acetylation Direct protein sequencing DNA replication DNA-binding Metal-binding Nucleus Phosphoprotein Reference proteome Zinc Zinc-finger
MSSVQLSRGD
MSSVQLSRGDFHSIFTNKQRYDNPTGGVYQVYNTRKSDGANSNRKNLIMISDGIYHMKALLRNQAASKFQSMELQRGDIIRVIIAEPAIVRERKKYVLLVDDFELVQSRADMVNQTSTFLDNYFSEHPNETLKDEDITDSGNVANQTNASNAGVPDMLHSNSNLNANERKFANENPNSQKTRPIFAIEQLSPYQNVWTIKARVSYKGEIKTWHNQRGDGKLFNVNFLDTSGEIRATAFNDFATKFNEILQEGKVYYVSKAKLQPAKPQFTNLTHPYELNLDRDTVIEECFDESNVPKTHFNFIKLDAIQNQEVNSNVDVL...
DNA repair DNA replication DNA topological change DNA unwinding involved in DNA replication double-strand break repair via homologous recombination establishment of protein localization heteroduplex formation mitotic recombination nucleotide-excision repair protein ubiquitination reciprocal meiotic recombination sporul...
fatty acid biosynthetic process
chloroplast
acyl- desaturase activity metal ion binding stearoyl- desaturase activity
Ricinus communis
3D-structure Chloroplast Fatty acid biosynthesis Fatty acid metabolism Iron Lipid biosynthesis Lipid metabolism Metal-binding Oxidoreductase Plastid Transit peptide
MALKLNPFLS
MALKLNPFLSQTQKLPSFALPPMASTRSPKFYMASTLKSGSKEVENLKKPFMPPREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGFDEQVRELRERAKEIPDDYFVVLVGDMITEEALPTYQTMLNTLDGVRDETGASPTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLGFIYTSFQERATFISHGNTARQAKEHGDIKLAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFADMMRKKISMPAHLMYDGRDDNLFDHFSAVAQ...
fatty acid biosynthetic process chloroplast acyl- desaturase activity metal ion binding stearoyl- desaturase activity Ricinus communis 3D-structure Chloroplast Fatty acid biosynthesis Fatty acid metabolism Iron Lipid biosynthesis Lipid metabolism Metal-binding Oxidoreductase Plastid Transit peptide MALKLNPFLS MALKLNPFL...
proteolysis
host cell cytoplasm; T=13 icosahedral viral capsid
metal ion binding serine-type peptidase activity structural molecule activity
Avian infectious bursal disease virus
Capsid protein Host cytoplasm Hydrolase Metal-binding Protease Serine protease T=13 icosahedral capsid protein Virion
MTNLQDQTQQ
MTNLQDQTQQIVPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGAHYTLQSNGNLKFDQMLLTAQNLPASYNYCRLVSRSLTVRSSTLPGGVYALNGTINAVTFQGSLSELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITAADDYQFSSQYQPGGVTITLFSANIDAITSLSVGGELVFQTSVQGLVLGATIYFIGFDGTTVITRAVAADNGLTAGTDNLMPFNLVIPTNEITQPITSIKLEVVTSKSGGQ...
proteolysis host cell cytoplasm; T=13 icosahedral viral capsid metal ion binding serine-type peptidase activity structural molecule activity Avian infectious bursal disease virus Capsid protein Host cytoplasm Hydrolase Metal-binding Protease Serine protease T=13 icosahedral capsid protein Virion MTNLQDQTQQ MTNLQDQTQQ...
hydrogen peroxide catabolic process response to lipid hydroperoxide
extracellular exosome; extracellular region; extracellular space
glutathione peroxidase activity identical protein binding selenium binding
Homo sapiens
3D-structure Direct protein sequencing Oxidoreductase Peroxidase Reference proteome Secreted Selenocysteine Signal
MARLLQASCL
MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK
hydrogen peroxide catabolic process response to lipid hydroperoxide extracellular exosome; extracellular region; extracellular space glutathione peroxidase activity identical protein binding selenium binding Homo sapiens 3D-structure Direct protein sequencing Oxidoreductase Peroxidase Reference proteome Secreted Seleno...
cellular response to interleukin-1 cellular response to tumor necrosis factor cellular response to type II interferon chemokine-mediated signaling pathway chemotaxis eosinophil chemotaxis G protein-coupled receptor signaling pathway inflammatory response intracellular calcium ion homeostasis lymphocyte chemotaxis monoc...
extracellular region; extracellular space
CCR chemokine receptor binding chemokine activity
Homo sapiens
3D-structure Chemotaxis Cytokine Direct protein sequencing Disulfide bond Glycoprotein Reference proteome Secreted Signal
MQIITTALVC
MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
cellular response to interleukin-1 cellular response to tumor necrosis factor cellular response to type II interferon chemokine-mediated signaling pathway chemotaxis eosinophil chemotaxis G protein-coupled receptor signaling pathway inflammatory response intracellular calcium ion homeostasis lymphocyte chemotaxis monoc...
disruption by virus of host JAK-STAT cascade via inhibition of STAT1 activity disruption by virus of host JAK-STAT cascade via inhibition of STAT2 activity microtubule-dependent intracellular transport of viral material towards nucleus suppression by virus of host toll-like receptor signaling pathway suppression by vir...
host cell cytoplasm; host cell nucleus; virion component
molecular condensate scaffold activity RNA-dependent RNA polymerase activity
Rabies virus
3D-structure Alternative initiation Chaperone Cytoplasmic inwards viral transport Host cytoplasm Host nucleus Host-virus interaction Inhibition of host innate immune response by virus Inhibition of host interferon signaling pathway by virus Inhibition of host STAT1 by virus Inhibition of host STAT2 by virus Inhibition ...
MSKIFVNPSA
MSKIFVNPSAIRAGLADLEMAEETVDLINRNIEDNQAHLQGEPIEVDNLPEDMKRLHLDDEKSSNLGEMVRVGEGKYREDFQMDEGEDPNLLFQSYLDNVGVQIVRQMRSGERFLKIWSQTVEEIVSYVTVNFPNPPRRSSEDKSTQTTGRELKKETTSAFSQRESQPSKARMVAQVAPGPPALEWSATNEEDDLSVEAEIAHQIAESFSKKYKFPSRSSGIFLYNFEQLKMNLDDIVKEAKNVPGVTRLAHDGSKIPLRCVLGWVALANSKKFQLLVEADKLSKIMQDDLNRYTSC
disruption by virus of host JAK-STAT cascade via inhibition of STAT1 activity disruption by virus of host JAK-STAT cascade via inhibition of STAT2 activity microtubule-dependent intracellular transport of viral material towards nucleus suppression by virus of host toll-like receptor signaling pathway suppression by vir...
membrane fusion involved in viral entry into host cell viral entry into host cell virion attachment to host cell
host cell endosome membrane; host cell plasma membrane; membrane; viral envelope; virion membrane
structural molecule activity
Simian immunodeficiency virus
Apoptosis Cleavage on pair of basic residues Coiled coil Disulfide bond Fusion of virus membrane with host membrane Glycoprotein Host cell membrane Host endosome Host membrane Host-virus interaction Membrane Transmembrane Transmembrane helix Viral attachment to host cell Viral envelope protein Viral penetration into ho...
MSTGNVYQEL
MSTGNVYQELIRRYLVVVKKLYEGKYEVSRSFSYTMFSLLVGIIGKQYVTVFYGVPVWKEAKTHLICATDNSSLWVTTNCIPSLPDYDEVEIPDIKENFTGLIRENQIVYQAWHAMGSMLDTILKPCVKINPYCVKMQCQETENVSATTAKPITTPTTTSTVASSTEIYLDVDKNNTEEKVERNHVCRYNITGLCRDSKEEIVTNFRGDDVKCENNTCYMNHCNESVNTEDCQKGLLIRCILGCVPPGYVMLRYNEKLNNNKLCSNISAVQCTQHLVATVSSFFGFNGTMHKEGELIPIDDKYRGPEEFHQRKFVYKVPG...
membrane fusion involved in viral entry into host cell viral entry into host cell virion attachment to host cell host cell endosome membrane; host cell plasma membrane; membrane; viral envelope; virion membrane structural molecule activity Simian immunodeficiency virus Apoptosis Cleavage on pair of basic residues Coi...
viral budding via host ESCRT complex
host cell cytoplasm; host cell nucleus; host cell plasma membrane; membrane; viral nucleocapsid
RNA binding structural molecule activity zinc ion binding
Simian immunodeficiency virus
Capsid protein Host cell membrane Host cytoplasm Host membrane Host nucleus Host-virus interaction Lipoprotein Membrane Metal-binding Myristate Phosphoprotein Repeat Ribosomal frameshifting RNA-binding Viral budding Viral budding via the host ESCRT complexes Viral nucleoprotein Viral release from host cell Virion Zinc ...
MGNGNSALLG
MGNGNSALLGTDLDKFEKIRLKRGGKKCYRLKHLCWCKGELDRFGLSDKLLETQQGCEKILSVCWPLYDQGSDNLKALVGTVCVVACIHAGIEIKSTQDALKKLKVITRKEEKQEDESKNFPVQRDAAGQYQYTPISPRIIQTWVKTVEEKKWKPEVIPLFSALTEGAISHDLNIMLNAVGDHQGAMQVLKDVINEQAAEWDLTHPQQQPAQPGGGLRTPSGSDIAGTTSTVEEQLAWMNMQQNAINVGTIYKSWIILGMNRLVKSHCPISITDVRQGPKEAFKDYVDRFYNVMRAEQASGEVKMWMQQHLLIENANPEC...
viral budding via host ESCRT complex host cell cytoplasm; host cell nucleus; host cell plasma membrane; membrane; viral nucleocapsid RNA binding structural molecule activity zinc ion binding Simian immunodeficiency virus Capsid protein Host cell membrane Host cytoplasm Host membrane Host nucleus Host-virus interactio...
adenylate cyclase-activating G protein-coupled receptor signaling pathway cell adhesion cellular response to fatty acid cellular response to glucose stimulus cellular response to oxidative stress CTP biosynthetic process GTP biosynthetic process integrin-mediated signaling pathway negative regulation of apoptotic proce...
cell periphery; cytoplasm; cytosol; extracellular exosome; extracellular region; ficolin-1-rich granule lumen; intermediate filament; lamellipodium; mitochondrial membrane; nucleus; perinuclear region of cytoplasm; ruffle; secretory granule lumen
ATP binding DNA binding enzyme binding fatty acid binding G-quadruplex DNA binding GDP binding identical protein binding intermediate filament binding metal ion binding nucleoside diphosphate kinase activity protein histidine kinase activity protein serine/threonine kinase activity transcription coactivator activity
Homo sapiens
3D-structure Activator Alternative splicing ATP-binding Cell projection Cytoplasm Direct protein sequencing DNA-binding Kinase Magnesium Metal-binding Nucleotide metabolism Nucleotide-binding Nucleus Reference proteome Transcription Transcription regulation Transferase
MANLERTFIA
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
adenylate cyclase-activating G protein-coupled receptor signaling pathway cell adhesion cellular response to fatty acid cellular response to glucose stimulus cellular response to oxidative stress CTP biosynthetic process GTP biosynthetic process integrin-mediated signaling pathway negative regulation of apoptotic proce...
lipid catabolic process
extracellular region
triglyceride lipase activity
Geotrichum candidum
3D-structure Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Lipid degradation Lipid metabolism Pyrrolidone carboxylic acid Secreted Signal
MVSKSLFLAA
MVSKSLFLAAAVNLAGVLAQAPRPSLNGNEVISGVLEGKVDTFKGIPFADPPLNDLRFKHPQPFTGSYQGLKANDFSPACMQLDPGNSLTLLDKALGLAKVIPEEFRGPLYDMAKGTVSMNEDCLYLNVFRPAGTKPDAKLPVMVWIYGGAFVYGSSAAYPGNSYVKESINMGQPVVFVSINYRTGPFGFLGGDAITAEGNTNAGLHDQRKGLEWVSDNIANFGGDPDKVMIFGESAGAMSVAHQLIAYGGDNTYNGKKLFHSAILQSGGPLPYHDSSSVGPDISYNRFAQYAGCDTSASANDTLECLRSKSSSVLHDAQ...
lipid catabolic process extracellular region triglyceride lipase activity Geotrichum candidum 3D-structure Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Lipid degradation Lipid metabolism Pyrrolidone carboxylic acid Secreted Signal MVSKSLFLAA MVSKSLFLAAAVNLAGVLAQAPRPSLNGNEVISGVLEGKVDTFKGIPFADPPLNDLRF...
behavioral fear response cell adhesion endothelial cell migration locomotory exploration behavior negative regulation of extracellular matrix disassembly negative regulation of neutrophil chemotaxis positive regulation of cell population proliferation proteolysis psychomotor behavior regulation of cell-cell adhesion me...
apical plasma membrane; cell surface; endocytic vesicle; extracellular region; intercellular canaliculus; lamellipodium; lamellipodium membrane; membrane raft; plasma membrane
aminopeptidase activity chemorepellent activity dipeptidyl-peptidase activity protease binding protein homodimerization activity serine-type endopeptidase activity signaling receptor binding virus receptor activity
Sus scrofa
3D-structure Aminopeptidase Cell adhesion Cell junction Cell membrane Cell projection Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Membrane Protease Reference proteome Secreted Serine protease Signal-anchor Transmembrane Transmembrane helix
MKTPWKVLLG
MKTPWKVLLGLLGIAALVTVITVPVVLLNKGTDDAAADSRRTYTLTDYLKSTFRVKFYTLQWISDHEYLYKQENNILLFNAEYGNSSIFLENSTFDELGYSTNDYSVSPDRQFILFEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWITWSPVGHKLAYVWNNDIYVKNEPNLSSQRITWTGKENVIYNGVTDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRIPYPKAGAENPTVKFFVVDTRTLSPNASVTSYQIVPPASVLIGDHYLCGVTWVTEERISLQWIRRAQ...
behavioral fear response cell adhesion endothelial cell migration locomotory exploration behavior negative regulation of extracellular matrix disassembly negative regulation of neutrophil chemotaxis positive regulation of cell population proliferation proteolysis psychomotor behavior regulation of cell-cell adhesion me...
antibiotic metabolic process cellular response to calcium ion cellular response to insulin stimulus cellular response to nitric oxide cellular response to xenobiotic stimulus glutathione catabolic process GPI anchor release homocysteine metabolic process leukotriene D4 catabolic process leukotriene metabolic process ne...
apical part of cell; apical plasma membrane; endoplasmic reticulum membrane; extracellular space; microvillus membrane; plasma membrane; side of membrane
beta-lactamase activity cysteine-type endopeptidase inhibitor activity involved in apoptotic process dipeptidase activity GPI anchor binding identical protein binding metallodipeptidase activity modified amino acid binding zinc ion binding
Sus scrofa
Cell membrane Cell projection Dipeptidase Direct protein sequencing Disulfide bond Glycoprotein GPI-anchor Hydrolase Lipid metabolism Lipoprotein Membrane Metal-binding Metalloprotease Protease Reference proteome Signal Zinc
MWTSWWLWPL
MWTSWWLWPLVAVCAADQFRDLAVRIMQDTPVIDGHNDLPWQLLNLFNNQLQDPGANLSSLAHTHTNIPKLKAGFVGGQFWSAYVPCDTQNRDAVKRTLEQIDVIQRMCQAYPETFACVTSSTGIRQAFREGKVASLVGVEGGHSIDSSLGVLRALYHLGMRYMTLTHSCNTPWADNWLVDTGDDKAQSQGLSHFGQSVVKEMNRLGVMIDLAHVSVATMRAALKLSQAPVIFSHSSAYSLCPHRRNVPDDVLQLVKETGSLVMVNFYNDYVSCSAKANLSQVADHLDHIKKVAGAAAVGFGGDYDGVSRVPSGLEDVSK...
antibiotic metabolic process cellular response to calcium ion cellular response to insulin stimulus cellular response to nitric oxide cellular response to xenobiotic stimulus glutathione catabolic process GPI anchor release homocysteine metabolic process leukotriene D4 catabolic process leukotriene metabolic process ne...
3'-phosphoadenosine 5'-phosphosulfate metabolic process ATP metabolic process bone mineralization cellular response to insulin stimulus gene expression generation of precursor metabolites and energy immune response inorganic diphosphate transport intracellular phosphate ion homeostasis melanocyte differentiation negati...
basolateral plasma membrane; cell surface; extracellular space; lysosomal membrane; membrane; plasma membrane
3',5'-cyclic-AMP phosphodiesterase activity 3'-phosphoadenosine 5'-phosphosulfate binding ATP binding ATP diphosphatase activity calcium ion binding cyclic-GMP-AMP hydrolase activity dinucleotide phosphatase activity exonuclease activity GTP diphosphatase activity insulin receptor binding nucleic acid binding nucleosid...
Homo sapiens
3D-structure Biomineralization Calcium Cell membrane Diabetes mellitus Direct protein sequencing Disease variant Disulfide bond Glycoprotein Hydrolase Membrane Metal-binding Obesity Phosphoprotein Reference proteome Repeat Secreted Signal-anchor Transmembrane Transmembrane helix Zinc
MERDGCAGGG
MERDGCAGGGSRGGEGGRAPREGPAGNGRDRGRSHAAEAPGDPQAAASLLAPMDVGEEPLEKAARARTAKDPNTYKVLSLVLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTCNKFRCGEKRLTRSLCACSDDCKDKGDCCINYSSVCQGEKSWVEEPCESINEPQCPAGFETPPTLLFSLDGFRAEYLHTWGGLLPVISKLKKCGTYTKNMRPVYPTKTFPNHYSIVTGLYPESHGIIDNKMYDPKMNASFSLKSKEKFNPEWYKGEPIWVTAKYQGLKSGTF...
3'-phosphoadenosine 5'-phosphosulfate metabolic process ATP metabolic process bone mineralization cellular response to insulin stimulus gene expression generation of precursor metabolites and energy immune response inorganic diphosphate transport intracellular phosphate ion homeostasis melanocyte differentiation negati...
fatty acid beta-oxidation
peroxisome
(3R)-hydroxyacyl-CoA dehydrogenase (NAD) activity 3-hydroxyacyl-CoA dehydrogenase activity enoyl-CoA hydratase activity isomerase activity
Candida tropicalis
3D-structure Fatty acid metabolism Isomerase Lipid metabolism Lyase Multifunctional enzyme NAD NADP Oxidoreductase Peroxisome Repeat
MSPVDFKDKV
MSPVDFKDKVVIITGAGGGLGKYYSLEFAKLGAKVVVNDLGGALNGQGGNSKAADVVVDEIVKNGGVAVADYNNVLDGDKIVETAVKNFGTVHVIINNAGILRDASMKKMTEKDYKLVIDVHLNGAFAVTKAAWPYFQKQKYGRIVNTSSPAGLYGNFGQANYASAKSALLGFAETLAKEGAKYNIKANAIAPLARSRMTESILPPPMLEKLGPEKVAPLVLYLSSAENELTGQFFEVAAGFYAQIRWERSGGVLFKPDQSFTAEVVAKRFSEILDYDDSRKPEYLKNQYPFMLNDYATLTNEARKLPANDASGAPTVSL...
fatty acid beta-oxidation peroxisome (3R)-hydroxyacyl-CoA dehydrogenase (NAD) activity 3-hydroxyacyl-CoA dehydrogenase activity enoyl-CoA hydratase activity isomerase activity Candida tropicalis 3D-structure Fatty acid metabolism Isomerase Lipid metabolism Lyase Multifunctional enzyme NAD NADP Oxidoreductase Peroxisome...
carbon catabolite regulation of transcription cellular response to insulin stimulus glucose homeostasis late viral transcription lipid homeostasis negative regulation of fibrinolysis positive regulation of transcription by RNA polymerase II positive regulation of transcription from RNA polymerase II promoter by glucose...
chromatin; Golgi apparatus; nucleoplasm; nucleus; transcription regulator complex
bHLH transcription factor binding DNA-binding transcription factor activity, RNA polymerase II-specific enzyme binding histone deacetylase binding identical protein binding protein heterodimerization activity protein homodimerization activity protein kinase binding protein-containing complex binding RNA polymerase II c...
Homo sapiens
3D-structure Alternative splicing Direct protein sequencing DNA-binding Isopeptide bond Nucleus Reference proteome Transcription Transcription regulation Ubl conjugation
MKGQQKTAET
MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFPSTAVGDGAGGTTSGSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHGLEVVIKNDSN
carbon catabolite regulation of transcription cellular response to insulin stimulus glucose homeostasis late viral transcription lipid homeostasis negative regulation of fibrinolysis positive regulation of transcription by RNA polymerase II positive regulation of transcription from RNA polymerase II promoter by glucose...
cyclooxygenase pathway keratinocyte differentiation learning maintenance of blood-brain barrier memory negative regulation of epinephrine secretion negative regulation of norepinephrine secretion positive regulation of smooth muscle contraction positive regulation of vasoconstriction prostaglandin biosynthetic process ...
cytoplasm; endoplasmic reticulum membrane; Golgi apparatus; intracellular membrane-bounded organelle; neuron projection; nuclear envelope; photoreceptor outer segment
heme binding metal ion binding oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen peroxidase activity prostaglandin-endoperoxide synthase activity
Mus musculus
Dioxygenase Disulfide bond EGF-like domain Endoplasmic reticulum Fatty acid biosynthesis Fatty acid metabolism Glycoprotein Heme Iron Lipid biosynthesis Lipid metabolism Membrane Metal-binding Microsome Oxidoreductase Peroxidase Prostaglandin biosynthesis Prostaglandin metabolism Reference proteome Signal
MSRRSLSLWF
MSRRSLSLWFPLLLLLLLPPTPSVLLADPGVPSPVNPCCYYPCQNQGVCVRFGLDNYQCDCTRTGYSGPNCTIPEIWTWLRNSLRPSPSFTHFLLTHGYWLWEFVNATFIREVLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDVQLLAQQLLLRREFIPAPQGTNILFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYHLRLFKDGKLKYQVLDGEVYPPSVEQASVLMRYPPGVPPERQMAVGQEVFGLLPGLMLFSTIWLREHNRVCDLLKE...
cyclooxygenase pathway keratinocyte differentiation learning maintenance of blood-brain barrier memory negative regulation of epinephrine secretion negative regulation of norepinephrine secretion positive regulation of smooth muscle contraction positive regulation of vasoconstriction prostaglandin biosynthetic process ...
beak morphogenesis cell differentiation hormone-mediated signaling pathway inner ear receptor cell differentiation involved in inner ear sensory epithelium regeneration limb morphogenesis negative regulation of transcription by RNA polymerase II positive regulation of transcription by RNA polymerase II response to reti...
nucleus; perinuclear region of cytoplasm
nuclear receptor activity RNA polymerase II cis-regulatory region sequence-specific DNA binding zinc ion binding
Gallus gallus
Alternative splicing DNA-binding Metal-binding Nucleus Receptor Reference proteome Transcription Transcription regulation Zinc Zinc-finger
MTTSSRTCPV
MTTSSRTCPVPAVNGHMTHYPAAPYPLLFPPVIGGLSLPSLHGLQSHPPTSGCSTPSPATVETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPTKQESTENYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLE...
beak morphogenesis cell differentiation hormone-mediated signaling pathway inner ear receptor cell differentiation involved in inner ear sensory epithelium regeneration limb morphogenesis negative regulation of transcription by RNA polymerase II positive regulation of transcription by RNA polymerase II response to reti...
adenylate cyclase-modulating G protein-coupled receptor signaling pathway defense response to Gram-negative bacterium G protein-coupled receptor signaling pathway olfactory learning positive regulation of gene expression
axon; heterotrimeric G-protein complex; neuronal cell body; non-motile cilium
G protein-coupled receptor binding G-protein beta/gamma-subunit complex binding GTP binding GTPase activity metal ion binding
Caenorhabditis elegans
GTP-binding Lipoprotein Magnesium Metal-binding Myristate Nucleotide-binding Palmitate Reference proteome Transducer
MGLCQSEEEK
MGLCQSEEEKVGTLKSRAIDKEIKQLQTSEERTVKLLLLGAGECGKSTVLKQMRLLTSKQYTDEELLTQAKLVYTNIVIEMDHLVKAMPAAGLNFSDPMREHDVHMLTLYIKDMQHKNFQQDAADHVEKLWKDPVVKRLYAERKELNIRDIGDNTEYFFENLPRISKEDYHPNATDTLLLRTKTTGIVEVGFEIKKVKFRVFDVGGQRSERKKWIHCFEDVNAIIFIAALSEYNEVLFEDETTNRMIESMRLFESICNSRWFHNTNIILFLNKKDLFEEKIKKENIHKAFPEYRGEQNYAETVAFIKTKFEALSNNPKKT...
adenylate cyclase-modulating G protein-coupled receptor signaling pathway defense response to Gram-negative bacterium G protein-coupled receptor signaling pathway olfactory learning positive regulation of gene expression axon; heterotrimeric G-protein complex; neuronal cell body; non-motile cilium G protein-coupled rec...
cell migration cholesterol homeostasis fibroblast growth factor receptor signaling pathway glucose homeostasis peptidyl-tyrosine phosphorylation phosphate ion homeostasis positive regulation of catalytic activity positive regulation of cell population proliferation positive regulation of DNA biosynthetic process positi...
endoplasmic reticulum; endosome; extracellular region; Golgi apparatus; plasma membrane; receptor complex; transport vesicle
ATP binding fibroblast growth factor binding fibroblast growth factor receptor activity heparin binding
Homo sapiens
3D-structure Alternative splicing ATP-binding Cell membrane Direct protein sequencing Disulfide bond Endoplasmic reticulum Endosome Glycoprotein Immunoglobulin domain Kinase Membrane Nucleotide-binding Phosphoprotein Receptor Reference proteome Repeat Secreted Signal Transferase Transmembrane Transmembrane helix Tyrosi...
MRLLLALLGV
MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLDVLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFPYVQVLKTADINSSEVEVLYL...
cell migration cholesterol homeostasis fibroblast growth factor receptor signaling pathway glucose homeostasis peptidyl-tyrosine phosphorylation phosphate ion homeostasis positive regulation of catalytic activity positive regulation of cell population proliferation positive regulation of DNA biosynthetic process positi...
blood coagulation positive regulation of leukocyte chemotaxis proteolysis
extracellular space
calcium ion binding serine-type endopeptidase activity
Bos taurus
Blood coagulation Calcium Cleavage on pair of basic residues Direct protein sequencing Disulfide bond EGF-like domain Gamma-carboxyglutamic acid Glycoprotein Hemostasis Hydrolase Protease Reference proteome Repeat Secreted Serine protease Signal Zymogen
MLSQAWALAL
MLSQAWALALLCFLLSLWGSLPAVFLPQEQALSILHRPRRANGFLEELLPGSLERECREELCSFEEAHEIFRNEERTRQFWVSYNDGDQCASSPCQNGGSCEDQLRSYICFCPDGFEGRNCETDKQSQLICANDNGGCEQYCGADPGAGRFCWCHEGYALQADGVSCAPTVEYPCGKIPVLEKRNGSKPQGRIVGGHVCPKGECPWQAMLKLNGALLCGGTLVGPAWVVSAAHCFERLRSRGNLTAVLGEHDLSRVEGPEQERRVAQIIVPKQYVPGQTDHDVALLQLAQPVALGDHVAPLCLPDPDFADQTLAFVRFSA...
blood coagulation positive regulation of leukocyte chemotaxis proteolysis extracellular space calcium ion binding serine-type endopeptidase activity Bos taurus Blood coagulation Calcium Cleavage on pair of basic residues Direct protein sequencing Disulfide bond EGF-like domain Gamma-carboxyglutamic acid Glycoprotein He...
cell adhesion immune response
extracellular region
heparin binding polysaccharide binding scavenger receptor activity
Oryctolagus cuniculus
Cell adhesion Direct protein sequencing Disulfide bond Glycoprotein Heparin-binding Phosphoprotein Reference proteome Repeat Secreted Signal Sulfation
MAPLRPIFTL
MAPLRPIFTLALLLWVVLADQESCKDRCTEGFNANRKCQCDELCSYYQSCCADYAAECKPQVTRGDVFTMPEDEYGPYDYIEQTKDNASVHAQPESPTVGQEPTLSPDLQTEGGAEPTHEVPLEPEMETLRPEGEDLQAGTTELGTSASPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDETAVRPGYPKLIQDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGILDPDYPRNISEGFSGIPDNVDAAFALPAHSYSGRERVYFFKGDKYWEYQFQQQPSQEECEGSSLSAVFEHFAMLHRDSWEDIFKLL...
cell adhesion immune response extracellular region heparin binding polysaccharide binding scavenger receptor activity Oryctolagus cuniculus Cell adhesion Direct protein sequencing Disulfide bond Glycoprotein Heparin-binding Phosphoprotein Reference proteome Repeat Secreted Signal Sulfation MAPLRPIFTL MAPLRPIFTLALLLWVVL...
potassium ion transmembrane transport potassium ion transport protein homooligomerization
axon; axon initial segment; dendritic spine; membrane; plasma membrane; voltage-gated potassium channel complex
delayed rectifier potassium channel activity monoatomic ion-gated channel activity potassium ion binding voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential voltage-gated potassium channel activity
Homo sapiens
Cataract Cell membrane Cell projection Disease variant Dystonia Glycoprotein Intellectual disability Ion channel Ion transport Membrane Phosphoprotein Potassium Potassium channel Potassium transport Reference proteome Transmembrane Transmembrane helix Transport Voltage-gated channel
MEVAMVSAES
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGGSHHHHQSRGACTSHDPQSSRGSRRRRRQRSEKKKAHYRQSSFPHCSDLMPSGSEEKILRELSEEEEDEEEEEEEEEEGRFYYSEDDHGDECSYTDLLPQDEGGGGYSSVRYSDCCERVVINVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYPESSSPARGIAIVSVLVILIS...
potassium ion transmembrane transport potassium ion transport protein homooligomerization axon; axon initial segment; dendritic spine; membrane; plasma membrane; voltage-gated potassium channel complex delayed rectifier potassium channel activity monoatomic ion-gated channel activity potassium ion binding voltage-gated...
atrial cardiac muscle cell action potential membrane hyperpolarization membrane repolarization during atrial cardiac muscle cell action potential membrane repolarization during bundle of His cell action potential membrane repolarization during SA node cell action potential negative regulation of cytosolic calcium ion c...
cell surface; Golgi apparatus; intercalated disc; intracellular canaliculus; membrane raft; perinuclear region of cytoplasm; plasma membrane; potassium channel complex; voltage-gated potassium channel complex; Z disc
alpha-actinin binding delayed rectifier potassium channel activity outward rectifier potassium channel activity protein kinase binding scaffold protein binding signaling receptor binding voltage-gated potassium channel activity involved in atrial cardiac muscle cell action potential repolarization voltage-gated potassi...
Homo sapiens
Alternative splicing Atrial fibrillation Cell membrane Ion channel Ion transport Isopeptide bond Lipoprotein Membrane Palmitate Phosphoprotein Potassium Potassium channel Potassium transport Reference proteome Repeat Transmembrane Transmembrane helix Transport Ubl conjugation Voltage-gated channel
MEIALVPLEN
MEIALVPLENGGAMTVRGGDEARAGCGQATGGELQCPPTAGLSDGPKEPAPKGRGAQRDADSGVRPLPPLPDPGVRPLPPLPEELPRPRRPPPEDEEEEGDPGLGTVEDQALGTASLHHQRVHINISGLRFETQLGTLAQFPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLIFEYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPAPHQPPAPAPGANGSGVMAPPSGPTVAPLLPRTL...
atrial cardiac muscle cell action potential membrane hyperpolarization membrane repolarization during atrial cardiac muscle cell action potential membrane repolarization during bundle of His cell action potential membrane repolarization during SA node cell action potential negative regulation of cytosolic calcium ion c...
action potential cellular response to ammonium ion cellular response to nitric oxide cellular response to toxic substance globus pallidus development monoatomic ion transmembrane transport nitric oxide-cGMP-mediated signaling pathway optic nerve development positive regulation of potassium ion transmembrane transport p...
apical plasma membrane; axolemma; axon; axon terminus; basolateral plasma membrane; dendrite; dendrite membrane; GABA-ergic synapse; membrane; neuronal cell body; neuronal cell body membrane; perikaryon; plasma membrane; postsynaptic membrane; presynaptic membrane; synapse; terminal bouton; vesicle; voltage-gated potas...
delayed rectifier potassium channel activity transmembrane transporter binding voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential voltage-gated potassium channel activity
Rattus norvegicus
Alternative splicing Cell membrane Cell projection Glycoprotein Ion channel Ion transport Membrane Phosphoprotein Postsynaptic cell membrane Potassium Potassium channel Potassium transport Reference proteome Synapse Synaptosome Transmembrane Transmembrane helix Transport Voltage-gated channel
MGKIENNERV
MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPQGDCLTAAGDKLQPLPPPLSPPPRPPPLSPVPSGCFEGGAGNCSSHGGNGSDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLGGKRLGIEDAAGLGGPDGKSGRWRKLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTSAVLQYEIETDPALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDF...
action potential cellular response to ammonium ion cellular response to nitric oxide cellular response to toxic substance globus pallidus development monoatomic ion transmembrane transport nitric oxide-cGMP-mediated signaling pathway optic nerve development positive regulation of potassium ion transmembrane transport p...
cAMP-mediated signaling feeding behavior insulin secretion negative regulation of lymphocyte proliferation neuropeptide signaling pathway positive regulation of apoptotic process positive regulation of cortisol secretion positive regulation of large conductance calcium-activated potassium channel activity positive regu...
extracellular region; extracellular space; neuronal cell body; secretory granule
galanin receptor activity galanin receptor binding neuropeptide hormone activity type 1 galanin receptor binding type 2 galanin receptor binding type 3 galanin receptor binding
Homo sapiens
3D-structure Cleavage on pair of basic residues Direct protein sequencing Disease variant Epilepsy Hormone Neuropeptide Phosphoprotein Reference proteome Secreted Signal
MARGSALLLA
MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS
cAMP-mediated signaling feeding behavior insulin secretion negative regulation of lymphocyte proliferation neuropeptide signaling pathway positive regulation of apoptotic process positive regulation of cortisol secretion positive regulation of large conductance calcium-activated potassium channel activity positive regu...
actin cytoskeleton organization actin filament organization aggregation involved in sorocarp development cell motility chemotaxis to cAMP endocytosis endosomal transport lateral pseudopodium retraction pinocytosis response to other organism vesicle transport along actin filament
actin cytoskeleton; cell leading edge; cell-cell junction; cytoplasm; cytosol; myosin complex; plasma membrane; pseudopodium; vesicle
actin filament binding ATP binding calmodulin binding microfilament motor activity
Dictyostelium discoideum
Actin-binding ATP-binding Calmodulin-binding Motor protein Myosin Nucleotide-binding Reference proteome Repeat
MATFKRDLTK
MATFKRDLTKNVGVEDLIMLTEVSESSLHENLKIRYKEGLIYTSIGPVLVSMNPYKQLGIYGNDQINLYKGKHEFEIPPHIYSIADKAYRALRSEGENQCIIISGESGAGKTEASKYIMQYIASITGSSTEVERVKKTILESNPLLEAFGNAKTLRNNNSSRFGKYMEIQFNLGGDPEGGKITNYLLEKSRVINQTQGERNFHIFYQLLKGSSEEEKKTYNLLSPDQYHYLTRNASNGCFTADGIDDQIGFKQTKNAMKVVGIDEPLQKEIFATLSAILLLGNLSFNKSASGNGSVISDKKLANTIASLMGVDAIVLESS...
actin cytoskeleton organization actin filament organization aggregation involved in sorocarp development cell motility chemotaxis to cAMP endocytosis endosomal transport lateral pseudopodium retraction pinocytosis response to other organism vesicle transport along actin filament actin cytoskeleton; cell leading edge; c...
cell cycle cell division gastrulation negative regulation of G2/M transition of mitotic cell cycle negative regulation of mitotic nuclear division ventral furrow formation
cytoplasm; nucleus
cyclin binding
Drosophila melanogaster
Cell cycle Cell division Mitosis Nucleus Phosphoprotein Reference proteome
MSSTNETNQV
MSSTNETNQVLQRLNSLKIVETPKEQHEFGKRECYSLDSKKYSLVPATPSSSGHGKFQTELKKRRKNKLNRMYTYEADKNFIKARKSLNF
cell cycle cell division gastrulation negative regulation of G2/M transition of mitotic cell cycle negative regulation of mitotic nuclear division ventral furrow formation cytoplasm; nucleus cyclin binding Drosophila melanogaster Cell cycle Cell division Mitosis Nucleus Phosphoprotein Reference proteome MSSTNETNQV MSST...
cell differentiation chromosome condensation negative regulation of DNA recombination nucleosome assembly spermatogenesis
nucleosome; nucleus
double-stranded DNA binding nucleosomal DNA binding structural constituent of chromatin
Homo sapiens
Chromosome Citrullination Developmental protein Differentiation DNA-binding Nucleus Phosphoprotein Reference proteome Spermatogenesis
MSETVPAASA
MSETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMSLVALKKALAAAGYDVEKNNSRIKLSLKSLVNKGILVQTRGTGASGSFKLSKKVIPKSTRSKAKKSVSAKTKKLVLSRDSKSPKTAKTNKRAKKPRATTPKTVRSGRKAKGAKGKQQQKSPVKARASKSKLTQHHEVNVRKATSKK
cell differentiation chromosome condensation negative regulation of DNA recombination nucleosome assembly spermatogenesis nucleosome; nucleus double-stranded DNA binding nucleosomal DNA binding structural constituent of chromatin Homo sapiens Chromosome Citrullination Developmental protein Differentiation DNA-binding N...
proteolysis
host cell cytoplasm; T=13 icosahedral viral capsid
metal ion binding serine-type peptidase activity structural molecule activity
Infectious pancreatic necrosis virus
Capsid protein Host cytoplasm Hydrolase Metal-binding Protease Serine protease T=13 icosahedral capsid protein Virion
MNTNKATATY
MNTNKATATYLKSIMLPETGPASIPDDITERHILKQETSSYNLEVSESGSGILVCFPGAPGSRIGAHYRWNANQTGLEFDQWLETSQDLKKAFNYGRLISRKYDIQSSTLPAGLYALNGTLNAATFEGSLSEVESLTYNSLMSLTTNPQDKVNNQLVTKGVTVLNLPTGFDKPYVRLEDETPQGLQSMNGAKMRCTAAIAPRRYEIDLPSQRLPPVPATGTLTTLYEGNADIVNSTTVTGDINFSLAEQPANETKFDFQLDFMGLDNDVPVVTVVSSVLATNDNYRGVSAKMTQSIPTENITKPITRVKLSYKINQQTAI...
proteolysis host cell cytoplasm; T=13 icosahedral viral capsid metal ion binding serine-type peptidase activity structural molecule activity Infectious pancreatic necrosis virus Capsid protein Host cytoplasm Hydrolase Metal-binding Protease Serine protease T=13 icosahedral capsid protein Virion MNTNKATATY MNTNKATATYLK...
box C/D RNA 3'-end processing ribosomal small subunit biogenesis rRNA methylation sno(s)RNA metabolic process snoRNA localization
box C/D RNP complex; Cajal body; chromosome; dense fibrillar component; granular component; nucleolus; nucleoplasm; nucleus; small-subunit processome
ATPase binding histone H2AQ104 methyltransferase activity RNA binding rRNA methyltransferase activity TFIID-class transcription factor complex binding
Rattus norvegicus
Acetylation Direct protein sequencing Isopeptide bond Methylation Methyltransferase Nucleus Phosphoprotein Reference proteome Ribonucleoprotein RNA-binding rRNA processing S-adenosyl-L-methionine Transferase Ubl conjugation
MKPGFSPRGG
MKPGFSPRGGGFGGRGGFGDRGGRGGGRGGRGGFGGGRGGFGGGGRGRGGGGGGFRGRGGGGGRGGGFQSGGGRGRGGGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYR...
box C/D RNA 3'-end processing ribosomal small subunit biogenesis rRNA methylation sno(s)RNA metabolic process snoRNA localization box C/D RNP complex; Cajal body; chromosome; dense fibrillar component; granular component; nucleolus; nucleoplasm; nucleus; small-subunit processome ATPase binding histone H2AQ104 methyltra...
DNA damage response protein ubiquitination ubiquitin-dependent protein catabolic process
cytoplasm; nucleus
ATP binding ubiquitin activating enzyme activity
Saccharomyces cerevisiae
3D-structure Acetylation ATP-binding Cytoplasm Direct protein sequencing Isopeptide bond Ligase Nucleotide-binding Nucleus Phosphoprotein Reference proteome Repeat Ubl conjugation Ubl conjugation pathway
MSSNNSGLSA
MSSNNSGLSAAGEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPVQLADLSTQFFLTEKDIGQKRGDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDTVSLEDKVKINEFCHSSGIRFISSETRGLFGNTFVDLGDEFTVLDPTGEEPRTGMVSDIEPDGTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRIGSVKEYGEYKKGGIFTEVKVPRKISFKSLKQQLSNPEFVFSDFAKFDRAAQLHLGFQALHQFAVRHNGELPRTMNDEDAN...
DNA damage response protein ubiquitination ubiquitin-dependent protein catabolic process cytoplasm; nucleus ATP binding ubiquitin activating enzyme activity Saccharomyces cerevisiae 3D-structure Acetylation ATP-binding Cytoplasm Direct protein sequencing Isopeptide bond Ligase Nucleotide-binding Nucleus Phosphoprotein...
DNA duplex unwinding establishment of sister chromatid cohesion interstrand cross-link repair mitotic sister chromatid cohesion
chromatin; nucleus
ATP binding ATP hydrolysis activity DNA binding DNA helicase activity
Saccharomyces cerevisiae
ATP-binding Cell cycle DNA-binding Helicase Hydrolase Nucleotide-binding Nucleus Phosphoprotein Reference proteome
MDKKEYSETF
MDKKEYSETFYHPYKPYDIQVQLMETVYRVLSEGKKIAILESPTGTGKTLSLICATMTWLRMNKADIFTRMETNIKTNEDDSENLSDDEPDWVIDTYRKSVLQEKVDLLNDYEKHLNEINTTSCKQLKTMCDLDKEHGRYKSVDPLRKKRKGARHLDVSLEEQDFIPRPYESDSENNDTSKSTRGGRISDKDYKLSELNSQIITLLDKIDGKVSRDPNNGDRFDVTNQNPVKIYYASRTYSQLGQFTSQLRLPSFPSSFRDKVPDEKVKYLPLASKKQLCINPKVMKWKTLEAINDACADLRHSKEGCIFYQNTNEWRHC...
DNA duplex unwinding establishment of sister chromatid cohesion interstrand cross-link repair mitotic sister chromatid cohesion chromatin; nucleus ATP binding ATP hydrolysis activity DNA binding DNA helicase activity Saccharomyces cerevisiae ATP-binding Cell cycle DNA-binding Helicase Hydrolase Nucleotide-binding Nucl...
cellular response to oxidative stress protein phosphorylation
cytoplasm
ATP binding calmodulin binding calmodulin-dependent protein kinase activity protein kinase activity protein serine kinase activity
Saccharomyces cerevisiae
ATP-binding Calmodulin-binding Kinase Nucleotide-binding Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase
MPKESEVINS
MPKESEVINSEFHVDVQDPERLNGHPVAKFINKLSGQPESYVNRTNYIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLYEELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISIDVKRFILKALRLNPADRPTATELLDDPWITSKRVETSNIL...
cellular response to oxidative stress protein phosphorylation cytoplasm ATP binding calmodulin binding calmodulin-dependent protein kinase activity protein kinase activity protein serine kinase activity Saccharomyces cerevisiae ATP-binding Calmodulin-binding Kinase Nucleotide-binding Phosphoprotein Reference proteome ...
phosphorylation regulation of RNA splicing
nucleus
ATP binding protein serine kinase activity protein serine/threonine kinase activity protein serine/threonine/tyrosine kinase activity protein tyrosine kinase activity
Mus musculus
Alternative splicing ATP-binding Kinase Nucleotide-binding Nucleus Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase Tyrosine-protein kinase
MRHSKRTYCP
MRHSKRTYCPDWDERDWDYGTWRSSSSHKRKKRSHSSAREQKRCRYDHSKTTDSYYLESRSINEKAYHSRRYVDEYRNDYMGYEPGHPYGEPGSRYQMHSSKSSGRSGRSSYKSKHRSRHHTSQHHSHGKSHRRKRSRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDHKVGGRRVAVKIVKNVDRYCEAAQSEIQVLEHLNTTDPHSTFRCVQMLEWFEHRGHICIVFELLGLSTYDFIKENSFLPFRMDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVKSDYTEAYNPKMKRDERTIVNPDI...
phosphorylation regulation of RNA splicing nucleus ATP binding protein serine kinase activity protein serine/threonine kinase activity protein serine/threonine/tyrosine kinase activity protein tyrosine kinase activity Mus musculus Alternative splicing ATP-binding Kinase Nucleotide-binding Nucleus Phosphoprotein Referen...
cell wall organization cellular response to cell envelope stress DNA damage response peptidoglycan biosynthetic process regulation of cell shape response to antibiotic
membrane
carboxypeptidase activity cysteine-type carboxypeptidase activity glycosyltransferase activity peptidoglycan L,D-transpeptidase activity
Escherichia coli
3D-structure Cell shape Cell wall biogenesis/degradation Glycosyltransferase Hydrolase Membrane Peptidoglycan synthesis Reference proteome Transferase Transmembrane Transmembrane helix
MLLNMMCGRQ
MLLNMMCGRQLSAISLCLAVTFAPLFNAQADEPEVIPGDSPVAVSEQGEALPQAQATAIMAGIQPLPEGAAEKARTQIESQLPAGYKPVYLNQLQLLYAARDMQPMWENRDAVKAFQQQLAEVAIAGFQPQFNKWVELLTDPGVNGMARDVVLSDAMMGYLHFIANIPVKGTRWLYSSKPYALATPPLSVINQWQLALDKGQLPTFVAGLAPQHPQYAAMHESLLALLCDTKPWPQLTGKATLRPGQWSNDVPALREILQRTGMLDGGPKITLPGDDTPTDAVVSPSAVTVETAETKPMDKQTTSRSKPAPAVRAAYDNE...
cell wall organization cellular response to cell envelope stress DNA damage response peptidoglycan biosynthetic process regulation of cell shape response to antibiotic membrane carboxypeptidase activity cysteine-type carboxypeptidase activity glycosyltransferase activity peptidoglycan L,D-transpeptidase activity Escher...
epidermis development keratinization keratinocyte differentiation peptide cross-linking
cornified envelope; cytoplasm; cytosol
structural molecule activity
Homo sapiens
Cytoplasm Direct protein sequencing Keratinization Reference proteome Repeat
MSSQQQKQPC
MSSQQQKQPCTPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPSIVTPAPAQQKTKQK
epidermis development keratinization keratinocyte differentiation peptide cross-linking cornified envelope; cytoplasm; cytosol structural molecule activity Homo sapiens Cytoplasm Direct protein sequencing Keratinization Reference proteome Repeat MSSQQQKQPC MSSQQQKQPCTPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPE...
autophagosome assembly autophagy endocytosis late endosome to vacuole transport macroautophagy pexophagy phosphatidylinositol phosphate biosynthetic process phosphatidylinositol-3-phosphate biosynthetic process phosphatidylinositol-mediated signaling phosphorylation positive regulation of transcription elongation by RN...
cytoplasm; cytosol; endosome; endosome membrane; fungal-type vacuole membrane; Golgi membrane; membrane; nucleus-vacuole junction; peroxisome; phagophore assembly site; phagophore assembly site membrane; phosphatidylinositol 3-kinase complex, class III, type I; phosphatidylinositol 3-kinase complex, class III, type II
1-phosphatidylinositol-3-kinase activity ATP binding protein kinase activity
Saccharomyces cerevisiae
3D-structure ATP-binding Autophagy Endosome Golgi apparatus Kinase Membrane Nucleotide-binding Phosphoprotein Protein transport Reference proteome Transferase Transport
MSLNNITFCV
MSLNNITFCVSQDLDVPLKVKIKSLEGHKPLLKPSQKILNPELMLIGSNVFPSSDLIVSLQVFDKERNRNLTLPIYTPYIPFRNSRTWDYWLTLPIRIKQLTFSSHLRIILWEYNGSKQIPFFNLETSIFNLKDCTLKRGFESLKFRYDVIDHCEVVTDNKDQENLNKYFQGEFTRLPWLDEITISKLRKQRENRTWPQGTFVLNLEFPMLELPVVFIEREIMNTQMNIPTLKNNPGLSTDLREPNRNDPQIKISLGDKYHSTLKFYDPDQPNNDPIEEKYRRLERASKNANLDKQVKPDIKKRDYLNKIINYPPGTKLT...
autophagosome assembly autophagy endocytosis late endosome to vacuole transport macroautophagy pexophagy phosphatidylinositol phosphate biosynthetic process phosphatidylinositol-3-phosphate biosynthetic process phosphatidylinositol-mediated signaling phosphorylation positive regulation of transcription elongation by RN...
chromatin remodeling chromosome organization DNA damage response G1/S transition of mitotic cell cycle intracellular iron ion homeostasis MAPK cascade negative regulation of cell division negative regulation of monocyte differentiation positive regulation of cysteine-type endopeptidase activity involved in apoptotic pr...
nucleolus; nucleoplasm
DNA-binding transcription factor activity, RNA polymerase II-specific E-box binding protein dimerization activity protein-containing complex binding
Marmota monax
Acetylation Activator DNA-binding Glycoprotein Isopeptide bond Nucleus Phosphoprotein Proto-oncogene Transcription Transcription regulation Ubl conjugation
MPLNVSFANR
MPLNVSFANRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPPCVTVASFSPPGDDDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDTGCPSPARGHSGCSSSSLYLQDLSPRASECIDPSVVFPYPLNDSSSPKPCASPDSTAFSPSSDSLLSSTESSPRASPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPSARRSESVSPPAGSHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDCP...
chromatin remodeling chromosome organization DNA damage response G1/S transition of mitotic cell cycle intracellular iron ion homeostasis MAPK cascade negative regulation of cell division negative regulation of monocyte differentiation positive regulation of cysteine-type endopeptidase activity involved in apoptotic pr...
erythrocyte development erythrocyte differentiation heme biosynthetic process hemoglobin biosynthetic process intracellular iron ion homeostasis intracellular oxygen homeostasis protoporphyrinogen IX biosynthetic process response to hypoxia
mitochondrial inner membrane; mitochondrial matrix; mitochondrion
5-aminolevulinate synthase activity pyridoxal phosphate binding
Homo sapiens
3D-structure Acyltransferase Alternative splicing Disease variant Heme biosynthesis Membrane Mitochondrion Mitochondrion inner membrane Pyridoxal phosphate Reference proteome Transferase Transit peptide
MVTAAMLLQC
MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFKTDLPSSLVSVSLRKPFSGPQEQEQISGKVTHLIQNNMPGNYVFSYDQFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQETLQRHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHASMIQGIRNSGAAKFVFRHNDPDHLKKLLEKSNPK...
erythrocyte development erythrocyte differentiation heme biosynthetic process hemoglobin biosynthetic process intracellular iron ion homeostasis intracellular oxygen homeostasis protoporphyrinogen IX biosynthetic process response to hypoxia mitochondrial inner membrane; mitochondrial matrix; mitochondrion 5-aminolevuli...
DNA damage response purine nucleobase metabolic process purine nucleoside catabolic process pyrimidine nucleobase metabolic process ribonucleoside catabolic process
cytosol
adenosine nucleosidase activity inosine nucleosidase activity purine nucleosidase activity ribosylpyrimidine nucleosidase activity uridine nucleosidase activity
Escherichia coli
Glycosidase Hydrolase Reference proteome
MRLPIFLDTD
MRLPIFLDTDPGIDDAVAIAAAIFAPELDLQLMTTVAGNVSVEKTTRNALQLLHFWNAEIPLAQGAAVPLVRAPRDAASVHGESGMAGYDFVEHNRKPLGIPAFLAIRDALMRAPEPVTLVAIGPLTNIALLLSQCPECKPYIRRLVIMGGSAGRGNCTPNAEFNIAADPEAAACVFRSGIEIVMCGLDVTNQAILTPDYLSTLPQLNRTGKMLHALFSHYRSGSMQSGLRMHDLCAIAWLVRPDLFTLKPCFVAVETQGEFTSGTTVVDIDGCLGKPANVQVALDLDVKGFQQWVAEVLALAS
DNA damage response purine nucleobase metabolic process purine nucleoside catabolic process pyrimidine nucleobase metabolic process ribonucleoside catabolic process cytosol adenosine nucleosidase activity inosine nucleosidase activity purine nucleosidase activity ribosylpyrimidine nucleosidase activity uridine nucleosi...
de novo' pyrimidine nucleobase biosynthetic process arginine biosynthetic process glutamine metabolic process pyrimidine nucleotide biosynthetic process
carbamoyl-phosphate synthase complex; cytoplasm; mitochondrial matrix
ATP binding carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity glutaminase activity
Neurospora crassa
Amino-acid biosynthesis Arginine biosynthesis ATP-binding Ligase Mitochondrion Nucleotide-binding Reference proteome Transit peptide
MFSRLAARLP
MFSRLAARLPKASALNGVAARQVRNLSQPAITGSKGRNMPAREPRTTAAATGAEATFTIRDGPVFQGTAFGANTNISGEAVFTTSLVGYPESMTDPSYRGQILVFTQPLIGNYGVPSNERDEFNLLKYFESPHIQCAGIVVSDVATQYSHWTAVQSLGEWCASEGIPAISGVDTRAIVTYLREQGSSLARISIGDEYDADEDEGFIDPGQINLVKRVSTKAPFVVTNPNAKFHVALIDCGVKENILRSLVSRGASVTVFPYNYPIHKVAENFDGVFISNGPGDPTHCQETVYNLAKLMETSPIPIMGICLGHQLLALAVG...
de novo' pyrimidine nucleobase biosynthetic process arginine biosynthetic process glutamine metabolic process pyrimidine nucleotide biosynthetic process carbamoyl-phosphate synthase complex; cytoplasm; mitochondrial matrix ATP binding carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity glutaminase activity Ne...
acute-phase response in utero embryonic development protein N-linked glycosylation response to chromate response to cytokine response to lead ion response to methanol response to peptide hormone
endoplasmic reticulum; extracellular region; extracellular space; Golgi apparatus; intracellular membrane-bounded organelle
endopeptidase inhibitor activity identical protein binding protease binding serine-type endopeptidase inhibitor activity
Mus musculus
Acute phase Glycoprotein Protease inhibitor Reference proteome Secreted Serine protease inhibitor Signal
MTPSISWGLL
MTPSISWGLLLLAGLCCMVPSFLAEDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIVEAVKELDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDKSTTVKVPMMMLSGMLDVHHCSILSSWVLLMDYAGNASAVFLLPEDGKMQHLEQTLNKELISKILLNRRRRLVQIHIPRLSISGDYNLKTL...
acute-phase response in utero embryonic development protein N-linked glycosylation response to chromate response to cytokine response to lead ion response to methanol response to peptide hormone endoplasmic reticulum; extracellular region; extracellular space; Golgi apparatus; intracellular membrane-bounded organelle e...
cholesterol metabolic process detection of UV erythrocyte differentiation heme A biosynthetic process heme B biosynthetic process heme biosynthetic process heme O biosynthetic process multicellular organismal-level iron ion homeostasis protoporphyrinogen IX metabolic process regulation of eIF2 alpha phosphorylation by ...
mitochondrial inner membrane; mitochondrial matrix; mitochondrion
2 iron, 2 sulfur cluster binding ferrochelatase activity heme binding iron ion binding iron-responsive element binding protein homodimerization activity
Bos taurus
2Fe-2S Acetylation Direct protein sequencing Heme biosynthesis Iron Iron-sulfur Lyase Membrane Metal-binding Mitochondrion Mitochondrion inner membrane Porphyrin biosynthesis Reference proteome Transit peptide
MAAALRSAGV
MAAALRSAGVLLRDRLLYGGSRACQPRRCQSGAATAAAATETAQRARSPKPQAQPGNRKPRTGILMLNMGGPETVEEVQDFLQRLFLDQDLMTLPVQDKLGPFIAKRRTPKIQEQYRRIGGGSPIKMWTSKQGEGMVKLLDELSPHTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAVAFTQYPQYSCSTTGSSLNAIYRYYNEVGRKPTMKWSTIDRWPTHPLLIQCFADHILKELDHFPPEKRREVVILFSAHSLPMSVVNRGDPYPQEVGATVQRVMDKLGYSNPYRLVWQSKVGPMPWLGPQTDEAIKGLCKRGR...
cholesterol metabolic process detection of UV erythrocyte differentiation heme A biosynthetic process heme B biosynthetic process heme biosynthetic process heme O biosynthetic process multicellular organismal-level iron ion homeostasis protoporphyrinogen IX metabolic process regulation of eIF2 alpha phosphorylation by ...
apoptotic process bone development cell differentiation cell population proliferation embryonic digestive tract development embryonic eye morphogenesis embryonic hindlimb morphogenesis glandular epithelial cell development growth plate cartilage development hormone-mediated signaling pathway multicellular organism grow...
cytoplasm; nucleoplasm; nucleus
DNA-binding transcription factor activity heterocyclic compound binding nuclear receptor activity nuclear retinoid X receptor binding protein-containing complex binding RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific DNA binding sequence-specific double-stranded DNA binding zinc ...
Mus musculus
3D-structure Alternative splicing Cytoplasm DNA-binding Metal-binding Nucleus Phosphoprotein Receptor Reference proteome Transcription Transcription regulation Zinc Zinc-finger
MSTSSHACPV
MSTSSHACPVPAVRGHMTHYPAAPYPLLFPPVIRGLSLPPLHGLHGHPPPSGCSTPSPASVGQACQRTTGGSQFAASTKWTPSLNAAIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLN...
apoptotic process bone development cell differentiation cell population proliferation embryonic digestive tract development embryonic eye morphogenesis embryonic hindlimb morphogenesis glandular epithelial cell development growth plate cartilage development hormone-mediated signaling pathway multicellular organism grow...
bone maturation bone mineralization bone morphogenesis cell-cell signaling chondrocyte differentiation chondrocyte proliferation endochondral bone growth endochondral ossification fibroblast growth factor receptor apoptotic signaling pathway fibroblast growth factor receptor signaling pathway MAPK cascade negative regu...
cell surface; endoplasmic reticulum; extracellular region; Golgi apparatus; plasma membrane; receptor complex; transport vesicle
ATP binding fibroblast growth factor binding fibroblast growth factor receptor activity identical protein binding protein tyrosine kinase activity
Homo sapiens
3D-structure Alternative splicing Apoptosis ATP-binding Cell membrane Chromosomal rearrangement Craniosynostosis Cytoplasmic vesicle Deafness Disease variant Disulfide bond Dwarfism Ectodermal dysplasia Endoplasmic reticulum Glycoprotein Immunoglobulin domain Kinase Lacrimo-auriculo-dento-digital syndrome Membrane Nucl...
MGAPACALAL
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKE...
bone maturation bone mineralization bone morphogenesis cell-cell signaling chondrocyte differentiation chondrocyte proliferation endochondral bone growth endochondral ossification fibroblast growth factor receptor apoptotic signaling pathway fibroblast growth factor receptor signaling pathway MAPK cascade negative regu...
cell motility protein transport type IV pilus assembly type IV pilus-dependent motility
cytoplasm; plasma membrane
ATP binding ATP hydrolysis activity metal ion binding
Pseudomonas aeruginosa
ATP-binding Cytoplasm Fimbrium biogenesis Metal-binding Nucleotide-binding Protein transport Reference proteome Transport Zinc
MNDSIQLSGL
MNDSIQLSGLSRQLVQANLLDEKTAVQAQAQAQRNKLSLVTHLVQSKLVSGLALAELSAEQFGIAYCDLNSLDKESFPRDAISEKLVRQHRVIPLWRRGNKLFVGISDPANHQAINDVQFSTGLTTEAILVEDDKLGLAIDKLFESATDGLAGLDDVDLEGLDIGSADKSTQEDASAEADDAPVVRFVNKMLLDAIKGGSSDLHFEPYEKIYRVRFRTDGMLHEVAKPPIQLASRISARLKVMAGLDISERRKPQDGRIKMRVSKTKSIDFRVNTLPTLWGEKIVMRILDSSSAQMGIDALGYEEDQKELYLAALKQPQG...
cell motility protein transport type IV pilus assembly type IV pilus-dependent motility cytoplasm; plasma membrane ATP binding ATP hydrolysis activity metal ion binding Pseudomonas aeruginosa ATP-binding Cytoplasm Fimbrium biogenesis Metal-binding Nucleotide-binding Protein transport Reference proteome Transport Zinc M...
methylation pilus assembly signal peptide processing type IV pilus assembly
plasma membrane; type II protein secretion system complex
aspartic-type endopeptidase activity metal ion binding N-methyltransferase activity
Pseudomonas aeruginosa
Cell inner membrane Cell membrane Hydrolase Membrane Metal-binding Methyltransferase Multifunctional enzyme Protease Reference proteome S-adenosyl-L-methionine Transferase Transmembrane Transmembrane helix Zinc
MPLLDYLASH
MPLLDYLASHPLAFVLCTILLGLLVGSFLNVVVHRLPKMMERNWKAEAREALGLEPEPKQATYNLVLPNSACPRCGHEIRPWENIPLVSYLALGGKCSSCKAAIGKRYPLVELATALLSGYVAWHFGFTWQAGAMLLLTWGLLAMSLIDADHQLLPDVLVLPLLWLGLIANHFGLFASLDDALFGAVFGYLSLWSVFWLFKLVTGKEGMGYGDFKLLAMLGAWGGWQILPLTILLSSLVGAILGVIMLRLRNAESGTPIPFGPYLAIAGWIALLWGDQITRTYLQFAGFK
methylation pilus assembly signal peptide processing type IV pilus assembly plasma membrane; type II protein secretion system complex aspartic-type endopeptidase activity metal ion binding N-methyltransferase activity Pseudomonas aeruginosa Cell inner membrane Cell membrane Hydrolase Membrane Metal-binding Methyltransf...
high-density lipoprotein particle assembly male gonad development phosphorylation protein kinase A signaling renal water homeostasis spermatogenesis
cAMP-dependent protein kinase complex; ciliary base; cytosol; nucleoplasm; nucleus
AMP-activated protein kinase activity ATP binding cAMP-dependent protein kinase activity protein kinase A regulatory subunit binding protein serine kinase activity protein serine/threonine kinase activity
Homo sapiens
ATP-binding cAMP Disease variant Kinase Lipoprotein Myristate Nucleotide-binding Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase
MGNAPAKKDT
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYT...
high-density lipoprotein particle assembly male gonad development phosphorylation protein kinase A signaling renal water homeostasis spermatogenesis cAMP-dependent protein kinase complex; ciliary base; cytosol; nucleoplasm; nucleus AMP-activated protein kinase activity ATP binding cAMP-dependent protein kinase activity...
amine metabolic process
outer membrane-bounded periplasmic space
amine dehydrogenase activity methylamine dehydrogenase (amicyanin) activity
Paracoccus denitrificans
3D-structure Disulfide bond Electron transport Oxidoreductase Periplasm Signal Transport TTQ
MLGNFRFDDM
MLGNFRFDDMVEKLSRRVAGQTSRRSVIGKLGTAMLGIGLVPLLPVDRRGRVSRANAADAPAGTDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASWVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
amine metabolic process outer membrane-bounded periplasmic space amine dehydrogenase activity methylamine dehydrogenase (amicyanin) activity Paracoccus denitrificans3D-structure Disulfide bond Electron transport Oxidoreductase Periplasm Signal Transport TTQ MLGNFRFDDM MLGNFRFDDMVEKLSRRVAGQTSRRSVIGKLGTAMLGIGLVPLLPVDRRGR...
G-quadruplex DNA unwinding miRNA transport mRNA export from nucleus mRNA processing mRNA splicing, via spliceosome mRNA transport negative regulation of mRNA splicing, via spliceosome negative regulation of transcription by RNA polymerase II positive regulation of telomerase RNA reverse transcriptase activity positive ...
Cajal body; catalytic step 2 spliceosome; chromosome, telomeric region; cytoplasm; extracellular exosome; membrane; nuclear matrix; nucleoplasm; nucleus; ribonucleoprotein complex; spliceosomal complex
G-rich strand telomeric DNA binding identical protein binding miRNA binding molecular condensate scaffold activity mRNA 3'-UTR binding N6-methyladenosine-containing RNA reader activity pre-mRNA intronic binding RNA binding single-stranded telomeric DNA binding
Homo sapiens
3D-structure Acetylation Alternative splicing Cytoplasm Direct protein sequencing Disease variant Host-virus interaction Isopeptide bond Methylation mRNA processing mRNA splicing mRNA transport Nucleus Phosphoprotein Reference proteome Repeat Ribonucleoprotein RNA-binding Secreted Spliceosome Transport Ubl conjugation
MEKTLETVPL
MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGN...
G-quadruplex DNA unwinding miRNA transport mRNA export from nucleus mRNA processing mRNA splicing, via spliceosome mRNA transport negative regulation of mRNA splicing, via spliceosome negative regulation of transcription by RNA polymerase II positive regulation of telomerase RNA reverse transcriptase activity positive ...
amine metabolic process
outer membrane-bounded periplasmic space
amine dehydrogenase activity methylamine dehydrogenase (amicyanin) activity
Paracoccus versutus
3D-structure Direct protein sequencing Disulfide bond Electron transport Oxidoreductase Periplasm Signal Transport TTQ
MLGNFRFDDM
MLGNFRFDDMVEKLSRRVAGRTSRRGAIGRLGTVLAGAALVPLLPVDRRGRVSRANAAGPAEGVDPRAKWQPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASWVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
amine metabolic process outer membrane-bounded periplasmic space amine dehydrogenase activity methylamine dehydrogenase (amicyanin) activity Paracoccus versutus 3D-structure Direct protein sequencing Disulfide bond Electron transport Oxidoreductase Periplasm Signal Transport TTQ MLGNFRFDDM MLGNFRFDDMVEKLSRRVAGRTSRRGAIG...
photosynthesis protein stabilization
chloroplast thylakoid membrane; photosystem II
phosphate ion binding
Chlamydomonas reinhardtii
3D-structure Chloroplast Direct protein sequencing Membrane Phosphoprotein Photosynthesis Photosystem II Plastid Reference proteome Thylakoid Transmembrane Transmembrane helix
MATGTSKAKP
MATGTSKAKPSKVNSDFQEPGLVTPLGTLLRPLNSEAGKVLPGWGTTVLMAVFILLFAAFLLIILEIYNSSLILDDVSMSWETLAKVS
photosynthesis protein stabilization chloroplast thylakoid membrane; photosystem II phosphate ion binding Chlamydomonas reinhardtii 3D-structure Chloroplast Direct protein sequencing Membrane Phosphoprotein Photosynthesis Photosystem II Plastid Reference proteome Thylakoid Transmembrane Transmembrane helix MATGTSKAKP M...
immune response regulation of transcription by RNA polymerase II
chromatin; intracellular membrane-bounded organelle; nucleoplasm
DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific double-stranded DNA binding
Homo sapiens
3D-structure Activator DNA-binding Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation
MATQAYTELQ
MATQAYTELQAAPPPSQPPQAPPQAQPQPPPPPPPAAPQPPQPPTAAATPQPQYVTELQSPQPQAQPPGGQKQYVTELPAVPAPSQPTGAPTPSPAPQQYIVVTVSEGAMRASETVSEASPGSTASQTGVPTQVVQQVQGTQQRLLVQTSVQAKPGHVSPLQLTNIQVPQQALPTQRLVVQSAAPGSKGGQVSLTVHGTQQVHSPPEQSPVQANSSSSKTAGAPTGTVPQQLQVHGVQQSVPVTQERSVVQATPQAPKPGPVQPLTVQGLQPVHVAQEVQQLQQVPVPHVYSSQVQYVEGGDASYTASAIRSSTYSYPET...
immune response regulation of transcription by RNA polymerase II chromatin; intracellular membrane-bounded organelle; nucleoplasm DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific double-stranded DNA binding Homo...
cell division cilium assembly mitotic cell cycle mitotic cell cycle phase transition multi-ciliated epithelial cell differentiation response to xenobiotic stimulus
centriolar satellite; centrosome; cyclin-dependent protein kinase holoenzyme complex; cytoplasm; nucleolus; nucleus
cyclin-dependent protein serine/threonine kinase regulator activity
Homo sapiens
Alternative splicing Cell cycle Cell division Ciliopathy Cilium biogenesis/degradation Cyclin Cytoplasm Disease variant Nucleus Phosphoprotein Primary ciliary dyskinesia Reference proteome
MVTPCPTSPS
MVTPCPTSPSSPAARAGRRDNDQNLRAPVKKSRRPRLRRKQPLHPLNPCPLPGDSGICDLFESPSSGSDGAESPSAARGGSPLPGPAQPVAQLDLQTFRDYGQSCYAFRKAQESHFHPREALARQPQVTAESRCKLLSWLIPVHRQFGLSFESLCLTVNTLDRFLTTTPVAADCFQLLGVTSLLIACKQVEVHPPRVKQLLALCCGAFSRQQLCNLECIVLHKLHFTLGAPTISFFLEHFTHARVEAGQAEASEALEAQALARGVAELSLADYAFTSYSPSLLAICCLALADRMLRVSRPVDLRLGDHPEAALEDCMGKL...
cell division cilium assembly mitotic cell cycle mitotic cell cycle phase transition multi-ciliated epithelial cell differentiation response to xenobiotic stimulus centriolar satellite; centrosome; cyclin-dependent protein kinase holoenzyme complex; cytoplasm; nucleolus; nucleus cyclin-dependent protein serine/threonin...
suppression by virus of host NF-kappaB cascade suppression by virus of host PKR signaling suppression by virus of host type I interferon-mediated signaling pathway suppression by virus of host viral-induced cytoplasmic pattern recognition receptor signaling pathway via inhibition of host MDA-5 activity suppression by v...
helical viral capsid; host cell cytoplasm; ribonucleoprotein complex; viral nucleocapsid
protein serine/threonine kinase inhibitor activity RNA binding
Bovine respiratory syncytial virus
Capsid protein Helical capsid protein Host cytoplasm Host-virus interaction Inhibition of host innate immune response by virus Inhibition of host interferon signaling pathway by virus Inhibition of host MAVS by virus Inhibition of host MDA5 by virus Inhibition of host NF-kappa-B by virus Inhibition of host PKR by virus...
MALSKVKLND
MALSKVKLNDTFNKDQLLSTSKYTIQRSTGDNIDIPNYDVQKHLNKLCGMLLITEDANHKFTGLIGILYAMSRLGREDTLKILKDAGYQVRANGVDVITHRQDVNGKEMKFEVLTLVSLTSEVQGNIEIESRKSYKKMLKEMGEVAPEYRHDSPDCGMIVLCVAALVITKLAAGDRSGLTAVIRRANNVLRNEMKRYKGLIPKDIANSFYEVIEKYPHYIDVFVHFGIAQSSTRGGSRVEGIFAGLFMNAYGAGQVMLRWGVLAKSVKNIMLGHASVQAEMEQVVEVYEYAQKLGGEAGFYHILNNPKASLLSLTQFPNF...
suppression by virus of host NF-kappaB cascade suppression by virus of host PKR signaling suppression by virus of host type I interferon-mediated signaling pathway suppression by virus of host viral-induced cytoplasmic pattern recognition receptor signaling pathway via inhibition of host MDA-5 activity suppression by v...
bile acid and bile salt transport bile acid biosynthetic process bile acid signaling pathway cellular response to cholesterol cellular response to glucose stimulus cholesterol catabolic process cholesterol homeostasis negative regulation of collagen biosynthetic process negative regulation of fatty acid biosynthetic pr...
endoplasmic reticulum membrane; intracellular membrane-bounded organelle
24-hydroxycholesterol 7alpha-hydroxylase activity cholesterol 7-alpha-monooxygenase activity heme binding iron ion binding
Homo sapiens
3D-structure Cholesterol metabolism Endoplasmic reticulum Heme Iron Lipid metabolism Membrane Metal-binding Microsome Monooxygenase Oxidoreductase Reference proteome Steroid metabolism Sterol metabolism Transmembrane Transmembrane helix
MMTTSLIWGI
MMTTSLIWGIAIAACCCLWLILGIRRRQTGEPPLENGLIPYLGCALQFGANPLEFLRANQRKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKYFDWKKFHFATSAKAFGHRSIDPMDGNTTENINDTFIKTLQGHALNSLTESMMENLQRIMRPPVSSNSKTAAWVTEGMYSFCYRVMFEAGYLTIFGRDLTRRDTQKAHILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAKTHLVVLWASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLE...
bile acid and bile salt transport bile acid biosynthetic process bile acid signaling pathway cellular response to cholesterol cellular response to glucose stimulus cholesterol catabolic process cholesterol homeostasis negative regulation of collagen biosynthetic process negative regulation of fatty acid biosynthetic pr...
bone resorption cell surface receptor signaling pathway cellular response to hypoxia cellular response to nerve growth factor stimulus cellular response to platelet-derived growth factor stimulus DNA damage response male gonad development mast cell degranulation negative regulation of apoptotic process negative regulat...
axon; cilium; cytosol; flotillin complex; focal adhesion; Golgi apparatus; growth cone; membrane raft; perinuclear region of cytoplasm; plasma membrane
calcium ion binding ephrin receptor binding phosphatidylinositol 3-kinase regulatory subunit binding phosphotyrosine residue binding protein kinase binding protein tyrosine kinase binding receptor tyrosine kinase binding SH3 domain binding ubiquitin protein ligase activity
Mus musculus
3D-structure Calcium Cell membrane Cell projection Cytoplasm Golgi apparatus Membrane Metal-binding Phosphoprotein Proto-oncogene Reference proteome Repeat Transferase Ubl conjugation Ubl conjugation pathway Zinc Zinc-finger
MAGNVKKSSG
MAGNVKKSSGAGGGGSGGSGAGGLIGLMKDAFQPHHHHHHLSPHPPCTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTVLSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNK...
bone resorption cell surface receptor signaling pathway cellular response to hypoxia cellular response to nerve growth factor stimulus cellular response to platelet-derived growth factor stimulus DNA damage response male gonad development mast cell degranulation negative regulation of apoptotic process negative regulat...
cholesterol metabolic process cholesterol transport high-density lipoprotein particle remodeling reverse cholesterol transport triglyceride transport very-low-density lipoprotein particle remodeling
extracellular space; high-density lipoprotein particle
cholesterol transfer activity lipid binding
Oryctolagus cuniculus
Cholesterol metabolism Disulfide bond Glycoprotein Lipid metabolism Lipid transport Reference proteome Secreted Signal Steroid metabolism Sterol metabolism Transport
ACPKGASYEA
ACPKGASYEAGIVCRITKPALLVLNQETAKVVQTAFQRAGYPDVSGERAVMLLGRVKYGLHNLQISHLSIASSQVELVDAKTIDVAIQNVSVVFKGTLNYSYTSAWGLGINQSVDFEIDSAIDLQINTELTCDAGSVRTNAPDCYLAFHKLLLHLQGEREPGWLKQLFTNFISFTLKLILKRQVCNEINTISNIMADFVQTRAASILSDGDIGVDISVTGAPVITATYLESHHKGHFTHKNVSEAFPLRAFPPGLLGDSRMLYFWFSDQVLNSLARAAFQEGRLVLSLTGDEFKKVLETQGFDTNQEIFQELSRGLPTGQ...
cholesterol metabolic process cholesterol transport high-density lipoprotein particle remodeling reverse cholesterol transport triglyceride transport very-low-density lipoprotein particle remodeling extracellular space; high-density lipoprotein particle cholesterol transfer activity lipid binding Oryctolagus cuniculus ...
MAPK cascade negative regulation of canonical Wnt signaling pathway positive regulation of insulin-like growth factor receptor signaling pathway positive regulation of MAPK cascade regulation of cell growth regulation of glucose metabolic process regulation of insulin-like growth factor receptor signaling pathway respo...
endoplasmic reticulum lumen; extracellular region; extracellular space
insulin-like growth factor I binding insulin-like growth factor II binding signaling receptor binding
Homo sapiens
3D-structure Alternative splicing Direct protein sequencing Disulfide bond Glycoprotein Growth factor binding Phosphoprotein Reference proteome Secreted Signal
MLPLCLVAAL
MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQKHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE
MAPK cascade negative regulation of canonical Wnt signaling pathway positive regulation of insulin-like growth factor receptor signaling pathway positive regulation of MAPK cascade regulation of cell growth regulation of glucose metabolic process regulation of insulin-like growth factor receptor signaling pathway respo...
adenylate cyclase-modulating G protein-coupled receptor signaling pathway high-density lipoprotein particle assembly negative regulation of smoothened signaling pathway negative regulation of TORC1 signaling neural tube closure protein kinase A signaling protein phosphorylation regulation of protein processing renal wa...
cAMP-dependent protein kinase complex; centrosome; ciliary base; cytosol; extracellular exosome; nucleoplasm; nucleus; plasma membrane
AMP-activated protein kinase activity ATP binding cAMP-dependent protein kinase activity magnesium ion binding protein serine kinase activity protein serine/threonine kinase activity ubiquitin protein ligase binding
Homo sapiens
Alternative splicing ATP-binding cAMP Cell membrane Cytoplasm Disease variant Kinase Lipoprotein Membrane Myristate Nucleotide-binding Nucleus Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase
MGNAATAKKG
MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFR...
adenylate cyclase-modulating G protein-coupled receptor signaling pathway high-density lipoprotein particle assembly negative regulation of smoothened signaling pathway negative regulation of TORC1 signaling neural tube closure protein kinase A signaling protein phosphorylation regulation of protein processing renal wa...
aerobic respiration cellular respiration mitochondrial electron transport, ubiquinol to cytochrome c oxidative phosphorylation proteolysis
mitochondrial inner membrane; mitochondrial respiratory chain complex III; mitochondrial respiratory chain complex IV; mitochondrion; nucleoplasm
metal ion binding metalloendopeptidase activity
Homo sapiens
3D-structure Acetylation Direct protein sequencing Disease variant Electron transport Membrane Mitochondrion Mitochondrion inner membrane Primary mitochondrial disease Reference proteome Respiratory chain Transit peptide Transport
MKLLTRAGSF
MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQP...
aerobic respiration cellular respiration mitochondrial electron transport, ubiquinol to cytochrome c oxidative phosphorylation proteolysis mitochondrial inner membrane; mitochondrial respiratory chain complex III; mitochondrial respiratory chain complex IV; mitochondrion; nucleoplasm metal ion binding metalloendopeptid...
negative regulation of transcription by RNA polymerase II negative regulation of ubiquitin-dependent protein catabolic process positive regulation of rDNA heterochromatin formation positive regulation of RNA polymerase II transcription preinitiation complex assembly positive regulation of transcription by RNA polymeras...
cytosol; nucleus
peptidyl-prolyl cis-trans isomerase activity RNA polymerase II complex binding
Saccharomyces cerevisiae
3D-structure Cytoplasm Isomerase Nucleus Phosphoprotein Reference proteome Rotamase
MPSDVASRTG
MPSDVASRTGLPTPWTVRYSKSKKREYFFNPETKHSQWEEPEGTNKDQLHKHLRDHPVRVRCLHILIKHKDSRRPASHRSENITISKQDATDELKTLITRLDDDSKTNSFEALAKERSDCSSYKRGGDLGWFGRGEMQPSFEDAAFQLKVGEVSDIVESGSGVHVIKRVG
negative regulation of transcription by RNA polymerase II negative regulation of ubiquitin-dependent protein catabolic process positive regulation of rDNA heterochromatin formation positive regulation of RNA polymerase II transcription preinitiation complex assembly positive regulation of transcription by RNA polymeras...
adaptive thermogenesis calcium ion transmembrane transport calcium ion transport from cytosol to endoplasmic reticulum fatty acid beta-oxidation flight behavior follicle cell of egg chamber development heart contraction intestinal stem cell homeostasis intracellular calcium ion homeostasis lipid biosynthetic process ne...
endomembrane system; endoplasmic reticulum; endoplasmic reticulum membrane; sarcoplasmic reticulum; sarcoplasmic reticulum membrane; synapse
ATP binding ATP hydrolysis activity metal ion binding P-type calcium transporter activity
Drosophila melanogaster
Alternative splicing ATP-binding Calcium Calcium transport Endoplasmic reticulum Ion transport Magnesium Membrane Metal-binding Nucleotide-binding Phosphoprotein Reference proteome Sarcoplasmic reticulum Translocase Transmembrane Transmembrane helix Transport
MEDGHSKTVE
MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLA...
adaptive thermogenesis calcium ion transmembrane transport calcium ion transport from cytosol to endoplasmic reticulum fatty acid beta-oxidation flight behavior follicle cell of egg chamber development heart contraction intestinal stem cell homeostasis intracellular calcium ion homeostasis lipid biosynthetic process ne...
cardiac muscle cell differentiation cardioblast differentiation cardiocyte differentiation cell differentiation determination of digestive tract left/right asymmetry embryonic anterior midgut (ectodermal) morphogenesis embryonic heart tube development germ cell migration gonad development gonadal mesoderm development l...
nucleus
DNA binding DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding
Drosophila melanogaster
Developmental protein DNA-binding Homeobox Nucleus Reference proteome
MLQHHQQQAQ
MLQHHQQQAQSGGYYDHYTQSPSPGSLTNADALNTTPFSVKDILNMVNQTEAYEGSYGHIDGAATASALFAAGEYQNPHQYLNHQQHQQSELPIPQQQLHHQHLDDGATTSSSLSPLLPPPPHQLYGGYQDYGMPAHMFQHHHGHPHQSFQHSASAYNMSASQFYAGASATAYQTPATYNYNYAGSGEVYGGATPSAVGIKSEYIPTPYVTPSPTLDLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAKKKDNSQVTSSRSELRKNSISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRF...
cardiac muscle cell differentiation cardioblast differentiation cardiocyte differentiation cell differentiation determination of digestive tract left/right asymmetry embryonic anterior midgut (ectodermal) morphogenesis embryonic heart tube development germ cell migration gonad development gonadal mesoderm development l...
adult behavior cellular response to histamine chemical synaptic transmission chloride transmembrane transport gamma-aminobutyric acid signaling pathway inhibitory synapse assembly post-embryonic development regulation of postsynaptic membrane potential synaptic transmission, GABAergic
axon; chloride channel complex; cytoplasmic vesicle membrane; dendrite membrane; GABA receptor complex; GABA-A receptor complex; GABA-ergic synapse; glutamatergic synapse; inhibitory synapse; neuron projection; plasma membrane; postsynapse; postsynaptic specialization membrane; synapse
chloride channel activity GABA-A receptor activity GABA-gated chloride ion channel activity inhibitory extracellular ligand-gated monoatomic ion channel activity neurotransmitter receptor activity transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
Mus musculus
3D-structure Alternative splicing Cell membrane Cell projection Chloride Chloride channel Cytoplasmic vesicle Disulfide bond Glycoprotein Ion channel Ion transport Lipoprotein Membrane Palmitate Phosphoprotein Postsynaptic cell membrane Reference proteome Signal Synapse Transmembrane Transmembrane helix Transport
MSSPNTWSIG
MSSPNTWSIGSSVYSPVFSQKMTLWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTI...
adult behavior cellular response to histamine chemical synaptic transmission chloride transmembrane transport gamma-aminobutyric acid signaling pathway inhibitory synapse assembly post-embryonic development regulation of postsynaptic membrane potential synaptic transmission, GABAergic axon; chloride channel complex; cy...
animal organ morphogenesis canonical Wnt signaling pathway cell fate commitment cell-cell signaling muscle cell differentiation negative regulation of canonical Wnt signaling pathway neuron differentiation positive regulation of cell migration positive regulation of convergent extension involved in gastrulation positiv...
cell surface; endoplasmic reticulum lumen; extracellular matrix; extracellular space
cytokine activity frizzled binding signaling receptor binding
Mus musculus
Developmental protein Disulfide bond Extracellular matrix Glycoprotein Lipoprotein Reference proteome Secreted Signal Wnt signaling pathway
MPSLLLVVVA
MPSLLLVVVAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAISRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRALMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRITRQGKLELANSRFNQPTPEDLVYVDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCG...
animal organ morphogenesis canonical Wnt signaling pathway cell fate commitment cell-cell signaling muscle cell differentiation negative regulation of canonical Wnt signaling pathway neuron differentiation positive regulation of cell migration positive regulation of convergent extension involved in gastrulation positiv...
animal organ morphogenesis axis specification branching involved in ureteric bud morphogenesis canonical Wnt signaling pathway cell fate commitment cell-cell signaling epithelial-mesenchymal cell signaling nephron tubule development nephron tubule formation neuron differentiation odontogenesis of dentin-containing toot...
cell surface; endoplasmic reticulum lumen; extracellular matrix; extracellular space
cytokine activity frizzled binding signaling receptor binding
Mus musculus
Developmental protein Disulfide bond Extracellular matrix Glycoprotein Lipoprotein Reference proteome Secreted Signal Wnt signaling pathway
MLPPVPSRLG
MLPPVPSRLGLLLLLLCPAHVDGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRVLQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLLGTPGPPGPTGSPDASAAWEWGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCD...
animal organ morphogenesis axis specification branching involved in ureteric bud morphogenesis canonical Wnt signaling pathway cell fate commitment cell-cell signaling epithelial-mesenchymal cell signaling nephron tubule development nephron tubule formation neuron differentiation odontogenesis of dentin-containing toot...
carbohydrate metabolic process cellular response to fructose stimulus fructose import across plasma membrane fructose transmembrane transport glucose transmembrane transport intestinal hexose absorption regulation of systemic arterial blood pressure mediated by a chemical signal response to fructose
apical plasma membrane; extracellular exosome; membrane; plasma membrane; sarcolemma; specific granule membrane
fructose binding fructose transmembrane transporter activity glucose transmembrane transporter activity
Homo sapiens
Acetylation Alternative splicing Cell membrane Glycoprotein Membrane Reference proteome Sugar transport Transmembrane Transmembrane helix Transport
MEQQDQSMKE
MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGEFMEDFPLTLLWSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSRVATSFELIIISRLLVGICAGVSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIFGLRNLLANVDGWPILLGLTGVPAALQLLLLPFFPESPRYLLIQKKDEAAAKKALQTLRGWDSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQLLSIIVLMGGQQLSGVNAIYYYADQIYLSAGVPEEHVQYVTAG...
carbohydrate metabolic process cellular response to fructose stimulus fructose import across plasma membrane fructose transmembrane transport glucose transmembrane transport intestinal hexose absorption regulation of systemic arterial blood pressure mediated by a chemical signal response to fructose apical plasma membr...
cell envelope organization keratinization keratinocyte differentiation peptide cross-linking positive regulation of cell cycle positive regulation of keratinocyte proliferation protein modification process
cornified envelope; cytosol; extracellular exosome; membrane; plasma membrane
identical protein binding metal ion binding protein-glutamine gamma-glutamyltransferase activity
Homo sapiens
3D-structure Acyltransferase Alternative splicing Calcium Disease variant Ichthyosis Keratinization Lipoprotein Membrane Metal-binding Palmitate Phosphoprotein Reference proteome Transferase
MMDGPRSDVG
MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDDWGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAAGDGTIREGMLVVNGVDLLSSRSDQNRREHHTDEYEYDELIVRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGTHVIIPVGKGGSGGWKAQVVKASGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYILDRRGMPYGGRGDPVN...
cell envelope organization keratinization keratinocyte differentiation peptide cross-linking positive regulation of cell cycle positive regulation of keratinocyte proliferation protein modification process cornified envelope; cytosol; extracellular exosome; membrane; plasma membrane identical protein binding metal ion ...
apoptotic process cell migration involved in sprouting angiogenesis cellular response to corticotropin-releasing hormone stimulus cellular response to fibroblast growth factor stimulus cellular response to vascular endothelial growth factor stimulus detection of lipopolysaccharide endothelial cell chemotaxis fat cell d...
chromatin; cytosol; mitochondrion; nuclear membrane; nucleoplasm; nucleus; presynapse; transcription regulator complex
DNA binding DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity, RNA polymerase II-specific identical protein binding lipopolysaccharide binding nuclear glucocorticoid receptor binding nuclear receptor activity protein heterodimerization activity RNA polyme...
Homo sapiens
3D-structure Acetylation Alternative splicing Cytoplasm DNA-binding Inflammatory response Metal-binding Mitochondrion Nucleus Phosphoprotein Receptor Reference proteome Transcription Transcription regulation Zinc Zinc-finger
MPCIQAQYGT
MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQ...
apoptotic process cell migration involved in sprouting angiogenesis cellular response to corticotropin-releasing hormone stimulus cellular response to fibroblast growth factor stimulus cellular response to vascular endothelial growth factor stimulus detection of lipopolysaccharide endothelial cell chemotaxis fat cell d...
neuronal action potential potassium ion transmembrane transport protein homooligomerization
juxtaparanode region of axon; plasma membrane; voltage-gated potassium channel complex
delayed rectifier potassium channel activity voltage-gated potassium channel activity
Xenopus laevis
Cell membrane Glycoprotein Ion channel Ion transport Lipoprotein Membrane Palmitate Phosphoprotein Potassium Potassium channel Potassium transport Reference proteome Transmembrane Transmembrane helix Transport Voltage-gated channel
MTVATGDLTD
MTVATGDLTDGSVGFAGHPQDSYDPEPDHECCERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYFYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEIFREDEGFIKEEERPLPDNEFQKQVWLLFEYPESSGPARIIAIISVTVILISIVSFCLETLPVFRDENEDMHGSGGNYYSYPNSTVRFQKSNTFTDPFFIVETLCIIWFSFEFLVRFLACPSKAVFFTNLMNIIDIVAIIPYFITLGTELAEKTEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQT...
neuronal action potential potassium ion transmembrane transport protein homooligomerization juxtaparanode region of axon; plasma membrane; voltage-gated potassium channel complex delayed rectifier potassium channel activity voltage-gated potassium channel activity Xenopus laevis Cell membrane Glycoprotein Ion channel I...
cell competition in a multicellular organism cell cycle cystoblast division female germ-line stem cell asymmetric division fusome organization gamete generation germ-line stem cell division germ-line stem cell population maintenance germarium-derived female germ-line cyst formation male germline stem cell symmetric div...
cytoplasm; fusome; spectrosome
mRNA 3'-UTR binding mRNA regulatory element binding translation repressor activity ubiquitin binding
Drosophila melanogaster
3D-structure Cell cycle Developmental protein Differentiation Oogenesis Reference proteome Spermatogenesis
MLNARDVCPE
MLNARDVCPEGNDDQQLDHNFKQMEEHLALMVEGNENEDPRKATCEYEDTNEDGATCTSGVLSEIQENFGRLRLCDVTAPLLEFHGLDCLQQIQKRSRHFAFDGSPAKKSRSGGVLVTGPKQKQLQKENVWNRKSKGSASADNIEKLPITIEKLHMIGLHGDCLEHNAVLRLMNLFRSLHDHLTADLGFSRQNSMPSDYLFDMPVKSTMPKSLNVRYQLQVLCTKVERFLVQQRRTLEANRHFDFEKYDECDKLLKGFASYLDNFKLLLKPKMRNRNGNSGSNADKFHTQRMERLLIGLRDWIKAAHLSVHVFNWEMDLE...
cell competition in a multicellular organism cell cycle cystoblast division female germ-line stem cell asymmetric division fusome organization gamete generation germ-line stem cell division germ-line stem cell population maintenance germarium-derived female germ-line cyst formation male germline stem cell symmetric div...
bicarbonate transport one-carbon metabolic process
apical plasma membrane; brush border membrane; cell surface; endoplasmic reticulum-Golgi intermediate compartment; external side of plasma membrane; extracellular exosome; Golgi apparatus; membrane; perinuclear region of cytoplasm; plasma membrane; rough endoplasmic reticulum; secretory granule membrane; trans-Golgi ne...
carbonate dehydratase activity zinc ion binding
Homo sapiens
3D-structure Alternative splicing Cell membrane Direct protein sequencing Disease variant Disulfide bond Glycoprotein GPI-anchor Lipoprotein Lyase Membrane Metal-binding Reference proteome Retinitis pigmentosa Signal Zinc
MRMLLALLAL
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLGPMLACLLAGFLR
bicarbonate transport one-carbon metabolic process apical plasma membrane; brush border membrane; cell surface; endoplasmic reticulum-Golgi intermediate compartment; external side of plasma membrane; extracellular exosome; Golgi apparatus; membrane; perinuclear region of cytoplasm; plasma membrane; rough endoplasmic re...
adult behavior behavioral response to pain chemical synaptic transmission establishment of localization in cell excitatory postsynaptic potential gamma-aminobutyric acid secretion inhibitory postsynaptic potential ionotropic glutamate receptor signaling pathway membrane depolarization modulation of chemical synaptic tr...
dendrite; glutamatergic synapse; ionotropic glutamate receptor complex; kainate selective glutamate receptor complex; membrane; neuronal cell body; plasma membrane; postsynaptic density; postsynaptic density membrane; presynaptic membrane; receptor complex; synapse; terminal bouton
extracellularly glutamate-gated ion channel activity glutamate binding glutamate-gated receptor activity identical protein binding kainate selective glutamate receptor activity L-glutamate transmembrane transporter activity ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane pote...
Rattus norvegicus
3D-structure Alternative splicing Cell membrane Glycoprotein Ion channel Ion transport Ligand-gated ion channel Membrane Phosphoprotein Postsynaptic cell membrane Receptor Reference proteome RNA editing Signal Synapse Transmembrane Transmembrane helix Transport
MERSTVLIQP
MERSTVLIQPGLWTRDTSWTLLYFLCYILPQTSPQVLRIGGIFETVENEPVNVEELAFKFAVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQSICNALEVPHIQTRWKHPSVDSRDLFYINLYPDYAAISRAVLDLVLYYNWKTVTVVYEDSTGLIRLQELIKAPSRYNIKIKIRQLPPANKDAKPLLKEMKKSKEFYVIFDCSHETAAEILKQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGFRKLNIDNPHVSSIIEKWSMERLQAPPRPETGLLDGMMTTE...
adult behavior behavioral response to pain chemical synaptic transmission establishment of localization in cell excitatory postsynaptic potential gamma-aminobutyric acid secretion inhibitory postsynaptic potential ionotropic glutamate receptor signaling pathway membrane depolarization modulation of chemical synaptic tr...
proteolysis
extracellular matrix
metalloendopeptidase activity zinc ion binding
Paracentrotus lividus
Autocatalytic cleavage Calcium Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Metal-binding Metalloprotease Protease Repeat Signal Zinc Zymogen
MANSGLILLV
MANSGLILLVMFMIHVTTVHNVPLPSTAPSIITQLSDITTSIIEEDAFGLTTPTTGLLTPVSENDSDDDGDDITTIQTTTSSSQTVISGVVVEEGVHESNVEILKAHLEKFGYTPPGSTFGEANLNYTSAILDFQEHGGINQTGILDADTAELLSTPRCGVPDVLPFVTSSITWSRNQPVTYSFGALTSDLNQNDVKDEIRRAFRVWDDVSGLSFREVPDTTSVDIRIKFGSYDHGDGISFDGRGGVLAHAFLPRNGDAHFDDSETWTEGTRSGTNLFQVAAHEFGHSLGLYHSTVRSALMYPYYQGYVPNFRLDNDDIA...
proteolysis extracellular matrix metalloendopeptidase activity zinc ion binding Paracentrotus lividus Autocatalytic cleavage Calcium Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Metal-binding Metalloprotease Protease Repeat Signal Zinc Zymogen MANSGLILLV MANSGLILLVMFMIHVTTVHNVPLPSTAPSIITQLSDITTSIIEED...
lipid metabolic process positive regulation of triglyceride catabolic process xenobiotic metabolic process
endoplasmic reticulum membrane
catalytic activity deacetylase activity lipase activity serine hydrolase activity triglyceride lipase activity
Homo sapiens
Direct protein sequencing Disulfide bond Endoplasmic reticulum Glycoprotein Hydrolase Lipid metabolism Membrane Microsome Reference proteome Signal-anchor Transmembrane Transmembrane helix
MGRKSLYLLI
MGRKSLYLLIVGILIAYYIYTPLPDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAA...
lipid metabolic process positive regulation of triglyceride catabolic process xenobiotic metabolic process endoplasmic reticulum membrane catalytic activity deacetylase activity lipase activity serine hydrolase activity triglyceride lipase activity Homo sapiens Direct protein sequencing Disulfide bond Endoplasmic retic...
arginine biosynthetic process argininosuccinate metabolic process urea cycle
cytoplasm; cytosol
argininosuccinate synthase activity ATP binding
Saccharomyces cerevisiae
Amino-acid biosynthesis Arginine biosynthesis ATP-binding Cytoplasm Ligase Nucleotide-binding Reference proteome
MSKGKVCLAY
MSKGKVCLAYSGGLDTSVILAWLLDQGYEVVAFMANVGQEEDFDAAKEKALKIGACKFVCVDCREDFVKDILFPAVQVNAVYEDVYLLGTSLARPVIAKAQIDVAKQEGCFAVSHGCTGKGNDQIRFELSFYALKPDVKCITPWRMPEFFERFAGRKDLLDYAAQKGIPVAQTKAKPWSTDENQAHISYEAGILEDPDTTPPKDMWKLIVDPMDAPDQPQDLTIDFERGLPVKLTYTDNKTSKEVSVTKPLDVFLAASNLARANGVGRIDIVEDRYINLKSRGCYEQAPLTVLRKAHVDLEGLTLDKEVRQLRDSFVTPN...
arginine biosynthetic process argininosuccinate metabolic process urea cycle cytoplasm; cytosol argininosuccinate synthase activity ATP binding Saccharomyces cerevisiae Amino-acid biosynthesis Arginine biosynthesis ATP-binding Cytoplasm Ligase Nucleotide-binding Reference proteome MSKGKVCLAY MSKGKVCLAYSGGLDTSVILAWLLDQ...
calcium ion transport cognition intracellular calcium ion homeostasis negative regulation of tumor necrosis factor production positive regulation of angiogenesis positive regulation of cell population proliferation positive regulation of MAPK cascade response to hypoxia response to nicotine signal transduction synaptic...
acetylcholine-gated channel complex; axon; cytoplasm; dendrite; neuron projection; perikaryon; plasma membrane; postsynaptic membrane; synapse
acetylcholine binding acetylcholine receptor activity acetylcholine-gated monoatomic cation-selective channel activity amyloid-beta binding chloride channel regulator activity protein homodimerization activity toxic substance binding
Gallus gallus
3D-structure Cell membrane Direct protein sequencing Disulfide bond Glycoprotein Ion channel Ion transport Ligand-gated ion channel Membrane Postsynaptic cell membrane Receptor Reference proteome Signal Synapse Transmembrane Transmembrane helix Transport
MGLRALMLWL
MGLRALMLWLLAAAGLVRESLQGEFQRKLYKELLKNYNPLERPVANDSQPLTVYFTLSLMQIMDVDEKNQVLTTNIWLQMYWTDHYLQWNVSEYPGVKNVRFPDGLIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQKCNLKFGSWTYGGWSLDLQMQEADISGYISNGEWDLVGIPGKRTESFYECCKEPYPDITFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHH...
calcium ion transport cognition intracellular calcium ion homeostasis negative regulation of tumor necrosis factor production positive regulation of angiogenesis positive regulation of cell population proliferation positive regulation of MAPK cascade response to hypoxia response to nicotine signal transduction synaptic...
cellular response to amino acid stimulus cellular response to ethanol cellular response to zinc ion chloride transmembrane transport monoatomic ion transmembrane transport neuropeptide signaling pathway response to amino acid spinal cord development synapse assembly
chloride channel complex; glycinergic synapse; neuron projection; plasma membrane; postsynaptic membrane; synapse
extracellularly glycine-gated chloride channel activity glycine binding glycine-gated chloride ion channel activity metal ion binding transmembrane signaling receptor activity transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
Rattus norvegicus
Alternative splicing Cell membrane Cell projection Chloride Chloride channel Disulfide bond Glycoprotein Ion channel Ion transport Ligand-gated ion channel Membrane Metal-binding Postsynaptic cell membrane Receptor Reference proteome Signal Synapse Transmembrane Transmembrane helix Transport Zinc
MNRQLVNILT
MNRQLVNILTALFAFFLGTNHFREAFCKDHDSRSGKHPSQTLSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFEYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIW...
cellular response to amino acid stimulus cellular response to ethanol cellular response to zinc ion chloride transmembrane transport monoatomic ion transmembrane transport neuropeptide signaling pathway response to amino acid spinal cord development synapse assembly chloride channel complex; glycinergic synapse; neuron...
cluster assembly chaperone cofactor-dependent protein refolding protein import into mitochondrial matrix protein refolding
cytoplasm; mitochondrion; PAM complex, Tim23 associated import motor
ATP binding ATP hydrolysis activity ATP-dependent protein folding chaperone heat shock protein binding protein folding chaperone unfolded protein binding
Schizosaccharomyces pombe
Alternative initiation ATP-binding Hydrolase Mitochondrion Nucleotide-binding Reference proteome Stress response Transit peptide
MISSRFTNVV
MISSRFTNVVRSGLRFQSKGASFKIGASLHGSRMTARWNSNASGNEKVKGPVIGIDLGTTTSCLAIMEGQTPKVIANAEGTRTTPSVVAFTKDGERLVGVSAKRQAVINPENTFFATKRLIGRRFKEPEVQRDIKEVPYKIVEHSNGDAWLEARGKTYSPSQIGGFILSKMRETASTYLGKDVKNAVVTVPAYFNDSQRQATKAAGAIAGLNVLRVVNEPTAAALAYGLDKKNDAIVAVFDLGGGTFDISILELNNGVFEVRSTNGDTHLGGEDFDVALVRHIVETFKKNEGLDLSKDRLAVQRIREAAEKAKCELSSLS...
cluster assembly chaperone cofactor-dependent protein refolding protein import into mitochondrial matrix protein refolding cytoplasm; mitochondrion; PAM complex, Tim23 associated import motor ATP binding ATP hydrolysis activity ATP-dependent protein folding chaperone heat shock protein binding protein folding chaperon...
steroid metabolic process sulfation
cytoplasm; cytosol
alcohol sulfotransferase activity bile-salt sulfotransferase activity sulfotransferase activity
Rattus norvegicus
Cytoplasm Direct protein sequencing Lipid metabolism Reference proteome Steroid metabolism Transferase
MPDYTWFEGI
MPDYTWFEGIPFPAFGIPKETLQNVCNKFVVKEEDLILLTYPKSGTNWLIEIVCLIQTKGDPKWIQSVTIWDRSPWIETDLGYDMLIKKKGPRLITSHLPMHLFSKSLFSSKAKVIYLIRNPRDVLVSGYYFWGKTTLAKKPDSLGTYVEWFLKGYVPYGSWFEHIRAWLSMRELDNFLLLYYEDMKKDTMGTIKKICDFLGKKLEPDELDLVLKYSSFQVMKENNMSNYNLMEKELILPGFTFMRNGTTGDWKNHFTVAQAEAFDKVFQEKMAGFPPGMFPWD
steroid metabolic process sulfation cytoplasm; cytosol alcohol sulfotransferase activity bile-salt sulfotransferase activity sulfotransferase activity Rattus norvegicus Cytoplasm Direct protein sequencing Lipid metabolism Reference proteome Steroid metabolism Transferase MPDYTWFEGI MPDYTWFEGIPFPAFGIPKETLQNVCNKFVVKEEDLI...
protein stabilization
blood microparticle; extracellular exosome; extracellular matrix; extracellular region; extracellular space
enzyme regulator activity
Homo sapiens
Direct protein sequencing Disulfide bond Glycoprotein Leucine-rich repeat Reference proteome Repeat Secreted Signal
MLPGAWLLWT
MLPGAWLLWTSLLLLARPAQPCPMGCDCFVQEVFCSDEELATVPLDIPPYTKNIIFVETSFTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFLNLSTNIFSNLTSLGKLTLNFNMLEALPEGLFQHLAALESLHLQGNQLQALPRRLFQPLTHLKTLNLAQNLLAQLPEELFHPLTSLQTLKLSNNALSGLPQGVFGKLGSLQELFLDSNNISELPPQVFSQLFCLERLWLQRNAITHLPLSIFASLGNLTFLSLQWNMLRVLPAGLFAHTPCLVGLSLTHNQLETVAEGTFAHLSNLRSLML...
protein stabilization blood microparticle; extracellular exosome; extracellular matrix; extracellular region; extracellular space enzyme regulator activity Homo sapiens Direct protein sequencing Disulfide bond Glycoprotein Leucine-rich repeat Reference proteome Repeat Secreted Signal MLPGAWLLWT MLPGAWLLWTSLLLLARPAQPCPM...
disruption of extracellular matrix of another organism envenomation resulting in hemorrhagic damage in another organism envenomation resulting in induction of edema in another organism envenomation resulting in myocyte killing in another organism proteolysis
extracellular region
metal ion binding metalloendopeptidase activity peptidase activity toxin activity
Lachesis muta muta
Calcium Direct protein sequencing Disulfide bond Glycoprotein Hemorrhagic toxin Hemostasis impairing toxin Hydrolase Metal-binding Metalloprotease Protease Secreted Toxin Zinc
FSQKYIELVV
FSQKYIELVVVADHGMFTKYNGNLNTIRTRVHEIVNTLNGFYRSLNILISLTDLEIWSNQDLINVQSAANDTLKTFGEWRERVLLNRISHDNAQLLTAIDLADNTIGIAYTGGMCYPKNSVGIVQDHSPKTLLIAVTMAHELGHNLGMKHDENHCHCSASFCIMPPSISEGPSYEFSDCSKDYYQMFLTKRKPQCILNKP
disruption of extracellular matrix of another organism envenomation resulting in hemorrhagic damage in another organism envenomation resulting in induction of edema in another organism envenomation resulting in myocyte killing in another organism proteolysis extracellular region metal ion binding metalloendopeptidase a...