Biological Process
stringlengths
7
1.01k
Cellular Component
stringlengths
6
867
Molecular Function
stringlengths
11
871
Organism
stringlengths
8
73
Keywords
stringlengths
1
810
Sequence 10
stringlengths
5
10
Sequence
stringlengths
5
1.02k
Combined
stringlengths
136
3.91k
cell redox homeostasis deoxyribonucleotide biosynthetic process endoplasmic reticulum to Golgi vesicle-mediated transport glutathione metabolic process protein deglutathionylation protein transport retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum sulfate assimilation vacuole fusion, non-autophagic ...
cytoplasm; cytosol; fungal-type vacuole; Golgi membrane; membrane fusion priming complex; nucleus
disulfide oxidoreductase activity protein-disulfide reductase activity
Saccharomyces cerevisiae
3D-structure Cytoplasm Deoxyribonucleotide synthesis Direct protein sequencing Disulfide bond Electron transport Golgi apparatus Isopeptide bond Membrane Nucleus Phosphoprotein Protein transport Redox-active center Reference proteome Transport Ubl conjugation
MVTQLKSASE
MVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV
cell redox homeostasis deoxyribonucleotide biosynthetic process endoplasmic reticulum to Golgi vesicle-mediated transport glutathione metabolic process protein deglutathionylation protein transport retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum sulfate assimilation vacuole fusion, non-autophagic ...
endoplasmic reticulum to Golgi vesicle-mediated transport intracellular protein transport retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum vesicle fusion vesicle fusion with Golgi apparatus
COPII-coated ER to Golgi transport vesicle; endoplasmic reticulum membrane; Golgi membrane; membrane; SNARE complex
SNAP receptor activity
Saccharomyces cerevisiae
3D-structure Coiled coil Endoplasmic reticulum ER-Golgi transport Golgi apparatus Membrane Protein transport Reference proteome Transmembrane Transmembrane helix Transport
MSSRFAGGNA
MSSRFAGGNAYQRDTGRTQLFGPADGSNSLDDNVSSALGSTDKLDYSQSTLASLESQSEEQMGAMGQRIKALKSLSLKMGDEIRGSNQTIDQLGDTFHNTSVKLKRTFGNMMEMARRSGISIKTWLIIFFMVGVLFFWVWIT
endoplasmic reticulum to Golgi vesicle-mediated transport intracellular protein transport retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum vesicle fusion vesicle fusion with Golgi apparatus COPII-coated ER to Golgi transport vesicle; endoplasmic reticulum membrane; Golgi membrane; membrane; SNARE c...
cell differentiation muscle cell fate determination muscle organ development negative regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II
nucleus
DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding
Drosophila melanogaster
Developmental protein DNA-binding Homeobox Nucleus Reference proteome Repeat
MVMLQSPAQK
MVMLQSPAQKASDSASAQNTAVGGLMSPNSNPDSPKSNTSPDVASADSVVSGTGGGSTPPAAKIPKFIISANGAAVAGKQEQELRYSLERLKQMSSESGSLLSRLSPLQEDSQDKEKPNHNNNNSLTNHNANSNTRRSQSPPASVGSVSFSSPAQQRKLLELNAVRHLARPEPLQHPHAALLQQHPHLLQNPQFLAAAQQHMHHHQHQHHQHPAHPHSHQHPHPHPHPHPHPHPSAVFHLRAPSSSSTAPPSPATSPLSPPTSPAMHSDQQMSPPIAPPQNPPHSSQPPQQQQVAAPSDMDLERIKLVAAVAARTTQASS...
cell differentiation muscle cell fate determination muscle organ development negative regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II nucleus DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific ...
brain development cell differentiation glial cell development negative regulation of gene expression negative regulation of transcription by RNA polymerase II neuroblast development neuroblast fate determination positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II
nucleus
DNA-binding transcription factor activity, RNA polymerase II-specific DNA-binding transcription factor binding RNA polymerase II cis-regulatory region sequence-specific DNA binding
Drosophila melanogaster
3D-structure Developmental protein Differentiation DNA-binding Homeobox Neurogenesis Nucleus Reference proteome Transcription Transcription regulation
MTTSASLERT
MTTSASLERTPSKRDRDRERDNSSGLGSAGSLPASPQSAITVSPSSPATPKRPLRTSTPSLERKREREDREDREDRKERQERHERDRDHERFAAVFSTASTTVPTNTSSSSGLAPEQLRIPTGAAAFSGFPGLHSMSSLMLPSSAAVAAAAAAPFLPWSPILLPPWNHALLPAAFYPAALRNALPGLFDAKVPSSQRSGFHISDILNLEGSELKNAAAAAAAAAHHGSDLSHHSASESTSGHRGQGSHTSPSALSPTPAGVSADEHHNGSGTGGGAGEADHHSTTEHHAPPSHPQQQHPHHQQHHHPHLLLPQQHHQQAV...
brain development cell differentiation glial cell development negative regulation of gene expression negative regulation of transcription by RNA polymerase II neuroblast development neuroblast fate determination positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II n...
cell differentiation mesoderm development mesodermal cell fate commitment positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II visceral muscle development
nucleus
DNA binding DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific DNA binding
Drosophila melanogaster
Developmental protein DNA-binding Homeobox Nucleus Reference proteome
MLNMESAGVS
MLNMESAGVSAAMAGLSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPT...
cell differentiation mesoderm development mesodermal cell fate commitment positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II visceral muscle development nucleus DNA binding DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis...
adult walking behavior anterior head segmentation anterior region determination brain development brain segmentation central nervous system development compound eye morphogenesis compound eye photoreceptor development embryonic development via the syncytial blastoderm negative regulation of transcription by RNA polymer...
nucleus
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity, RNA polymerase II-specific protein heterodimerization activity protein homodimerization activity RNA polymerase II cis-regulatory region sequence-specific DNA binding
Drosophila melanogaster
Developmental protein DNA-binding Homeobox Nucleus Reference proteome Repeat Transcription Transcription regulation
MAAGFLKSGD
MAAGFLKSGDLGPHPHSYGGPHPHHSVPHGPLPPGMPMPSLGPFGLPHGLEAVGFSQGMWGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQQQSNSLSSSKNASGGGSGNSCSSSSANSRSNSNNNGSSSNNNTQSSGGNNSNKSSQKQGNSQSSQQGGGSSGGNNSNNNSAAAAASAAAAVAAAQSIKTHHSSFLSAAAAAASGGTNQSANNNSNNNNQGNSTPNSSSSGGGGGSQAGGHLSAAAAAAALNVTAAHQNSSPLLPTPATSVSPVSIVCKKEH...
adult walking behavior anterior head segmentation anterior region determination brain development brain segmentation central nervous system development compound eye morphogenesis compound eye photoreceptor development embryonic development via the syncytial blastoderm negative regulation of transcription by RNA polymer...
apoptotic process determination of dorsal/ventral asymmetry dorsal/ventral pattern formation hemocyte proliferation innate immune response larval somatic muscle development positive regulation of antifungal peptide production response to fungus Toll signaling pathway
cytoplasm; cytoplasmic side of plasma membrane; cytosol; nucleus; plasma membrane
protein domain specific binding protein tyrosine kinase binding
Drosophila melanogaster
3D-structure Cell membrane Cytoplasm Developmental protein Membrane Reference proteome Repeat Transducer
MAYGWNGCGM
MAYGWNGCGMGVQVNGSNGAIGLSSKYSRNTELRRVEDNDIYRLAKILDENSCWRKLMSIIPKGMDVQACSGAGCLNFPAEIKKGFKYTAQDVFQIDEAANRLPPDQSKSQMMIDEWKTSGKLNERPTVGVLLQLLVQAELFSAADFVALDFLNESTPARPVDGPGALISLELLEEEMEVDNEGLSLKYQSSTATLGADAQGSVGLNLDNFEKDIVRRDKSVPQPSGNTPPIAPPRRQQRSTTNSNFATLTGTGTTSTTIPNVPNLTILNPSEQIQEPVLQPRPMNIPDLSILISNSGDLRATVSDNPSNRTSSTDPPNI...
apoptotic process determination of dorsal/ventral asymmetry dorsal/ventral pattern formation hemocyte proliferation innate immune response larval somatic muscle development positive regulation of antifungal peptide production response to fungus Toll signaling pathway cytoplasm; cytoplasmic side of plasma membrane; cyto...
defense response to bacterium defense response to fungus negative regulation of DNA-templated transcription positive regulation of DNA binding positive regulation of DNA-templated transcription positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II response to heat
chromatin; nucleus; polytene chromosome
DNA binding DNA-binding transcription factor activity identical protein binding RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific DNA binding
Drosophila melanogaster
3D-structure Activator Direct protein sequencing DNA-binding Nucleus Phosphoprotein Reference proteome Stress response Transcription Transcription regulation
MSRSRSSAKA
MSRSRSSAKAVQFKHESEEEEEDEEEQLPSRRMHSYGDAAAIGSGVPAFLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYGFHKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQIKRKISNNKNGDDKGVLKPEAMSKILTDVKVMRGRQDNLDSRFSAMKQENEVLWREIASLRQKHAKQQQIVNKLIQFLITIVQPSRNMSGVKRHVQLMINNTPEIDRARTTSETESESGGGPVIHELREELLDEVMNPSPAGYTAASHYDQESVSPPAVERPRSNMSISSHNVDYS...
defense response to bacterium defense response to fungus negative regulation of DNA-templated transcription positive regulation of DNA binding positive regulation of DNA-templated transcription positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II response to heat ch...
axon guidance eye morphogenesis germ-band extension negative regulation of DNA-templated transcription neuroblast fate determination periodic partitioning by pair rule gene positive regulation of DNA-templated transcription positive regulation of transcription by RNA polymerase II segment polarity determination sex det...
nucleus
ATP binding DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific DNA binding
Drosophila melanogaster
Developmental protein Nucleus Pair-rule protein Reference proteome Segmentation polarity protein Transcription Transcription regulation
MHLPAGPTMV
MHLPAGPTMVANNTQVLAAAAAAAAAAAAAVAQGPGPQQSSNATTASAIAINPAQSLANTSTHSASSTGSSTPDLSTNNTSSSSNATTSPQNSAKMPSSMTDMFASLHEMLQEYHGELAQTGSPSILCSALPNHWRSNKSLPGAFKVIALDDVPDGTLVSIKCGNDENYCGELRNCTTTMKNQVAKFNDLRFVGRSGRGKSFTLTITIATYPVQIASYSKAIKVTVDGPREPRSKQSYGYPHPGAFNPFMLNPAWLDAAYMTYGYADYFRHQAAAQAAQVHHPALAKSSASSVSPNPNPSVATSSSSAVQPSEYPHPAAA...
axon guidance eye morphogenesis germ-band extension negative regulation of DNA-templated transcription neuroblast fate determination periodic partitioning by pair rule gene positive regulation of DNA-templated transcription positive regulation of transcription by RNA polymerase II segment polarity determination sex det...
germ-line stem-cell niche homeostasis glucose homeostasis lipid homeostasis R7 cell fate commitment R8 cell-mediated photoreceptor organization response to glucose sevenless signaling pathway visual perception
plasma membrane; rhabdomere microvillus membrane
adenylate cyclase inhibiting G protein-coupled glutamate receptor activity receptor ligand activity sevenless binding
Drosophila melanogaster
Cell membrane G-protein coupled receptor Glycoprotein Membrane Receptor Reference proteome Sensory transduction Signal Transducer Transmembrane Transmembrane helix Vision
MKVMDALQSG
MKVMDALQSGRRKPLPVALLCILVTVFCVLECHGADLTSPTKKSAPLRITKPQPTSQQAKPISITTRAPTTVASTTDDEVSSSVDGQLAPLISSTTEGPSSGTTASLVPEICLNGLQLTVNSADEGTVIRKQEEFVKILEGDVVLSVLTKDPDSALFVINRVNQANLIMADFEIGIRAISIDNASLAENLLIQEVQFLQQCTTYSMGIFVDWELYKQLESVIKDLEYNIWPIPGTRAHLFPKVAHLLHQMPWGEKIASVEIATETLEMYNEFMEAARQEHMCLMHFKSDDNVYIMFGNKLASHFKENGTLFSVPTDRTDD...
germ-line stem-cell niche homeostasis glucose homeostasis lipid homeostasis R7 cell fate commitment R8 cell-mediated photoreceptor organization response to glucose sevenless signaling pathway visual perception plasma membrane; rhabdomere microvillus membrane adenylate cyclase inhibiting G protein-coupled glutamate rece...
cell differentiation determination of muscle attachment site larval somatic muscle development muscle organ development positive regulation of myoblast differentiation regulation of transcription by RNA polymerase II
cytoplasm; nucleus
DNA-binding transcription factor activity, RNA polymerase II-specific protein dimerization activity RNA polymerase II cis-regulatory region sequence-specific DNA binding
Drosophila melanogaster
Developmental protein Differentiation DNA-binding Myogenesis Nucleus Reference proteome Transcription Transcription regulation
MTKYNSGSSE
MTKYNSGSSEMPAAQTIKQEYHNGYGQPTHPGYGFSAYSQQNPIAHPGQNPHQTLQNFFSRFNAVGDASAGNGGAASISANGSGSSCNYSHANHHPAELDKPLGMNMTPSPIYTTDYDDENSSLSSEEHVLAPLVCSSAQSSRPCLTWACKACKKKSVTVDRRKAATMRERRRLRKVNEAFEILKRRTSSNPNQRLPKVEILRNAIEYIESLEDLLQESSTTRDGDNLAPSLSGKSCQSDYLSSYAGAYLEDKLSFYNKHMEKYGQFTDFDGNANGSSLDCLNLIVQSINKSTTSPIQNKATPSASDTQSPPSSGATAPT...
cell differentiation determination of muscle attachment site larval somatic muscle development muscle organ development positive regulation of myoblast differentiation regulation of transcription by RNA polymerase II cytoplasm; nucleus DNA-binding transcription factor activity, RNA polymerase II-specific protein dimeri...
defense response to Gram-negative bacterium determination of adult lifespan insulin catabolic process negative regulation of developmental growth negative regulation of growth negative regulation of insulin receptor signaling pathway peptide catabolic process positive regulation of innate immune response proteolysis pr...
cytoplasm; cytosol; mitochondrion; peroxisome; plasma membrane
metal ion binding metalloendopeptidase activity metallopeptidase activity
Drosophila melanogaster
Direct protein sequencing Hydrolase Metal-binding Metalloprotease Protease Reference proteome Zinc
MTIAESSQKS
MTIAESSQKSATRKPDSMEPILRLNNIEKSLQDTRDYRGLQLENGLKVLLISDPNTDVSAAALSVQVGHMSDPTNLPGLAHFCEHMLFLGTEKYPHENGYTTYLSQSGGSSNAATYPLMTKYHFHVAPDKLDGALDRFAQFFIAPLFTPSATEREINAVNSEHEKNLPSDLWRIKQVNRHLAKPDHAYSKFGSGNKTTLSEIPKSKNIDVRDELLKFHKQWYSANIMCLAVIGKESLDELEGMVLEKFSEIENKNVKVPGWPRHPYAEERYGQKVKIVPIKDIRSLTISFTTDDLTQFYKSGPDNYLTHLIGHEGKGSIL...
defense response to Gram-negative bacterium determination of adult lifespan insulin catabolic process negative regulation of developmental growth negative regulation of growth negative regulation of insulin receptor signaling pathway peptide catabolic process positive regulation of innate immune response proteolysis pr...
cellular response to dexamethasone stimulus cholesterol metabolic process detection of UV erythrocyte differentiation generation of precursor metabolites and energy heme A biosynthetic process heme B biosynthetic process heme biosynthetic process heme O biosynthetic process multicellular organismal-level iron ion homeo...
mitochondrial inner membrane; mitochondrial matrix; mitochondrion
2 iron, 2 sulfur cluster binding ferrochelatase activity ferrous iron binding heme binding identical protein binding iron-responsive element binding protein homodimerization activity
Homo sapiens
2Fe-2S 3D-structure Acetylation Alternative splicing Disease variant Heme biosynthesis Iron Iron-sulfur Lyase Membrane Metal-binding Mitochondrion Mitochondrion inner membrane Porphyrin biosynthesis Reference proteome Transit peptide
MRSLGANMAA
MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQVQPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIK...
cellular response to dexamethasone stimulus cholesterol metabolic process detection of UV erythrocyte differentiation generation of precursor metabolites and energy heme A biosynthetic process heme B biosynthetic process heme biosynthetic process heme O biosynthetic process multicellular organismal-level iron ion homeo...
adenylate cyclase-activating G protein-coupled receptor signaling pathway bone mineralization calcium ion homeostasis chondrocyte differentiation endochondral ossification endoderm development lung alveolus development lung epithelial cell differentiation magnesium ion homeostasis mammary gland bud elongation negative ...
cytosol; extracellular space; Golgi apparatus; nucleoplasm; nucleus
hormone activity peptide hormone receptor binding
Mus musculus
Calcium Cleavage on pair of basic residues Cytoplasm Hormone Nucleus Reference proteome Secreted Signal
MLRRLVQQWS
MLRRLVQQWSVLVFLLSYSVPSRGRSVEGLGRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRREQEKKKRRTRSAWPSTAASGLLEDPLPHTSRTSLEPSLRTH
adenylate cyclase-activating G protein-coupled receptor signaling pathway bone mineralization calcium ion homeostasis chondrocyte differentiation endochondral ossification endoderm development lung alveolus development lung epithelial cell differentiation magnesium ion homeostasis mammary gland bud elongation negative ...
actin cytoskeleton organization asexual reproduction CTP biosynthetic process dGTP biosynthetic process from dGDP G protein-coupled receptor signaling pathway GTP biosynthetic process negative regulation of exocytosis negative regulation of phagocytosis negative regulation of pinocytosis nucleoside triphosphate biosynt...
cytoplasm; cytoskeleton; phagocytic vesicle; plasma membrane; ribosome; secretory granule
ATP binding metal ion binding nucleoside diphosphate kinase activity
Dictyostelium discoideum
3D-structure ATP-binding Cytoplasm Kinase Magnesium Metal-binding Nucleotide metabolism Nucleotide-binding Phosphoprotein Reference proteome Transferase
MSTNKVNKER
MSTNKVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
actin cytoskeleton organization asexual reproduction CTP biosynthetic process dGTP biosynthetic process from dGDP G protein-coupled receptor signaling pathway GTP biosynthetic process negative regulation of exocytosis negative regulation of phagocytosis negative regulation of pinocytosis nucleoside triphosphate biosynt...
blood coagulation proteolysis
endoplasmic reticulum lumen; extracellular exosome; extracellular space; Golgi lumen
calcium ion binding serine-type endopeptidase activity
Homo sapiens
3D-structure Alternative splicing Blood coagulation Calcium Cleavage on pair of basic residues Direct protein sequencing Disulfide bond EGF-like domain Gamma-carboxyglutamic acid Glycoprotein Hemostasis Hydroxylation Reference proteome Repeat Secreted Serine protease homolog Signal
MAGCVPLLQG
MAGCVPLLQGLVLVLALHRVEPSVFLPASKANDVLVRWKRAGSYLLEELFEGNLEKECYEEICVYEEAREVFENEVVTDEFWRRYKGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTSEKRAPDLQDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITVKTYFNRTSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVT...
blood coagulation proteolysis endoplasmic reticulum lumen; extracellular exosome; extracellular space; Golgi lumen calcium ion binding serine-type endopeptidase activity Homo sapiens 3D-structure Alternative splicing Blood coagulation Calcium Cleavage on pair of basic residues Direct protein sequencing Disulfide bond E...
basolateral protein secretion endosome to melanosome transport Golgi to lysosome transport Golgi to vacuole transport intracellular protein transport melanosome assembly platelet dense granule organization positive regulation of natural killer cell degranulation positive regulation of natural killer cell mediated cytot...
AP-1 adaptor complex; clathrin-coated pit; clathrin-coated vesicle; cytosol; early endosome; Golgi apparatus; intracellular membrane-bounded organelle; lysosomal membrane; perinuclear region of cytoplasm; recycling endosome; trans-Golgi network; trans-Golgi network membrane
clathrin adaptor activity GTP-dependent protein binding kinesin binding small GTPase binding
Mus musculus
3D-structure Coated pit Cytoplasm Cytoplasmic vesicle Direct protein sequencing Golgi apparatus Membrane Protein transport Reference proteome Transport
MPAPIRLREL
MPAPIRLRELIRTIRTARTQAEEREMIQKECAAIRSSFREEDNTYRCRNVAKLLYMHMLGYPAHFGQLECLKLIASQKFTDKRIGYLGAMLLLDERQDVHLLMTNCIKNDLNHSTQFVQGLALCTLGCMGSSEMCRDLAGEVEKLLKTSNSYLRKKAALCAVHVIRKVPELMEMFLPATKNLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKLVPQLVRILKNLIMSGYSPEHDVSGISDPFLQVRILRLLRILGRNDDDSSEAMNDILAQVATNTETSKNVGNAILYETVLTIMDIKSESGLRVLAINILGRFLLNN...
basolateral protein secretion endosome to melanosome transport Golgi to lysosome transport Golgi to vacuole transport intracellular protein transport melanosome assembly platelet dense granule organization positive regulation of natural killer cell degranulation positive regulation of natural killer cell mediated cytot...
cellular response to lipopolysaccharide collagen catabolic process endodermal cell differentiation extracellular matrix disassembly extracellular matrix organization positive regulation of microglial cell activation positive regulation of neuroinflammatory response positive regulation of tumor necrosis factor productio...
collagen-containing extracellular matrix; extracellular region; extracellular space; specific granule lumen; tertiary granule lumen
endopeptidase activity metalloendopeptidase activity peptidase activity serine-type endopeptidase activity tumor necrosis factor binding zinc ion binding
Homo sapiens
3D-structure Calcium Collagen degradation Direct protein sequencing Disulfide bond Extracellular matrix Glycoprotein Hydrolase Metal-binding Metalloprotease Protease Reference proteome Repeat Secreted Signal Zinc Zymogen
MFSLKTLPFL
MFSLKTLPFLLLLHVQISKAFPVSSKEKNTKTVQDYLEKFYQLPSNQYQSTRKNGTNVIVEKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGGFMLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPKPCDPSLTFDAITTLRGEILFFKDRYFWRRHPQLQRVEMNFISL...
cellular response to lipopolysaccharide collagen catabolic process endodermal cell differentiation extracellular matrix disassembly extracellular matrix organization positive regulation of microglial cell activation positive regulation of neuroinflammatory response positive regulation of tumor necrosis factor productio...
heme A biosynthetic process heme B biosynthetic process heme biosynthetic process heme O biosynthetic process liver development porphyrin-containing compound biosynthetic process porphyrin-containing compound metabolic process protoporphyrinogen IX biosynthetic process response to xenobiotic stimulus tetrapyrrole biosy...
axon; cytoplasm; cytosol; perinuclear region of cytoplasm
amine binding carboxylic acid binding hydroxymethylbilane synthase activity uroporphyrinogen-III synthase activity
Mus musculus
Acetylation Alternative splicing Heme biosynthesis Phosphoprotein Porphyrin biosynthesis Reference proteome Transferase
MSGNGGAATT
MSGNGGAATTAEENGSKMRVIRVGTRKSQLARIQTDTVVAMLKALYPGIQFEIIAMSTTGDKILDTALSKIGEKSLFTKELENALEKNEVDLVVHSLKDVPTILPPGFTIGAICKRENPCDAVVFHPKFIGKTLETLPEKSAVGTSSLRRVAQLQRKFPHLEFKSIRGNLNTRLRKLDELQEFSAIVLAVAGLQRMGWQNRVGQILHPEECMYAVGQGALAVEVRAKDQDILDLVSVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTVMKDGQLYLTGGVWSLDGSDSMQETMQATIQVPVQQEDGPEDDPQLVGITA...
heme A biosynthetic process heme B biosynthetic process heme biosynthetic process heme O biosynthetic process liver development porphyrin-containing compound biosynthetic process porphyrin-containing compound metabolic process protoporphyrinogen IX biosynthetic process response to xenobiotic stimulus tetrapyrrole biosy...
nitrogen fixation
nitrogenase complex
4 iron, 4 sulfur cluster binding ATP binding carbonyl sulfide nitrogenase activity metal ion binding nitrogenase activity
Rhodospirillum rubrum
4Fe-4S ADP-ribosylation ATP-binding Direct protein sequencing Iron Iron-sulfur Metal-binding Nitrogen fixation Nucleotide-binding Oxidoreductase
MSALRQIAFY
MSALRQIAFYGKGGIGKSTTSQNTLAALVEMGQRILIVGCDPKADSTRLILNTKLQDTVLHLAAEAGSVEDLDVADVVKIGYKGIKCTESGGPEPGVGCAGRGVITAINFLEENGAYDDLDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMALYAANNIAKGILKYAHTGGVRLGGLICNERQTDKEVELAEALAGRLGCRLIHFVPRDNGVQHAELRRQTVIQYAPDSKQAGEYRTLATKIHNNSGQGVVPTPITMEDLEEMLMEFGIMKSDEEALAELEAKESAAAN
nitrogen fixation nitrogenase complex 4 iron, 4 sulfur cluster binding ATP binding carbonyl sulfide nitrogenase activity metal ion binding nitrogenase activity Rhodospirillum rubrum4Fe-4S ADP-ribosylation ATP-binding Direct protein sequencing Iron Iron-sulfur Metal-binding Nitrogen fixation Nucleotide-binding Oxidoredu...
neuropeptide signaling pathway
extracellular region
hormone activity
Pelophylax ridibundus
Amidation Cleavage on pair of basic residues Endorphin Glycoprotein Hormone Pyrrolidone carboxylic acid Secreted Signal
MLQPVWSCIL
MLQPVWSCILALLGVFIFHVGEVRSQCWESNKCTDLSSEDGILECIKACKMDLSAESPVFPGNGHMQPLSENIRKYVMSHFRWNKFGRRNSTSNDNNNGGYKREDIANYPILNLLTGSDNQNTQQGIMEDEAVDRQDSKRSYSMEHFRWGKPVGKKRRPIKVFPTDAEEESSEIFPLELRRELSLEFDYPDTNSEEDLDDGELLDGPVKKDRKYKMHHFRWEGPPKDKRYGGFMTPERSQTPLMTLFKNAIIKNAHKKGQ
neuropeptide signaling pathway extracellular region hormone activity Pelophylax ridibundus Amidation Cleavage on pair of basic residues Endorphin Glycoprotein Hormone Pyrrolidone carboxylic acid Secreted Signal MLQPVWSCIL MLQPVWSCILALLGVFIFHVGEVRSQCWESNKCTDLSSEDGILECIKACKMDLSAESPVFPGNGHMQPLSENIRKYVMSHFRWNKFGRRNSTSNDNN...
chemical synaptic transmission chloride transmembrane transport gamma-aminobutyric acid signaling pathway synaptic transmission, GABAergic
axon; chloride channel complex; dendrite; GABA-A receptor complex; GABA-ergic synapse; glutamatergic synapse; neuron projection; neuronal cell body; postsynaptic membrane; synapse
chloride channel activity GABA-A receptor activity neurotransmitter receptor activity transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
Mus musculus
Cell membrane Chloride Chloride channel Disulfide bond Glycoprotein Ion channel Ion transport Membrane Phosphoprotein Postsynaptic cell membrane Reference proteome Signal Synapse Transmembrane Transmembrane helix Transport
MDVLGWLLLP
MDVLGWLLLPLLLLCTQPHHGARAMNDIGDYVGSNLEISWLPNLDGLMEGYARNFRPGIGGAPVNVALALEVASIDHISEANMEYTMTVFLHQSWRDSRLSYNHTNETLGLDSRFVDKLWLPDTFIVNAKSAWFHDVTVENKLIRLQPDGVILYSIRITSTVACDMDLAKYPLDEQECMLDLESYGYSSEDIVYYWSENQEQIHGLDRLQLAQFTITSYRFTTELMNFKSAGQFPRLSLHFQLRRNRGVYIIQSYMPSVLLVAMSWVSFWISQAAVPARVSLGITTVLTMTTLMVSARSSLPRASAIKALDVYFWICYVF...
chemical synaptic transmission chloride transmembrane transport gamma-aminobutyric acid signaling pathway synaptic transmission, GABAergic axon; chloride channel complex; dendrite; GABA-A receptor complex; GABA-ergic synapse; glutamatergic synapse; neuron projection; neuronal cell body; postsynaptic membrane; synapse c...
embryonic forelimb morphogenesis fatty acid transport positive regulation of collateral sprouting retinoic acid metabolic process
cytoplasm; cytosol; endoplasmic reticulum; nucleoplasm; nucleus
cyclin binding fatty acid binding retinal binding retinoic acid binding retinol binding
Mus musculus
Cytoplasm Endoplasmic reticulum Isopeptide bond Nucleus Reference proteome Retinol-binding Transport Ubl conjugation Vitamin A
MPNFSGNWKI
MPNFSGNWKIIRSENFEEMLKALGVNMMMRKIAVAAASKPAVEIKQENDTFYIKTSTTVRTTEINFKIGEEFEEQTVDGRPCKSLVKWESGNKMVCEQRLLKGEGPKTSWSRELTNDGELILTMTADDVVCTRVYVRE
embryonic forelimb morphogenesis fatty acid transport positive regulation of collateral sprouting retinoic acid metabolic process cytoplasm; cytosol; endoplasmic reticulum; nucleoplasm; nucleus cyclin binding fatty acid binding retinal binding retinoic acid binding retinol binding Mus musculus Cytoplasm Endoplasmic ret...
base-excision repair
mitochondrion; nucleus
3'-5'-DNA exonuclease activity 3'-tyrosyl-DNA phosphodiesterase activity DNA binding DNA-(apurinic or apyrimidinic site) endonuclease activity double-stranded DNA 3'-5' DNA exonuclease activity phosphoric diester hydrolase activity zinc ion binding
Saccharomyces cerevisiae
Direct protein sequencing DNA damage DNA repair Hydrolase Metal-binding Nucleus Phosphoprotein Reference proteome Zinc
MPSTPSFVRS
MPSTPSFVRSAVSKYKFGAHMSGAGGISNSVTNAFNTGCNSFAMFLKSPRKWVSPQYTQEEIDKFKKNCATYNYNPLTDVLPHGQYFINLANPDREKAEKSYESFMDDLNRCEQLGIGLYNLHPGSTLKGDHQLQLKQLASYLNKAIKETKFVKIVLENMAGTGNLVGSSLVDLKEVIGMIEDKSRIGVCIDTCHTFAAGYDISTTETFNNFWKEFNDVIGFKYLSAVHLNDSKAPLGANRDLHERLGQGYLGIDVFRMIAHSEYLQGIPIVLETPYENDEGYGNEIKLMEWLESKSESELLEDKEYKEKNDTLQKLGAK...
base-excision repair mitochondrion; nucleus 3'-5'-DNA exonuclease activity 3'-tyrosyl-DNA phosphodiesterase activity DNA binding DNA-(apurinic or apyrimidinic site) endonuclease activity double-stranded DNA 3'-5' DNA exonuclease activity phosphoric diester hydrolase activity zinc ion binding Saccharomyces cerevisiae D...
cell adhesion cellular response to heat cellular response to osmotic stress cellular response to oxidative stress plasma membrane organization
cytoplasm; cytosol; endosome; nucleus; plasma membrane
lipid binding protein folding chaperone
Saccharomyces cerevisiae
3D-structure Direct protein sequencing Phosphoprotein Reference proteome Stress response
MSDAGRKGFG
MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNKGVFQGVHDSAEKGKDNAEGQGESLADQARDYMGAAKSKLNDAVEYVSGRVHGEEDPTKK
cell adhesion cellular response to heat cellular response to osmotic stress cellular response to oxidative stress plasma membrane organization cytoplasm; cytosol; endosome; nucleus; plasma membrane lipid binding protein folding chaperone Saccharomyces cerevisiae 3D-structure Direct protein sequencing Phosphoprotein Re...
defense response to bacterium defense response to fungus defense response to other organism heat acclimation negative regulation of seed germination response to heat response to virus stomatal closure
apoplast; chloroplast; cytoplasm; cytosol; cytosolic ribosome; Golgi apparatus; nucleolus; nucleus; plant-type cell wall; plant-type vacuole; plasma membrane; plasmodesma
ATP binding ATP-dependent protein folding chaperone mRNA binding protease binding
Arabidopsis thaliana
Acetylation Alternative splicing ATP-binding Chaperone Cytoplasm Nucleotide-binding Nucleus Plant defense Reference proteome Stress response Transcription Transcription regulation
MSGKGEGPAI
MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEFAAEEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCM...
defense response to bacterium defense response to fungus defense response to other organism heat acclimation negative regulation of seed germination response to heat response to virus stomatal closure apoplast; chloroplast; cytoplasm; cytosol; cytosolic ribosome; Golgi apparatus; nucleolus; nucleus; plant-type cell wal...
response to bacterium response to heat response to virus
cytosol; Golgi apparatus; nucleus; plant-type cell wall; plasma membrane
ATP binding ATP-dependent protein folding chaperone
Arabidopsis thaliana
ATP-binding Chaperone Cytoplasm Nucleotide-binding Nucleus Reference proteome Stress response Transcription Transcription regulation
MAGKGEGPAI
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPVNTVFDAKRLIGRRFSDASVQSDRQLWPFTIISGTAEKPMIVVEYKGEEKQFAAEEISSMVLIKMREIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKQDITGQPRALRRLRTACERAKRTLSSTAQTTIEIDSLYGGADFYSPITRARFEEMNMDLFRKCM...
response to bacterium response to heat response to virus cytosol; Golgi apparatus; nucleus; plant-type cell wall; plasma membrane ATP binding ATP-dependent protein folding chaperone Arabidopsis thaliana ATP-binding Chaperone Cytoplasm Nucleotide-binding Nucleus Reference proteome Stress response Transcription Transcrip...
viral RNA genome replication
host cell endoplasmic reticulum membrane; membrane
nucleotide binding RNA binding RNA-dependent RNA polymerase activity
Red clover necrotic mosaic virus
Host endoplasmic reticulum Host membrane Membrane Nucleotide-binding Nucleotidyltransferase Reference proteome Ribosomal frameshifting RNA-directed RNA polymerase Suppressor of RNA silencing Transferase Viral RNA replication
MGFINLSLFD
MGFINLSLFDVDKLMVWVSKFNPGKILSAICNLGIDCWNRFRKWFFGLNFDAHMWAVDAFIPLMPHYTEQMERVVDDFCSETPESKLEDCLELDTSVNEFFDEEVYKKDEEGVMKLQRSAARKHIKRVRPGMMQAAIKAVETRIRNRHTIFGDDMGKVDEAAVRATASDICGEFKINEHHTNALVYAAAYLAMTPDQRSIDSVKLAYNPKSQARRTLVSAIRENKAVAGFKSLEDFLGGPLSFPVEDAPYPILGIPEIRVAEKRASRVMKSKRVVGLPAVSAGLKVCVHQTSLHNMIVSLERRVFRVKNSAGELVVPPKP...
viral RNA genome replication host cell endoplasmic reticulum membrane; membrane nucleotide binding RNA binding RNA-dependent RNA polymerase activity Red clover necrotic mosaic virus Host endoplasmic reticulum Host membrane Membrane Nucleotide-binding Nucleotidyltransferase Reference proteome Ribosomal frameshifting RNA...
muscle organ development positive regulation of mesodermal cell fate specification positive regulation of muscle cell differentiation positive regulation of myoblast differentiation positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II striated muscle cell differenti...
nucleus
DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific protein homodimerization activity RNA polymerase II cis-regulatory region sequence-specific DNA binding RNA polymerase II transcription regulatory region sequence-specific DNA binding
Caenorhabditis elegans
Alternative splicing Developmental protein Differentiation DNA-binding Myogenesis Nucleus Reference proteome Transcription Transcription regulation
MNTETSTQSA
MNTETSTQSAPSDTYDTSIYYNSSPRVTANDITTLTSFAAPAPQVLDYANTQYDIYRNQPAYYLPSYAPTAPTTFYSDFANFNVTRSQDFASVPAVANSSDVKPIIIKQEKSTPNATELIIQSRVDSQHEDTTTSTAGGAGVGGPRRTKFVLSVDRRKAATMRERRRLRKVNEAFEVVKQRTCPNPNQRLPKVEILRSAIDYINNLERMLQQAGKMTKIMEQNQHLQMTQQINGAPPHDYVTSSHFASSSYNPENMFDDDDLTDSDDDRDHHKLGNAVDLRRRNSLDRLSRIVASIPNEEAMTDEQLLQPANDVIDGEKK...
muscle organ development positive regulation of mesodermal cell fate specification positive regulation of muscle cell differentiation positive regulation of myoblast differentiation positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II striated muscle cell differenti...
associative learning epidermal growth factor receptor signaling pathway muscle organ development nematode larval development oogenesis positive regulation of receptor localization to synapse positive regulation of vulval development Ras protein signal transduction regulation of cell fate specification regulation of cel...
cell cortex; plasma membrane
GDP binding GTP binding GTPase activity phospholipase binding protein serine/threonine kinase binding
Caenorhabditis elegans
Cell membrane GTP-binding Lipoprotein Membrane Methylation Nucleotide-binding Prenylation Reference proteome
MTEYKLVVVG
MTEYKLVVVGDGGVGKSALTIQLIQNHFVEEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAVNEAKSFENVANYREQIRRVKDSDDVPMVLVGNKCDLSSRSVDFRTVSETAKGYGIPNVDTSAKTRMGVDEAFYTLVREIRKHRERHDNNKPQKKKKCQIM
associative learning epidermal growth factor receptor signaling pathway muscle organ development nematode larval development oogenesis positive regulation of receptor localization to synapse positive regulation of vulval development Ras protein signal transduction regulation of cell fate specification regulation of cel...
cell growth mode switching, monopolar to bipolar establishment or maintenance of actin cytoskeleton polarity establishment or maintenance of cell polarity regulating cell shape intracellular signal transduction mitotic cytokinesis, division site positioning phosphorylation plasma membrane organization positive regulati...
cell cortex of cell tip; cell division site; cell tip; medial cortex; microtubule cytoskeleton; mitotic actomyosin contractile ring; new growing cell tip; non-growing cell tip; old cell tip after activation of bipolar cell growth
ATP binding protein serine kinase activity protein serine/threonine kinase activity
Schizosaccharomyces pombe
ATP-binding Cytoplasm Kinase Nucleotide-binding Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase
MEYRTNNVPV
MEYRTNNVPVGNETKSAALNALPKIKISDSPNRHHNLVDAFMQSPSYSTQPKSAVEPLGLSFSPGYISPSSQSPHHGPVRSPSSRKPLPASPSRTRDHSLRVPVSGHSYSADEKPRERRKVIGNYVLGKTIGAGSMGKVKVAHHLKTGEQFAIKIVTRLHPDITKAKAAASAEATKAAQSEKNKEIRTVREAALSTLLRHPYICEARDVYITNSHYYMVFEFVDGGQMLDYIISHGKLKEKQARKFVRQIGSALSYLHQNSVVHRDLKIENILISKTGDIKIIDFGLSNLYRRQSRLRTFCGSLYFAAPELLNAQPYIGP...
cell growth mode switching, monopolar to bipolar establishment or maintenance of actin cytoskeleton polarity establishment or maintenance of cell polarity regulating cell shape intracellular signal transduction mitotic cytokinesis, division site positioning phosphorylation plasma membrane organization positive regulati...
plasmid partitioning
extracellular region
DNA binding endonuclease activity exonuclease activity
Escherichia coli
DNA-binding Endonuclease Exonuclease Hydrolase Nuclease Plasmid Plasmid partition Secreted Signal
MKRRSYAMLR
MKRRSYAMLRAAAALAVLVVASPAWAELRGEVVRIIDGDTIDVLVDKQPVRVRLVDIDAPEKRQAFGERARQALAGMVFRRHVLVDEKDTDRYGRTLGTVWVNMELASRPPQPRNVNAAMVHQGMAWAYRFHGRAADPEMLRLEQEARGKRVGLWSDPHAVEPWKWRRESNNRRDEG
plasmid partitioning extracellular region DNA binding endonuclease activity exonuclease activity Escherichia coliDNA-binding Endonuclease Exonuclease Hydrolase Nuclease Plasmid Plasmid partition Secreted Signal MKRRSYAMLR MKRRSYAMLRAAAALAVLVVASPAWAELRGEVVRIIDGDTIDVLVDKQPVRVRLVDIDAPEKRQAFGERARQALAGMVFRRHVLVDEKDTDRYGRTLG...
tRNA folding tRNA methylation
cytosol
rRNA binding tRNA (uracil(54)-C5)-methyltransferase activity, S-adenosyl methionine-dependent tRNA binding
Escherichia coli
3D-structure Direct protein sequencing Methyltransferase Reference proteome S-adenosyl-L-methionine Transferase tRNA processing
MTPEHLPTEQ
MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDLVPEVFRSPVSHYRMRAEFRIWHDGDDLYHIIFDQQTKSRIRVDSFPAASELINQLMTAMIAGVRNNPVLRHKLFQIDYLTTLSNQAVVSLLYHKKLDDEWRQEAEALRDALRAQNLNVHLIGRATKTKIELDQDYIDERLPVAGKEMIYRQVENSFTQPNAAMNIQMLEWALDVTKGSKGDLLELYCGNGNFSLALARNFDRVLATEIAKPSVAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREFNRLQGIDLKSYQCETIFVDPPRSGLDSETEKMVQAYPRIL...
tRNA folding tRNA methylation cytosol rRNA binding tRNA (uracil(54)-C5)-methyltransferase activity, S-adenosyl methionine-dependent tRNA binding Escherichia coli 3D-structure Direct protein sequencing Methyltransferase Reference proteome S-adenosyl-L-methionine Transferase tRNA processing MTPEHLPTEQ MTPEHLPTEQYEAQLAEKV...
transport of virus in host, cell to cell
host cell plasmodesma; T=3 icosahedral viral capsid
DNA binding GTP binding RNA binding structural molecule activity
Bean-pod mottle virus
3D-structure Alternative initiation Capsid protein DNA-binding GTP-binding Host cell junction Nucleotide-binding RNA-binding Suppressor of RNA silencing T=3 icosahedral capsid protein Transport Viral movement protein Virion
MFASFIFSGD
MFASFIFSGDNKLTEKTIFNCGDLDILVVYYTIATQFRKFLPHYIRWHLYTLLIYILPSFLTTEIKYKRNLSNIHISGLFYDNRFKFWTKHDKNLALTEEEKMEVIRNRGIPADVLAKRAHEFEKHVAHESLKDQIPAVDKLYSTKVNKFAKIMNLRQSVVGDLKLLTDGKLYEGKHIPVSNISAGENHVVQIPLMAQEEILSSSASDFKTAMVSKSSKPQATAMHVGAIEIIIDSFASPDCNIVGAMLLVDTYHTNPENAVRSIFVAPFRGGRPIRVVTFPNTIVQIEPDMNSRFQLLSTTTNGDFVQGKDLAMVKVNV...
transport of virus in host, cell to cell host cell plasmodesma; T=3 icosahedral viral capsid DNA binding GTP binding RNA binding structural molecule activity Bean-pod mottle virus 3D-structure Alternative initiation Capsid protein DNA-binding GTP-binding Host cell junction Nucleotide-binding RNA-binding Suppressor of ...
axon midline choice point recognition courtship behavior female analia development female sex differentiation female somatic sex determination genital disc development imaginal disc-derived female genitalia development imaginal disc-derived male genitalia development male analia development male courtship behavior male...
nucleus
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity, RNA polymerase II-specific DNA-binding transcription repressor activity, RNA polymerase II-specific protein homodimerization activity RNA polymerase II cis-regulatory region sequence-specific DNA binding ...
Drosophila melanogaster
3D-structure Alternative splicing Differentiation DNA-binding Metal-binding Nucleus Reference proteome Sexual differentiation Transcription Transcription regulation Zinc
MVSEENWNSD
MVSEENWNSDTMSDSDMIDSKNDVCGGASSSSGSSISPRTPPNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQRVMALQTALRRAQAQDEQRALHMHEVPPANPAATTLLSHHHHVAAPAHVHAHHVHAHHAHGGHHSHHGHVLHHQQAAAAAAAAPSAPASHLGGSSTAASSIHGHAHAHHVHMAAAAAASVAQHQHQSHPHSHHHHHQNHHQHPHQQPATQTALRSPPHSDHGGSVGPATSSSGGGAPSSSNAAAATSSNGSSGGGGGGGGGSSGGGAGGGRSSGTSVITSADHHMTTVPTPAQSLEGSCD...
axon midline choice point recognition courtship behavior female analia development female sex differentiation female somatic sex determination genital disc development imaginal disc-derived female genitalia development imaginal disc-derived male genitalia development male analia development male courtship behavior male...
base-excision repair DNA repair nucleotide-excision repair nucleotide-excision repair involved in interstrand cross-link repair nucleotide-excision repair, DNA damage recognition protein localization to nucleus response to auditory stimulus UV protection UV-damage excision repair
intercellular bridge; nucleoplasm; nucleotide-excision repair factor 1 complex; nucleus
damaged DNA binding metal ion binding protein domain specific binding protein homodimerization activity sequence-specific double-stranded DNA binding
Homo sapiens
3D-structure Acetylation Disease variant DNA damage DNA repair DNA-binding Isopeptide bond Metal-binding Nucleus Phosphoprotein Reference proteome Ubl conjugation Xeroderma pigmentosum Zinc Zinc-finger
MAAADGALPE
MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM
base-excision repair DNA repair nucleotide-excision repair nucleotide-excision repair involved in interstrand cross-link repair nucleotide-excision repair, DNA damage recognition protein localization to nucleus response to auditory stimulus UV protection UV-damage excision repair intercellular bridge; nucleoplasm; nucl...
arachidonic acid secretion lipid catabolic process phospholipid metabolic process
extracellular region
calcium ion binding phospholipase A2 activity toxin activity
Pseudonaja textilis
Calcium Direct protein sequencing Disulfide bond Hydrolase Lipid degradation Lipid metabolism Metal-binding Neurotoxin Presynaptic neurotoxin Reference proteome Secreted Signal Toxin
MHPAHLLVLL
MHPAHLLVLLGVCVSLLGASDIPPLPLNLVQFSYLIRCANKYKRPGWHYANYGCYCGSGGRGTPVDDVDRCCQAHDKCYEDAEKLGCYPKWTTYYYYCGANGPYCKTRTKCQRFVCNCDVVAADCFASYPYNRRYWFYSNKKRCR
arachidonic acid secretion lipid catabolic process phospholipid metabolic process extracellular region calcium ion binding phospholipase A2 activity toxin activity Pseudonaja textilis Calcium Direct protein sequencing Disulfide bond Hydrolase Lipid degradation Lipid metabolism Metal-binding Neurotoxin Presynaptic neuro...
immune response immunoglobulin mediated immune response
extracellular region; immunoglobulin complex; plasma membrane
antigen binding
Homo sapiens
3D-structure Adaptive immunity Cell membrane Direct protein sequencing Disulfide bond Immunity Immunoglobulin Immunoglobulin domain Membrane Pyrrolidone carboxylic acid Reference proteome Secreted Signal
MDWTWRILFL
MDWTWRILFLVAAATGAHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGWVTMTRDTSISTAYMELSRLRSDDTAVYYCAR
immune response immunoglobulin mediated immune response extracellular region; immunoglobulin complex; plasma membrane antigen binding Homo sapiens 3D-structure Adaptive immunity Cell membrane Direct protein sequencing Disulfide bond Immunity Immunoglobulin Immunoglobulin domain Membrane Pyrrolidone carboxylic acid Refe...
bone mineralization bone morphogenesis cellular response to fluid shear stress collagen catabolic process embryonic hindlimb morphogenesis endochondral ossification estrous cycle extracellular matrix disassembly extracellular matrix organization growth plate cartilage development heart development luteolysis ossificati...
extracellular matrix; extracellular region; extracellular space; intercellular canaliculus
calcium ion binding calcium-dependent protein binding collagen binding endopeptidase activity fibronectin binding low-density lipoprotein particle receptor binding metalloendopeptidase activity peptidase activity serine-type endopeptidase activity zinc ion binding
Rattus norvegicus
Calcium Collagen degradation Direct protein sequencing Disulfide bond Extracellular matrix Glycoprotein Hydrolase Metal-binding Metalloprotease Phosphoprotein Protease Reference proteome Repeat Secreted Signal Zinc Zymogen
ATFFLLSWTH
ATFFLLSWTHCWSLPLPYGDDDDDDLSEEDLEFAEHYLKSYYHPVTLAGILKKSTVTSTVDRLREMQSFFGLDVTGKLDDPTLDIMRKPRCGVPDVGVYNVFPRTLKWSQTNLTYRIVNYTPDISHSEVEKAFRKAFKVWSDVTPLNFTRIHDGTADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNLGGDAHFDDDETWTSSSKGYNLFIVAAHELGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPEKCDPALSLDAITSLRGETMIFKDRFFWRLHPQQVEPELFLTKS...
bone mineralization bone morphogenesis cellular response to fluid shear stress collagen catabolic process embryonic hindlimb morphogenesis endochondral ossification estrous cycle extracellular matrix disassembly extracellular matrix organization growth plate cartilage development heart development luteolysis ossificati...
AMP metabolic process GMP salvage IMP biosynthetic process IMP salvage
cytosol
AMP deaminase activity identical protein binding metal ion binding
Homo sapiens
Alternative splicing Disease variant Hydrolase Metal-binding Nucleotide metabolism Phosphoprotein Reference proteome Zinc
MPLFKLPAEE
MPLFKLPAEEKQIDDAMRNFAEKVFASEVKDEGGRQEISPFDVDEICPISHHEMQAHIFHLETLSTSTEARRKKRFQGRKTVNLSIPLSETSSTKLSHIDEYISSSPTYQTVPDFQRVQITGDYASGVTVEDFEIVCKGLYRALCIREKYMQKSFQRFPKTPSKYLRNIDGEAWVANESFYPVFTPPVKKGEDPFRTDNLPENLGYHLKMKDGVVYVYPNEAAVSKDEPKPLPYPNLDTFLDDMNFLLALIAQGPVKTYTHRRLKFLSSKFQVHQMLNEMDELKELKNNPHRDFYNCRKVDTHIHAAACMNQKHLLRFIK...
AMP metabolic process GMP salvage IMP biosynthetic process IMP salvage cytosol AMP deaminase activity identical protein binding metal ion binding Homo sapiens Alternative splicing Disease variant Hydrolase Metal-binding Nucleotide metabolism Phosphoprotein Reference proteome Zinc MPLFKLPAEE MPLFKLPAEEKQIDDAMRNFAEKVFASE...
cell division G1/S transition of mitotic cell cycle phosphorylation regulation of G2/M transition of mitotic cell cycle regulation of gene expression regulation of meiotic cell cycle response to organic substance signal transduction
cyclin-dependent protein kinase holoenzyme complex; cytoplasm; nucleus
ATP binding cyclin binding cyclin-dependent protein serine/threonine kinase activity protein serine kinase activity RNA polymerase II CTD heptapeptide repeat kinase activity
Zea mays
ATP-binding Cell cycle Cell division Kinase Mitosis Nucleotide-binding Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase
MEQYEKVEKI
MEQYEKVEKIGEGTYGVVYKALDKATNETIALKKIRLEQEDEGVPSTAIREISLLKEMNHGNIVRLHDVVHSEKRIYLVFEYLDLDLKKFMDSCPEFAKNPTLIKSYLYQILHGVAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGARQYSTPVDVWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRILGTPNEQSWPGVSCLPDFKTAFPRWQAQDLATVVPNLDPAGLDLLSKMLRYEPSKRITARQALEHEYFKDLEVVQ
cell division G1/S transition of mitotic cell cycle phosphorylation regulation of G2/M transition of mitotic cell cycle regulation of gene expression regulation of meiotic cell cycle response to organic substance signal transduction cyclin-dependent protein kinase holoenzyme complex; cytoplasm; nucleus ATP binding cycl...
deadenylation-dependent decapping of nuclear-transcribed mRNA deadenylation-independent decapping of nuclear-transcribed mRNA follicle cell of egg chamber development habituation messenger ribonucleoprotein complex assembly miRNA-mediated gene silencing by inhibition of translation miRNA-mediated post-transcriptional g...
cytoplasm; cytoplasmic ribonucleoprotein granule; cytoplasmic stress granule; endoplasmic reticulum; messenger ribonucleoprotein complex; neuronal cell body; neuronal ribonucleoprotein granule; P granule; P-body; postsynapse; sensory dendrite
ATP binding ATP hydrolysis activity mRNA binding mRNA regulatory element binding translation repressor activity RNA binding RNA helicase activity
Drosophila melanogaster
3D-structure Alternative splicing ATP-binding Cell projection Cytoplasm Endoplasmic reticulum Helicase Hydrolase Methylation Nucleotide-binding Phosphoprotein Reference proteome Repressor RNA-binding Translation regulation
MMTEKLNSGH
MMTEKLNSGHTNLTSKGIINDLQIAGNTSDDMGWKSKLKLPPKDNRFKTTDVTDTRGNEFEEFCLKRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGKTGAYCIPVLEQIDPTKDYIQALVMVPTRELALQTSQICIELAKHLDIRVMVTTGGTILKDDILRIYQKVQLIIATPGRILDLMDKKVADMSHCRILVLDEADKLLSLDFQGMLDHVILKLPKDPQILLFSATFPLTVKNFMEKHLREPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGY...
deadenylation-dependent decapping of nuclear-transcribed mRNA deadenylation-independent decapping of nuclear-transcribed mRNA follicle cell of egg chamber development habituation messenger ribonucleoprotein complex assembly miRNA-mediated gene silencing by inhibition of translation miRNA-mediated post-transcriptional g...
cellular response to cholesterol cellular response to low-density lipoprotein particle stimulus cholesterol biosynthetic process cholesterol ester hydrolysis involved in cholesterol transport cholesterol homeostasis cholesterol metabolic process epithelial cell differentiation lipid catabolic process medium-chain fatty...
cytoplasm; cytosol; endoplasmic reticulum; endoplasmic reticulum lumen; lipid droplet
carboxylesterase activity carboxylic ester hydrolase activity methylumbelliferyl-acetate deacetylase activity sterol esterase activity
Homo sapiens
3D-structure Alternative splicing Cytoplasm Direct protein sequencing Disulfide bond Endoplasmic reticulum Glycoprotein Hydrolase Lipid droplet Lipid metabolism Phosphoprotein Reference proteome Serine esterase Signal
MWLRAFILAT
MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLG...
cellular response to cholesterol cellular response to low-density lipoprotein particle stimulus cholesterol biosynthetic process cholesterol ester hydrolysis involved in cholesterol transport cholesterol homeostasis cholesterol metabolic process epithelial cell differentiation lipid catabolic process medium-chain fatty...
blood coagulation, fibrin clot formation embryo implantation extracellular matrix organization negative regulation of cell adhesion negative regulation of cell motility negative regulation of ERK1 and ERK2 cascade negative regulation of protein phosphorylation negative regulation of stem cell proliferation negative reg...
basement membrane; collagen-containing extracellular matrix; elastic fiber; extracellular exosome; extracellular matrix; extracellular region; extracellular space
calcium ion binding extracellular matrix structural constituent fibrinogen binding fibronectin binding identical protein binding integrin binding peptidase activator activity protein-containing complex binding
Homo sapiens
Alternative splicing Calcium Chromosomal rearrangement Direct protein sequencing Disulfide bond EGF-like domain Extracellular matrix Glycoprotein Host-virus interaction Reference proteome Repeat Secreted Signal
MERAAPSRRV
MERAAPSRRVPLPLLLLGGLALLAAGVDADVLLEACCADGHRMATHQKDCSLPYATESKECRMVQEQCCHSQLEELHCATGISLANEQDRCATPHGDNASLEATFVKRCCHCCLLGRAAQAQGQSCEYSLMVGYQCGQVFQACCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYELTEDNSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCP...
blood coagulation, fibrin clot formation embryo implantation extracellular matrix organization negative regulation of cell adhesion negative regulation of cell motility negative regulation of ERK1 and ERK2 cascade negative regulation of protein phosphorylation negative regulation of stem cell proliferation negative reg...
adaptive immune response antigen processing and presentation antigen processing and presentation of exogenous peptide antigen via MHC class II antigen processing and presentation of peptide antigen negative regulation of T cell proliferation peptide antigen assembly with MHC class II protein complex positive regulation...
external side of plasma membrane; late endosome membrane; lysosomal membrane; lysosome; MHC class II protein complex; plasma membrane
MHC class II protein complex binding peptide antigen binding protein-containing complex binding
Mus musculus
Adaptive immunity Disulfide bond Glycoprotein Immunity Membrane MHC II Reference proteome Signal Transmembrane Transmembrane helix
RSRALILGVL
RSRALILGVLALTTMLSLCGGEDDIEADHVAFYGISVYQSPGDIGQYTFEFDGDELFYVDLDKKETVWMLPEFGQLTSFDPQGGLQEIATGKYNLEILIKDSNFTPAANEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTIFIIQGLRSGGTSRHPGPL
adaptive immune response antigen processing and presentation antigen processing and presentation of exogenous peptide antigen via MHC class II antigen processing and presentation of peptide antigen negative regulation of T cell proliferation peptide antigen assembly with MHC class II protein complex positive regulation...
homologous chromosome pairing at meiosis meiotic DNA double-strand break formation meiotic DNA double-strand break processing reciprocal meiotic recombination sporulation resulting in formation of a cellular spore synaptonemal complex assembly
condensed nuclear chromosome; nuclear chromosome; nucleoplasm
ATP binding chromatin binding DNA binding DNA end binding DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity metal ion binding
Saccharomyces cerevisiae
Chromosome Direct protein sequencing DNA-binding Isomerase Magnesium Meiosis Metal-binding Nucleus Reference proteome Sporulation Topoisomerase
MALEGLRKKY
MALEGLRKKYKTRQELVKALTPKRRSIHLNSNGHSNGTPCSNADVLAHIKHFLSLAANSLEQHQQPISIVFQNKKKKGDTSSPDIHTTLDFPLNGPHLCTHQFKLKRCAILLNLLKVVMEKLPLGKNTTVRDIFYSNVELFQRQANVVQWLDVIRFNFKLSPRKSLNIIPAQKGLVYSPFPIDIYDNILTCENEPKMQKQTIFPGKPCLIPFFQDDAVIKLGTTSMCNIVIVEKEAVFTKLVNNYHKLSTNTMLITGKGFPDFLTRLFLKKLEQYCSKLISDCSIFTDADPYGISIALNYTHSNERNAYICTMANYKGIR...
homologous chromosome pairing at meiosis meiotic DNA double-strand break formation meiotic DNA double-strand break processing reciprocal meiotic recombination sporulation resulting in formation of a cellular spore synaptonemal complex assembly condensed nuclear chromosome; nuclear chromosome; nucleoplasm ATP binding ch...
blastocyst formation cytokine precursor processing dibasic protein processing negative regulation of low-density lipoprotein particle receptor catabolic process negative regulation of transforming growth factor beta1 production nerve growth factor production peptide biosynthetic process peptide hormone processing posit...
cell surface; early endosome; endoplasmic reticulum; endoplasmic reticulum lumen; endoplasmic reticulum membrane; endosome membrane; extracellular region; Golgi cisterna; Golgi membrane; membrane; membrane raft; plasma membrane; trans-Golgi network; trans-Golgi network transport vesicle; trans-Golgi network transport v...
endopeptidase activity heparan sulfate binding heparin binding metal ion binding nerve growth factor binding peptidase activity peptide binding protease binding serine-type endopeptidase activity serine-type endopeptidase inhibitor activity serine-type peptidase activity
Mus musculus
3D-structure Autocatalytic cleavage Calcium Cell membrane Cleavage on pair of basic residues Disulfide bond Endosome Glycoprotein Golgi apparatus Heparin-binding Hydrolase Membrane Metal-binding Phosphoprotein Protease Reference proteome Repeat Secreted Serine protease Signal Transmembrane Transmembrane helix Zymogen
MELRSWLLWV
MELRSWLLWVVAAAGAVVLLAADAQGQKIFTNTWAVHIPGGPAVADRVAQKHGFHNLGQIFGDYYHFWHRAVTKRSLSPHRPRHSRLQREPQVKWLEQQVAKRRAKRDVYQEPTDPKFPQQWYLSGVTQRDLNVKEAWAQGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSA...
blastocyst formation cytokine precursor processing dibasic protein processing negative regulation of low-density lipoprotein particle receptor catabolic process negative regulation of transforming growth factor beta1 production nerve growth factor production peptide biosynthetic process peptide hormone processing posit...
DNA-templated transcription positive regulation of transcription by RNA polymerase II transcription by RNA polymerase II transcription elongation by RNA polymerase II
nucleolus; nucleoplasm; nucleus; transcription factor TFIID complex
DNA binding zinc ion binding
Homo sapiens
3D-structure Acetylation Alternative splicing Chromosomal rearrangement Direct protein sequencing DNA-binding Isopeptide bond Metal-binding Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation Ubl conjugation Zinc Zinc-finger
MEDEVVRFAK
MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLDGPSTEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDETNARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC
DNA-templated transcription positive regulation of transcription by RNA polymerase II transcription by RNA polymerase II transcription elongation by RNA polymerase II nucleolus; nucleoplasm; nucleus; transcription factor TFIID complex DNA binding zinc ion binding Homo sapiens 3D-structure Acetylation Alternative splici...
base-excision repair DNA demethylation DNA recombination DNA repair regulation of apoptotic process regulation of mRNA stability
cytoplasm; endoplasmic reticulum; mitochondrion; nuclear speck; nucleolus; nucleoplasm; nucleus; perinuclear region of cytoplasm
3'-5' exonuclease activity chromatin DNA binding class II DNA-(apurinic or apyrimidinic site) endonuclease activity damaged DNA binding DNA binding DNA-(abasic site) binding DNA-(apurinic or apyrimidinic site) endonuclease activity double-stranded DNA 3'-5' DNA exonuclease activity metal ion binding oxidoreductase acti...
Bos taurus
Acetylation Activator Cleavage on pair of basic residues Cytoplasm Direct protein sequencing Disulfide bond DNA damage DNA recombination DNA repair DNA-binding Endonuclease Endoplasmic reticulum Exonuclease Hydrolase Magnesium Metal-binding Mitochondrion Nuclease Nucleus Phosphoprotein Reference proteome Repressor RNA-...
MPKRGKKGAV
MPKRGKKGAVVEDAEEPKTEPEAKKSKAGAKKNEKEAVGEGAVLYEDPPDQKTSPSGKSATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPVELQELSGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEYDAFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLTDSFRHLYPNTAYAYTFWTYMMNARSKNVGWRLDYFLLSQSVLPALCDSKIRSKALGSDHCPITLYLAL
base-excision repair DNA demethylation DNA recombination DNA repair regulation of apoptotic process regulation of mRNA stability cytoplasm; endoplasmic reticulum; mitochondrion; nuclear speck; nucleolus; nucleoplasm; nucleus; perinuclear region of cytoplasm 3'-5' exonuclease activity chromatin DNA binding class II DNA-...
chromatin organization DNA damage response heterochromatin formation negative regulation of DNA-templated transcription negative regulation of transcription by RNA polymerase II rhythmic process
chromatin; chromatin lock complex; chromocenter; chromosome, centromeric region; condensed chromosome, centromeric region; euchromatin; heterochromatin; nuclear envelope; nucleoplasm; nucleus; pericentric heterochromatin; RNA polymerase II transcription regulator complex; senescence-associated heterochromatin focus; si...
chromatin binding DNA-binding transcription factor binding enzyme binding histone methyltransferase binding identical protein binding methylated histone binding protein domain specific binding transcription cis-regulatory region binding transcription coregulator binding
Mus musculus
Acetylation Biological rhythms Chromatin regulator Direct protein sequencing Isopeptide bond Nucleus Phosphoprotein Reference proteome Repeat Repressor Transcription Transcription regulation Ubl conjugation
MASNKTTLQK
MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEDFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ
chromatin organization DNA damage response heterochromatin formation negative regulation of DNA-templated transcription negative regulation of transcription by RNA polymerase II rhythmic process chromatin; chromatin lock complex; chromocenter; chromosome, centromeric region; condensed chromosome, centromeric region; eu...
negative regulation of transcription by transcription factor localization nitrate assimilation protein urmylation regulation of nitrogen utilization
cytoplasm
glutathione peroxidase activity phosphoprotein binding transcription corepressor activity
Saccharomyces cerevisiae
3D-structure Acetylation Amyloid Cytoplasm Nitrate assimilation Oxidoreductase Prion Reference proteome
MMNNNGNQVS
MMNNNGNQVSNLSNALRQVNIGNRNSNTTTDQSNINFEFSTGVNNNNNNNSSSNNNNVQNNNSGRNGSQNNDNENNIKNTLEQHRQQQQAFSDMSHVEYSRITKFFQEQPLEGYTLFSHRSAPNGFKVAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIWESGAILLHLVNKYYKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFRYFHSQKIASAVERYTDEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWLVGDKLTIADLAFVPWNNVV...
negative regulation of transcription by transcription factor localization nitrate assimilation protein urmylation regulation of nitrogen utilization cytoplasm glutathione peroxidase activity phosphoprotein binding transcription corepressor activity Saccharomyces cerevisiae 3D-structure Acetylation Amyloid Cytoplasm Ni...
cyclooxygenase pathway prostaglandin biosynthetic process regulation of blood pressure regulation of cell population proliferation response to oxidative stress
cytoplasm; endoplasmic reticulum membrane; extracellular exosome; Golgi apparatus; intracellular membrane-bounded organelle; neuron projection; photoreceptor outer segment
heme binding metal ion binding oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen peroxidase activity prostaglandin-endoperoxide synthase activity
Homo sapiens
3D-structure Alternative splicing Dioxygenase Disulfide bond EGF-like domain Endoplasmic reticulum Fatty acid biosynthesis Fatty acid metabolism Glycoprotein Heme Iron Lipid biosynthesis Lipid metabolism Membrane Metal-binding Microsome Oxidoreductase Peroxidase Prostaglandin biosynthesis Prostaglandin metabolism Refer...
MSRSLLLWFL
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHP...
cyclooxygenase pathway prostaglandin biosynthetic process regulation of blood pressure regulation of cell population proliferation response to oxidative stress cytoplasm; endoplasmic reticulum membrane; extracellular exosome; Golgi apparatus; intracellular membrane-bounded organelle; neuron projection; photoreceptor ou...
activation of innate immune response alternative mRNA splicing, via spliceosome chromatin remodeling double-strand break repair via homologous recombination innate immune response mRNA processing negative regulation of circadian rhythm negative regulation of DNA-templated transcription negative regulation of transcript...
chromatin; cytosol; nuclear matrix; nuclear speck; nucleoplasm; nucleus; paraspeckles; RNA polymerase II transcription regulator complex
chromatin binding DNA binding histone deacetylase binding protein homodimerization activity RNA binding transcription cis-regulatory region binding
Homo sapiens
3D-structure Acetylation Activator Alternative splicing Biological rhythms Chromosomal rearrangement Coiled coil Cytoplasm Direct protein sequencing DNA damage DNA recombination DNA repair DNA-binding Immunity Innate immunity Isopeptide bond Methylation mRNA processing mRNA splicing Nucleus Phosphoprotein Reference pro...
MSRDRFRSRG
MSRDRFRSRGGGGGGFHRRGGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPIPPPPPHQQQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPAPGVGSAPPASSSAPPATPPTSGAPPGSGPGPTPTPPPAVTSAPPGAPPPTPPSSGVPTTPPQAGGPPPPPAAVPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGEPRGGRQHHPPYHQQHHQGPPPGGPGGRSEEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKY...
activation of innate immune response alternative mRNA splicing, via spliceosome chromatin remodeling double-strand break repair via homologous recombination innate immune response mRNA processing negative regulation of circadian rhythm negative regulation of DNA-templated transcription negative regulation of transcript...
3'-UTR-mediated mRNA destabilization defense response to virus miRNA-mediated gene silencing by mRNA destabilization miRNA-mediated post-transcriptional gene silencing positive regulation of mRNA catabolic process regulation of neuron projection arborization regulatory ncRNA-mediated post-transcriptional gene silencing...
cytoplasmic ribonucleoprotein granule; cytoplasmic stress granule; cytosol; nucleus; P granule; P-body
5'-3' RNA helicase activity ATP binding ATP hydrolysis activity RNA binding
Mus musculus
Acetylation ATP-binding Cytoplasm Helicase Hydrolase Nucleotide-binding Nucleus Phosphoprotein Reference proteome RNA-binding RNA-mediated gene silencing Ubl conjugation
MPSKFSCRKL
MPSKFSCRKLRETGQRFESFLAERGLDLETDRERLRTIYNHDFKPSYGTPAPGFSSMLYGMKIANLAFVTKTRVRFFKLDRWADVQLPEKRRIKPGSNISKQHRSLLARIFHDRAEYLHGKHGVDVEVQGPHEARDGQLLIHLDLNRKEVLTLRLRNGGSKPVTLTHLFPLCWTPQFVFYHGEQDLPCPLGPGESYELHIYCKTSIVGYFPATVLWELLGPGESGAEGAETFYIARFLAAVAHSPLAAQLKPTTPFKRPPRLTRNSVLTNRIEEGERPDRAKGYELELSLALGTYYPPILLRQLLPTLLQGPSIFTAPKE...
3'-UTR-mediated mRNA destabilization defense response to virus miRNA-mediated gene silencing by mRNA destabilization miRNA-mediated post-transcriptional gene silencing positive regulation of mRNA catabolic process regulation of neuron projection arborization regulatory ncRNA-mediated post-transcriptional gene silencing...
pentose-phosphate shunt
cytoplasm; cytosol
metal ion binding transketolase activity
Saccharomyces cerevisiae
3D-structure Calcium Direct protein sequencing Isopeptide bond Magnesium Metal-binding Phosphoprotein Reference proteome Thiamine pyrophosphate Transferase Ubl conjugation
MTQFTDIDKL
MTQFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNLIAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDKPTLIKMTTTIGYGSLHAGSHSVHGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKLFSEYQ...
pentose-phosphate shunt cytoplasm; cytosol metal ion binding transketolase activity Saccharomyces cerevisiae 3D-structure Calcium Direct protein sequencing Isopeptide bond Magnesium Metal-binding Phosphoprotein Reference proteome Thiamine pyrophosphate Transferase Ubl conjugation MTQFTDIDKL MTQFTDIDKLAVSTIRILAVDTVSKAN...
centriole-centriole cohesion centrosome cycle cytoplasmic microtubule organization meiotic spindle organization microtubule nucleation mitotic cell cycle mitotic sister chromatid segregation mitotic sister chromatid separation mitotic spindle organization regulation of cell cycle
centrosome; cytoplasm; gamma-tubulin complex; gamma-tubulin ring complex; gamma-tubulin small complex; microtubule; nucleus; pericentriolar material; spindle
GTP binding guanyl nucleotide binding structural constituent of cytoskeleton
Drosophila melanogaster
Cytoplasm Cytoskeleton GTP-binding Microtubule Nucleotide-binding Reference proteome
MPSEIITLQL
MPSEIITLQLGQCGNQIGFEFWKRLCLEHGISPSGVLEDFANDGLDRKDVFFYQADDDHYIPRAVLLDLEPRVINTIMGSVYSKLYNPENVYLSKHGGGAGNNWASGYSQGEKLQEEVFDIIDREADGSDSLEGFILCHSIAGGTGSGMGSFIMERLADRYPKKLIQTFSVFPNQDEISDVVVQPYNSMLTLKRLTTAADSVVVLDNTALNRIACDRLHIQNPSFSQINNLVSTIMSVSTTTLRYPSYMNNNLIGLTAPLIPTPQLHFLMTGYTPLTSDSDIHTQQLVNVRKTTVLDVMRRLLQPKNMMVSTGPDKSNHH...
centriole-centriole cohesion centrosome cycle cytoplasmic microtubule organization meiotic spindle organization microtubule nucleation mitotic cell cycle mitotic sister chromatid segregation mitotic sister chromatid separation mitotic spindle organization regulation of cell cycle centrosome; cytoplasm; gamma-tubulin co...
cytoplasmic microtubule organization meiotic spindle organization microtubule cytoskeleton organization microtubule nucleation mitotic cell cycle mitotic sister chromatid segregation mitotic spindle organization
apical part of cell; cell leading edge; centriole; centrosome; ciliary basal body; condensed nuclear chromosome; cytoplasm; cytoplasmic microtubule; cytosol; gamma-tubulin complex; microtubule; mitotic spindle microtubule; neuron projection; non-motile cilium; nucleus; pericentriolar material; polar microtubule; recycl...
GTP binding identical protein binding structural constituent of cytoskeleton
Homo sapiens
3D-structure Cytoplasm Cytoskeleton Disease variant GTP-binding Lissencephaly Microtubule Nucleotide-binding Phosphoprotein Reference proteome
MPREIITLQL
MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAI...
cytoplasmic microtubule organization meiotic spindle organization microtubule cytoskeleton organization microtubule nucleation mitotic cell cycle mitotic sister chromatid segregation mitotic spindle organization apical part of cell; cell leading edge; centriole; centrosome; ciliary basal body; condensed nuclear chromos...
detection of chemical stimulus involved in sensory perception detection of chemical stimulus involved in sensory perception of smell G protein-coupled receptor signaling pathway sensory perception of smell
cell cortex; endoplasmic reticulum membrane; membrane; plasma membrane
G protein-coupled receptor activity odorant binding olfactory receptor activity
Mus musculus
Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Membrane Olfaction Receptor Reference proteome Sensory transduction Transducer Transmembrane Transmembrane helix
MEVDSNSSSG
MEVDSNSSSGSFILMGVSDHPHLEIIFFAVILASYLLTLVGNLTIILLSRLDARLHTPMYFFLSNLSSLDLAFTTSSVPQMLKNLWGPDKTISYGGCVTQLYVFLWLGATECILLVVMAFDRYVAVCRPLHYMTVMNPRLCWGLAAISWLGGLGNSVIQSTFTLQLPFCGHRKVDNFLCEVPAMIKLACGDTSLNEAVLNGVCTFFTVVPVSVILVSYCFIAQAVMKIRSVEGRRKAFNTCVSHLVVVFLFYGSAIYGYLLPAKSSNQSQGKFISLFYSVVTPMVNPLIYTLRNKEVKGALGRLLGKGRGAS
detection of chemical stimulus involved in sensory perception detection of chemical stimulus involved in sensory perception of smell G protein-coupled receptor signaling pathway sensory perception of smell cell cortex; endoplasmic reticulum membrane; membrane; plasma membrane G protein-coupled receptor activity odorant...
establishment of localization in cell intracellular calcium ion homeostasis intracellular magnesium ion homeostasis myelination negative regulation of potassium ion transmembrane transport potassium ion transmembrane transport protein processing regulation of axon diameter regulation of cell size skeletal muscle fiber ...
cytosol; Golgi apparatus; membrane; nucleoplasm; plasma membrane
metal ion binding metalloendopeptidase activity
Homo sapiens
Blood group antigen Cell membrane Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Membrane Metal-binding Metalloprotease Phosphoprotein Protease Reference proteome Signal-anchor Transmembrane Transmembrane helix Zinc
MEGGDQSEEE
MEGGDQSEEEPRERSQAGGMGTLWSQESTPEERLPVEGSRPWAVARRVLTAILILGLLLCFSVLLFYNFQNCGPRPCETSVCLDLRDHYLASGNTSVAPCTDFFSFACGRAKETNNSFQELATKNKNRLRRILEVQNSWHPGSGEEKAFQFYNSCMDTLAIEAAGTGPLRQVIEELGGWRISGKWTSLNFNRTLRLLMSQYGHFPFFRAYLGPHPASPHTPVIQIDQPEFDVPLKQDQEQKIYAQIFREYLTYLNQLGTLLGGDPSKVQEHSSLSISITSRLFQFLRPLEQRRAQGKLFQMVTIDQLKEMAPAIDWLSCL...
establishment of localization in cell intracellular calcium ion homeostasis intracellular magnesium ion homeostasis myelination negative regulation of potassium ion transmembrane transport potassium ion transmembrane transport protein processing regulation of axon diameter regulation of cell size skeletal muscle fiber ...
detection of chemical stimulus involved in sensory perception of bitter taste one-carbon metabolic process
cytosol; extracellular exosome; extracellular region; extracellular space
carbonate dehydratase activity zinc ion binding
Homo sapiens
3D-structure Alternative splicing Disulfide bond Glycoprotein Lyase Metal-binding Reference proteome Secreted Signal Zinc
MRALVLLLSL
MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN
detection of chemical stimulus involved in sensory perception of bitter taste one-carbon metabolic process cytosol; extracellular exosome; extracellular region; extracellular space carbonate dehydratase activity zinc ion binding Homo sapiens 3D-structure Alternative splicing Disulfide bond Glycoprotein Lyase Metal-bind...
bone development chaperone-mediated protein folding neutrophil chemotaxis positive regulation by host of viral genome replication positive regulation by host of viral process positive regulation of multicellular organism growth protein folding protein peptidyl-prolyl isomerization protein stabilization
cytoplasm; cytosol; endoplasmic reticulum; endoplasmic reticulum chaperone complex; endoplasmic reticulum lumen; extracellular exosome; focal adhesion; intracellular membrane-bounded organelle; melanosome; membrane; nucleoplasm; nucleus; perinuclear region of cytoplasm; protein-containing complex; smooth endoplasmic re...
cyclosporin A binding peptidyl-prolyl cis-trans isomerase activity RNA binding RNA polymerase binding unfolded protein binding
Homo sapiens
3D-structure Acetylation Direct protein sequencing Disease variant Dwarfism Endoplasmic reticulum Glycoprotein Isomerase Osteogenesis imperfecta Reference proteome Rotamase S-nitrosylation Signal Virion
MLRLSERNMK
MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE
bone development chaperone-mediated protein folding neutrophil chemotaxis positive regulation by host of viral genome replication positive regulation by host of viral process positive regulation of multicellular organism growth protein folding protein peptidyl-prolyl isomerization protein stabilization cytoplasm; cytos...
calcineurin-mediated signaling cellular response to pheromone fungal-type cell wall organization intracellular monoatomic ion homeostasis positive regulation of DNA-templated transcription regulation of cell morphogenesis
calcineurin complex; cytoplasm
calmodulin binding calmodulin-dependent protein phosphatase activity metal ion binding myosin phosphatase activity
Saccharomyces cerevisiae
3D-structure Acetylation Calmodulin-binding Hydrolase Iron Metal-binding Protein phosphatase Reference proteome Zinc
MSKDLNSSRI
MSKDLNSSRIKIIKPNDSYIKVDRKKDLTKYELENGKVISTKDRPIASVPAITGKIPSDEEVFDSKTGLPNHSFLREHFFHEGRLSKEQAIKILNMSTVALSKEPNLLKLKAPITICGDIHGQYYDLLKLFEVGGDPAEIDYLFLGDYVDRGAFSFECLIYLYSLKLNNLGRFWMLRGNHECKHLTSYFTFKNEMLHKYDMEVYDACCRSFNVLPLAALMNGQYFCVHGGISPELKSVEDVNKINRFREIPSRGLMCDLLWADPVENYDDARDGSEFDQSEDEFVPNSLRGCSFAFTFKASCKFLKANGLLSIIRAHEAQ...
calcineurin-mediated signaling cellular response to pheromone fungal-type cell wall organization intracellular monoatomic ion homeostasis positive regulation of DNA-templated transcription regulation of cell morphogenesis calcineurin complex; cytoplasm calmodulin binding calmodulin-dependent protein phosphatase activit...
cell morphogenesis endocytosis glucose mediated signaling pathway phosphorylation response to glucose signal transduction
cell periphery; endoplasmic reticulum; mitochondrial membrane; mitochondrion; nucleus; plasma membrane
ATP binding protein kinase activity protein serine kinase activity protein serine/threonine kinase activity
Saccharomyces cerevisiae
3D-structure ATP-binding Cell membrane Kinase Lipoprotein Membrane Mitochondrion Nucleotide-binding Palmitate Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase
MSMPIASTTL
MSMPIASTTLAVNNLTNINGNANFNVQANKQLHHQAVDSPARSSMTATTAANSNSNSSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLAQGLPVQFGRYLEIVRSL...
cell morphogenesis endocytosis glucose mediated signaling pathway phosphorylation response to glucose signal transduction cell periphery; endoplasmic reticulum; mitochondrial membrane; mitochondrion; nucleus; plasma membrane ATP binding protein kinase activity protein serine kinase activity protein serine/threonine kin...
cell morphogenesis endocytosis glucose mediated signaling pathway phosphorylation response to glucose signal transduction
cell periphery; cellular bud neck; mating projection; nucleus; plasma membrane
ATP binding protein kinase activity protein serine kinase activity protein serine/threonine kinase activity
Saccharomyces cerevisiae
Acetylation ATP-binding Cell membrane Isopeptide bond Kinase Lipoprotein Membrane Nucleotide-binding Palmitate Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase Ubl conjugation
MSQVQSPLTA
MSQVQSPLTATNSGLAVNNNTMNSQMPNRSNVRLVNGTLPPSLHVSSNLNHNTGNSSASYSGSQSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDLAQGLPIQFGRY...
cell morphogenesis endocytosis glucose mediated signaling pathway phosphorylation response to glucose signal transduction cell periphery; cellular bud neck; mating projection; nucleus; plasma membrane ATP binding protein kinase activity protein serine kinase activity protein serine/threonine kinase activity Saccharomyc...
DNA-templated transcription phosphorylation positive regulation of transcription elongation by RNA polymerase II transcription elongation by RNA polymerase II
cyclin-dependent protein kinase holoenzyme complex; nucleus
ATP binding cyclin-dependent protein serine/threonine kinase activity protein serine kinase activity RNA polymerase II CTD heptapeptide repeat kinase activity
Saccharomyces cerevisiae
ATP-binding Kinase Nucleotide-binding Nucleus Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase
MSDNGSPAVL
MSDNGSPAVLPKTEFNKYKIGKVKSTPAIQRDAKTNLTYIKLRKRSSEKVYGCTVFQNHYREDEKLGQGTFGEVYKGIHLETQRQVAMKKIIVSVEKDLFPITAQREITILKRLNHKNIIKLIEMVYDHSPDITNAASSNLHKSFYMILPYMVADLSGVLHNPRINLEMCDIKNMMLQILEGLNYIHCAKFMHRDIKTANILIDHNGVLKLADFGLARLYYGCPPNLKYPGGAGSGAKYTSVVVTRWYRAPELVLGDKQYTTAVDIWGVGCVFAEFFEKKPILQGKTDIDQGHVIFKLLGTPTEEDWAVARYLPGAELTT...
DNA-templated transcription phosphorylation positive regulation of transcription elongation by RNA polymerase II transcription elongation by RNA polymerase II cyclin-dependent protein kinase holoenzyme complex; nucleus ATP binding cyclin-dependent protein serine/threonine kinase activity protein serine kinase activity ...
intracellular signal transduction positive regulation of nitric-oxide synthase activity positive regulation of sprouting angiogenesis regulation of heart contraction substantia nigra development
cytoplasm; cytosol; extracellular region; Golgi apparatus; mitochondrion; nucleoplasm; nucleus; protein-containing complex; sarcoplasmic reticulum
ATPase binding calcium ion binding calcium-dependent protein binding identical protein binding protein homodimerization activity S100 protein binding
Homo sapiens
3D-structure Calcium Cytoplasm Glutathionylation Metal-binding Mitochondrion Reference proteome Repeat S-nitrosylation Sarcoplasmic reticulum
MGSELETAME
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
intracellular signal transduction positive regulation of nitric-oxide synthase activity positive regulation of sprouting angiogenesis regulation of heart contraction substantia nigra development cytoplasm; cytosol; extracellular region; Golgi apparatus; mitochondrion; nucleoplasm; nucleus; protein-containing complex; s...
cell differentiation cellular response to amino acid starvation intracellular signal transduction negative regulation of glial cell apoptotic process negative regulation of translation positive regulation of B cell receptor signaling pathway positive regulation of glial cell proliferation positive regulation of keratin...
cell-cell junction; cytoplasm; cytosol; plasma membrane
ATP binding diacylglycerol-dependent, calcium-independent serine/threonine kinase activity enzyme binding metal ion binding protein kinase activity protein serine kinase activity protein serine/threonine kinase activity protein serine/threonine kinase binding protein serine/threonine kinase inhibitor activity small GTP...
Mus musculus
ATP-binding Cytoplasm Differentiation Kinase Metal-binding Nucleotide-binding Phosphoprotein Reference proteome Repeat Serine/threonine-protein kinase Transferase Zinc Zinc-finger
MSSGTMKFNG
MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTAGTSDTFEGWVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQVNGHKFMATYLRQPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDAKIAEQRFGINIPHKFNVHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAVELAKTLAGMGLQPGNISPTS...
cell differentiation cellular response to amino acid starvation intracellular signal transduction negative regulation of glial cell apoptotic process negative regulation of translation positive regulation of B cell receptor signaling pathway positive regulation of glial cell proliferation positive regulation of keratin...
cardiac muscle cell action potential involved in contraction cellular response to acidic pH cellular response to cAMP cellular response to light stimulus epithelial cell maturation heart contraction male gonad development membrane repolarization membrane repolarization during action potential membrane repolarization du...
apical plasma membrane; cell surface; membrane raft; plasma membrane; voltage-gated potassium channel complex; Z disc
delayed rectifier potassium channel activity potassium channel regulator activity protein-containing complex binding telethonin binding transmembrane transporter binding
Mus musculus
Cell membrane Direct protein sequencing Glycoprotein Ion channel Ion transport Membrane Phosphoprotein Potassium Potassium channel Potassium transport Reference proteome Transmembrane Transmembrane helix Transport Voltage-gated channel
MSLPNSTTVL
MSLPNSTTVLPFLARLWQETAEQGGNVSGLARKSQLRDDSKLEALYILMVLGFFGFFTLGIMLSYIRSKKLEHSHDPFNVYIESDAWQEKGKAVFQARVLESFRACYVIENQAAVEQPATHLPELKPLS
cardiac muscle cell action potential involved in contraction cellular response to acidic pH cellular response to cAMP cellular response to light stimulus epithelial cell maturation heart contraction male gonad development membrane repolarization membrane repolarization during action potential membrane repolarization du...
CAT tailing positive regulation of cytoplasmic translational elongation through polyproline stretches positive regulation of translational elongation positive regulation of translational initiation positive regulation of translational termination rescue of stalled ribosome translational elongation translational framesh...
cytoplasm; mitochondrion; perinuclear region of cytoplasm
ribosome binding RNA binding translation elongation factor activity translation initiation factor activity
Saccharomyces cerevisiae
3D-structure Acetylation Cytoplasm Direct protein sequencing Elongation factor Hypusine Isopeptide bond Phosphoprotein Protein biosynthesis Reference proteome RNA-binding Ubl conjugation
MSDEEHTFET
MSDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD
CAT tailing positive regulation of cytoplasmic translational elongation through polyproline stretches positive regulation of translational elongation positive regulation of translational initiation positive regulation of translational termination rescue of stalled ribosome translational elongation translational framesh...
photoinhibition photosynthesis, light reaction photosystem II assembly photosystem II stabilization regulation of protein dephosphorylation
apoplast; chloroplast; chloroplast stroma; chloroplast thylakoid; chloroplast thylakoid lumen; chloroplast thylakoid membrane; photosystem II oxygen evolving complex; plastid; plastid thylakoid membrane; plastoglobule; thylakoid; thylakoid lumen
mRNA binding oxygen evolving activity poly(U) RNA binding
Arabidopsis thaliana
3D-structure Chloroplast Direct protein sequencing Manganese Membrane Photosynthesis Photosystem II Plastid Reference proteome Thylakoid Transit peptide
MAASLQSTAT
MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTGKCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKD...
photoinhibition photosynthesis, light reaction photosystem II assembly photosystem II stabilization regulation of protein dephosphorylation apoplast; chloroplast; chloroplast stroma; chloroplast thylakoid; chloroplast thylakoid lumen; chloroplast thylakoid membrane; photosystem II oxygen evolving complex; plastid; plas...
muscle contraction positive regulation of heart contraction positive regulation of heart rate positive regulation of relaxation of cardiac muscle regulation of calcium ion transmembrane transport regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion regulation of cell communic...
endoplasmic reticulum lumen; sarcoplasmic reticulum lumen; sarcoplasmic reticulum membrane; Z disc
ATPase binding calcium ion binding transmembrane transporter binding
Homo sapiens
Calcium Phosphoprotein Reference proteome Repeat Sarcoplasmic reticulum Signal
MGHHRPWLHA
MGHHRPWLHASVLWAGVASLLLPPAMTQQLRGDGLGFRNRNNSTGVAGLSEEASAELRHHLHSPRDHPDENKDVSTENGHHFWSHPDREKEDEDVSKEYGHLLPGHRSQDHKVGDEGVSGEEVFAEHGGQARGHRGHGSEDTEDSAEHRHHLPSHRSHSHQDEDEDEVVSSEHHHHILRHGHRGHDGEDDEGEEEEEEEEEEEEASTEYGHQAHRHRGHGSEEDEDVSDGHHHHGPSHRHQGHEEDDDDDDDDDDDDDDDDVSIEYRHQAHRHQGHGIEEDEDVSDGHHHRDPSHRHRSHEEDDNDDDDVSTEYGHQAHR...
muscle contraction positive regulation of heart contraction positive regulation of heart rate positive regulation of relaxation of cardiac muscle regulation of calcium ion transmembrane transport regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion regulation of cell communic...
carbohydrate metabolic process lipid glycosylation protein glycosylation
Golgi apparatus; Golgi cisterna; Golgi cisterna membrane; vesicle
glycosyltransferase activity metal ion binding N-acetyllactosaminide 3-alpha-galactosyltransferase activity
Mus musculus
Alternative splicing Glycoprotein Glycosyltransferase Golgi apparatus Manganese Membrane Metal-binding Reference proteome Signal-anchor Transferase Transmembrane Transmembrane helix
MITMLQDLHV
MITMLQDLHVNKISMSRSKSETSLPSSRSGSQEKIMNVKGKVILLMLIVSTVVVVFWEYVNRIPEVGENRWQKDWWFPSWFKNGTHSYQEDNVEGRREKGRNGDRIEEPQLWDWFNPKNRPDVLTVTPWKAPIVWEGTYDTALLEKYYATQKLTVGLTVFAVGKYIEHYLEDFLESADMYFMVGHRVIFYVMIDDTSRMPVVHLNPLHSLQVFEIRSEKRWQDISMMRMKTIGEHILAHIQHEVDFLFCMDVDQVFQDNFGVETLGQLVAQLQAWWYKASPEKFTYERRELSAAYIPFGEGDFYYHAAIFGGTPTHILNL...
carbohydrate metabolic process lipid glycosylation protein glycosylation Golgi apparatus; Golgi cisterna; Golgi cisterna membrane; vesicle glycosyltransferase activity metal ion binding N-acetyllactosaminide 3-alpha-galactosyltransferase activity Mus musculus Alternative splicing Glycoprotein Glycosyltransferase Golgi ...
glycogen biosynthetic process
cytoplasm; mitochondrion
glycogen (starch) synthase activity
Saccharomyces cerevisiae
Allosteric enzyme Direct protein sequencing Glycogen biosynthesis Glycosyltransferase Phosphoprotein Reference proteome Transferase
MARDLQNHLL
MARDLQNHLLFEVATEVTNRVGGIYSVLKSKAPVTVAQYGDNYTLLGPLNKATYESEVEKLDWEDESIFPEELLPIQKTLMSMREKGVNFVYGNWLIEGAPRVILFELDSVRHFLNEWKADLWSLVGIPSPEHDHETNDAILLGYVVVWFLGEVSKLDSSHAIIGHFHEWLAGVALPLCRKKRIDVVTIFTTHATLLGRYLCAAGDVDFYNNLQYFDVDQEAGKRGIYHRYCIERAAAHTADVFTTVSQITALEAEHLLKRKPDGILPNGLNVVKFQAVHEFQNLHALKKDKINDFVRGHFHGCFDFDLDNTVYFFIAGR...
glycogen biosynthetic process cytoplasm; mitochondrion glycogen (starch) synthase activity Saccharomyces cerevisiae Allosteric enzyme Direct protein sequencing Glycogen biosynthesis Glycosyltransferase Phosphoprotein Reference proteome Transferase MARDLQNHLL MARDLQNHLLFEVATEVTNRVGGIYSVLKSKAPVTVAQYGDNYTLLGPLNKATYESEVEK...
axon guidance cell adhesion chemotaxis neuron differentiation
cell surface; extracellular matrix; extracellular region; extracellular space; plasma membrane
extracellular matrix structural constituent heparin binding serine-type endopeptidase inhibitor activity
Homo sapiens
3D-structure Cell adhesion Cell membrane Chemotaxis Disease variant Disulfide bond Glycoprotein Heparin-binding Hypogonadotropic hypogonadism Kallmann syndrome Membrane Protease inhibitor Reference proteome Repeat Secreted Serine protease inhibitor Signal
MVPGVPGAVL
MVPGVPGAVLTLCLWLAASSGCLAAGPGAAAARRLDESLSAGSVQRARCASRCLSLQITRISAFFQHFQNNGSLVWCQNHKQCSKCLEPCKESGDLRKHQCQSFCEPLFPKKSYECLTSCEFLKYILLVKQGDCPAPEKASGFAAACVESCEVDNECSGVKKCCSNGCGHTCQVPKTLYKGVPLKPRKELRFTELQSGQLEVKWSSKFNISIEPVIYVVQRRWNYGIHPSEDDATHWQTVAQTTDERVQLTDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSAPPAPANLRLANSTVNSDGSVTVTIVWDLPEE...
axon guidance cell adhesion chemotaxis neuron differentiation cell surface; extracellular matrix; extracellular region; extracellular space; plasma membrane extracellular matrix structural constituent heparin binding serine-type endopeptidase inhibitor activity Homo sapiens 3D-structure Cell adhesion Cell membrane Chem...
mismatch repair mismatch repair involved in maintenance of fidelity involved in DNA-dependent DNA replication nucleotide-excision repair, DNA duplex unwinding regulation of DNA recombination
mismatch repair complex; single-stranded DNA-dependent ATP-dependent DNA helicase complex
ATP binding ATP hydrolysis activity ATP-dependent DNA damage sensor activity DNA binding identical protein binding mismatched DNA binding
Escherichia coli
3D-structure ATP-binding DNA damage DNA repair Nucleotide-binding Reference proteome
MPIQVLPPQL
MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNGCGIKKDELALALARHATSKIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEAWQAYAEGRDMNVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWVADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHD...
mismatch repair mismatch repair involved in maintenance of fidelity involved in DNA-dependent DNA replication nucleotide-excision repair, DNA duplex unwinding regulation of DNA recombination mismatch repair complex; single-stranded DNA-dependent ATP-dependent DNA helicase complex ATP binding ATP hydrolysis activity ATP...
malate metabolic process pyruvate metabolic process regulation of NADP metabolic process
intracellular membrane-bounded organelle; mitochondrial matrix; mitochondrion
electron transfer activity malate dehydrogenase (decarboxylating) (NAD+) activity malate dehydrogenase (decarboxylating) (NADP+) activity malic enzyme activity metal ion binding NAD binding oxaloacetate decarboxylase activity
Homo sapiens
3D-structure Acetylation Allosteric enzyme Alternative splicing Direct protein sequencing Metal-binding Mitochondrion NAD Oxidoreductase Reference proteome Transit peptide
MLSRLRVVST
MLSRLRVVSTTCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIA...
malate metabolic process pyruvate metabolic process regulation of NADP metabolic process intracellular membrane-bounded organelle; mitochondrial matrix; mitochondrion electron transfer activity malate dehydrogenase (decarboxylating) (NAD+) activity malate dehydrogenase (decarboxylating) (NADP+) activity malic enzyme ac...
blastocyst formation cytokine precursor processing dibasic protein processing negative regulation of low-density lipoprotein particle receptor catabolic process negative regulation of transforming growth factor beta1 production nerve growth factor production peptide biosynthetic process peptide hormone processing posit...
cell surface; endoplasmic reticulum; endoplasmic reticulum membrane; endosome membrane; extracellular region; Golgi cisterna; Golgi membrane; membrane; membrane raft; plasma membrane; trans-Golgi network; trans-Golgi network transport vesicle
endopeptidase activity heparan sulfate binding heparin binding metal ion binding nerve growth factor binding peptidase activity peptide binding protease binding serine-type endopeptidase activity serine-type endopeptidase inhibitor activity serine-type peptidase activity
Rattus norvegicus
Autocatalytic cleavage Calcium Cell membrane Cleavage on pair of basic residues Disulfide bond Endosome Glycoprotein Golgi apparatus Heparin-binding Hydrolase Membrane Metal-binding Phosphoprotein Protease Reference proteome Repeat Secreted Serine protease Signal Transmembrane Transmembrane helix Zymogen
MELRPWLLWV
MELRPWLLWVVAAAGALVLLAAEARGQKIFTNTWAVHISGGPAVADSVARKHGFHNLGQIFGDYYHFWHRAVTKRSLSPHRPRHSRLQRVPQVKWLEQQVAKQRAKRDVYQEPTDPKFPQQWYLSGVTQRDLNVKEAWAQGFTGRGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSA...
blastocyst formation cytokine precursor processing dibasic protein processing negative regulation of low-density lipoprotein particle receptor catabolic process negative regulation of transforming growth factor beta1 production nerve growth factor production peptide biosynthetic process peptide hormone processing posit...
cellular response to leukemia inhibitory factor glycine catabolic process glycine decarboxylation via glycine cleavage system response to lipoic acid response to methylamine
glycine cleavage complex; mitochondrial matrix; mitochondrion; nucleoplasm; plasma membrane
electron transfer activity glycine binding glycine dehydrogenase (decarboxylating) activity lyase activity protein homodimerization activity pyridoxal binding pyridoxal phosphate binding
Homo sapiens
3D-structure Acetylation Disease variant Mitochondrion Oxidoreductase Pyridoxal phosphate Reference proteome Transit peptide
MQSCARAWGL
MQSCARAWGLRLGRGVGGGRRLAGGSGPCWAPRSRDSSSGGGDSAAAGASRLLERLLPRHDDFARRHIGPGDKDQREMLQTLGLASIDELIEKTVPANIRLKRPLKMEDPVCENEILATLHAISSKNQIWRSYIGMGYYNCSVPQTILRNLLENSGWITQYTPYQPEVSQGRLESLLNYQTMVCDITGLDMANASLLDEGTAAAEALQLCYRHNKRRKFLVDPRCHPQTIAVVQTRAKYTGVLTELKLPCEMDFSGKDVSGVLFQYPDTEGKVEDFTELVERAHQSGSLACCATDLLALCILRPPGEFGVDIALGSSQRF...
cellular response to leukemia inhibitory factor glycine catabolic process glycine decarboxylation via glycine cleavage system response to lipoic acid response to methylamine glycine cleavage complex; mitochondrial matrix; mitochondrion; nucleoplasm; plasma membrane electron transfer activity glycine binding glycine deh...
dsRNA transport proton transmembrane transport vacuolar acidification
fusome; plasma membrane proton-transporting V-type ATPase complex; vacuolar proton-transporting V-type ATPase, V0 domain
proton-transporting ATPase activity, rotational mechanism
Drosophila melanogaster
Hydrogen ion transport Ion transport Membrane Reference proteome Transmembrane Transmembrane helix Transport
MSSEVSSDNP
MSSEVSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK
dsRNA transport proton transmembrane transport vacuolar acidification fusome; plasma membrane proton-transporting V-type ATPase complex; vacuolar proton-transporting V-type ATPase, V0 domain proton-transporting ATPase activity, rotational mechanism Drosophila melanogaster Hydrogen ion transport Ion transport Membrane R...
angiogenesis negative regulation of cell population proliferation negative regulation of protein kinase activity positive regulation of gene expression positive regulation of protein-containing complex assembly regulation of angiogenesis translation tryptophanyl-tRNA aminoacylation
cytoplasm; cytosol; extracellular exosome; nucleus; protein-containing complex
ATP binding kinase inhibitor activity protein domain specific binding protein homodimerization activity protein kinase binding tryptophan-tRNA ligase activity
Homo sapiens
3D-structure Alternative splicing Aminoacyl-tRNA synthetase Angiogenesis ATP-binding Cytoplasm Direct protein sequencing Disease variant Intellectual disability Ligase Neurodegeneration Neuropathy Nucleotide-binding Phosphoprotein Protein biosynthesis Reference proteome
MPNSEPASLL
MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMT...
angiogenesis negative regulation of cell population proliferation negative regulation of protein kinase activity positive regulation of gene expression positive regulation of protein-containing complex assembly regulation of angiogenesis translation tryptophanyl-tRNA aminoacylation cytoplasm; cytosol; extracellular exo...
immune response necroptotic signaling pathway positive regulation of NF-kappaB transcription factor activity regulation of biological quality regulation of developmental process regulation of multicellular organismal process regulation of secretion vascular endothelial growth factor production
extracellular space; plasma membrane
cytokine activity tumor necrosis factor receptor binding
Ovis aries
Cell membrane Cytokine Disulfide bond Glycoprotein Lipoprotein Membrane Myristate Phosphoprotein Reference proteome Secreted Signal-anchor Transmembrane Transmembrane helix
MSTKSMIRDV
MSTKSMIRDVELAEEVLSNKAGGPQGSRSCWCLSLFSFLLVAGATTLFCLLHFGVIGPQREEQSPAGPSFNRPLVQTLRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL
immune response necroptotic signaling pathway positive regulation of NF-kappaB transcription factor activity regulation of biological quality regulation of developmental process regulation of multicellular organismal process regulation of secretion vascular endothelial growth factor production extracellular space; plas...
mRNA 5'-splice site recognition mRNA splicing, via spliceosome
catalytic step 2 spliceosome; cytoplasm; nucleus; spliceosomal complex; U4/U6 x U5 tri-snRNP complex; U5 snRNP
ATP binding ATP hydrolysis activity first spliceosomal transesterification activity RNA binding RNA helicase activity
Saccharomyces cerevisiae
3D-structure ATP-binding Cytoplasm Helicase Hydrolase mRNA processing mRNA splicing Nucleotide-binding Nucleus Phosphoprotein Reference proteome
MARPIDVSQL
MARPIDVSQLIAGINKKKGLDENTSGKISKPRFLNKQERSKQERLKENEESLTPTQSDSAKVEIKKVNSRDDSFFNETNDKKRNPSKQNGSKFHFSWNESEDTLSGYDPIVSTRAIDLLWKGKTPKNAAESSYMGKHWTEKSLHEMNERDWRILKEDYAIVTKGGTVENPLRNWEELNIIPRDLLRVIIQELRFPSPTPIQRITIPNVCNMKQYRDFLGVASTGSGKTLAFVIPILIKMSRSPPRPPSLKIIDGPKALILAPTRELVQQIQKETQKVTKIWSKESNYDCKVISIVGGHSLEEISFSLSEGCDILVATPGR...
mRNA 5'-splice site recognition mRNA splicing, via spliceosome catalytic step 2 spliceosome; cytoplasm; nucleus; spliceosomal complex; U4/U6 x U5 tri-snRNP complex; U5 snRNP ATP binding ATP hydrolysis activity first spliceosomal transesterification activity RNA binding RNA helicase activity Saccharomyces cerevisiae 3D...
muscle cell fate commitment muscle tissue morphogenesis negative regulation of DNA-templated transcription positive regulation of myoblast differentiation positive regulation of skeletal muscle fiber development positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II s...
chromatin; cytosol; mitotic spindle; nucleoplasm; nucleus; RNA polymerase II transcription regulator complex
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific protein dimerization activity RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific double-stranded D...
Homo sapiens
Developmental protein Differentiation Disease variant DNA-binding Myogenesis Nucleus Reference proteome
MMMDLFETGS
MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVVEK
muscle cell fate commitment muscle tissue morphogenesis negative regulation of DNA-templated transcription positive regulation of myoblast differentiation positive regulation of skeletal muscle fiber development positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II s...
acrosome reaction adult walking behavior cellular response to amino acid stimulus cellular response to ethanol cellular response to zinc ion chloride transmembrane transport chloride transport inhibitory postsynaptic potential monoatomic ion transport muscle contraction negative regulation of transmission of nerve impu...
chloride channel complex; dendrite; external side of plasma membrane; glycinergic synapse; inhibitory synapse; intracellular membrane-bounded organelle; membrane; neuron projection; neuronal cell body; perikaryon; plasma membrane; postsynaptic membrane; synapse
extracellularly glycine-gated chloride channel activity glycine binding identical protein binding ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential taurine binding transmembrane signaling receptor activity transmitter-gated monoatomic ion channel activity involved in ...
Homo sapiens
3D-structure Alternative splicing Cell membrane Cell projection Chloride Chloride channel Disease variant Disulfide bond Glycoprotein Ion channel Ion transport Ligand-gated ion channel Membrane Metal-binding Postsynaptic cell membrane Receptor Reference proteome Signal Synapse Transmembrane Transmembrane helix Transpor...
MYSFNTLRLY
MYSFNTLRLYLWETIVFFSLAASKEAEAARSAPKPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYPDDSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLL...
acrosome reaction adult walking behavior cellular response to amino acid stimulus cellular response to ethanol cellular response to zinc ion chloride transmembrane transport chloride transport inhibitory postsynaptic potential monoatomic ion transport muscle contraction negative regulation of transmission of nerve impu...
cellular response to amino acid stimulus cellular response to ethanol cellular response to zinc ion chloride transmembrane transport monoatomic ion transmembrane transport neuropeptide signaling pathway response to amino acid
chloride channel complex; glycinergic synapse; intracellular membrane-bounded organelle; neuron projection; plasma membrane; postsynaptic membrane; synapse
extracellularly glycine-gated chloride channel activity glycine binding glycine-gated chloride ion channel activity metal ion binding transmembrane signaling receptor activity transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
Homo sapiens
3D-structure Alternative splicing Cell membrane Cell projection Chloride Chloride channel Disease variant Disulfide bond Glycoprotein Intellectual disability Ion channel Ion transport Ligand-gated ion channel Membrane Metal-binding Postsynaptic cell membrane Receptor Reference proteome Signal Synapse Transmembrane Tran...
MNRQLVNILT
MNRQLVNILTALFAFFLETNHFRTAFCKDHDSRSGKQPSQTLSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIW...
cellular response to amino acid stimulus cellular response to ethanol cellular response to zinc ion chloride transmembrane transport monoatomic ion transmembrane transport neuropeptide signaling pathway response to amino acid chloride channel complex; glycinergic synapse; intracellular membrane-bounded organelle; neuro...
glycine catabolic process glycine decarboxylation via glycine cleavage system protein lipoylation
cytoplasm; glycine cleavage complex; mitochondrial matrix; mitochondrion
aminomethyltransferase activity
Homo sapiens
Disease variant Lipoyl Mitochondrion Neurodegeneration Reference proteome Transit peptide
MALRVVRSVR
MALRVVRSVRALLCTLRAVPSPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
glycine catabolic process glycine decarboxylation via glycine cleavage system protein lipoylation cytoplasm; glycine cleavage complex; mitochondrial matrix; mitochondrion aminomethyltransferase activity Homo sapiens Disease variant Lipoyl Mitochondrion Neurodegeneration Reference proteome Transit peptide MALRVVRSVR MAL...
cerebellar granule cell differentiation chemical synaptic transmission establishment of localization in cell heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules maintenance of synapse structure negative regulation of excitatory postsynaptic potential negative regulation of inhibitory synapse ass...
collagen-containing extracellular matrix; extracellular region; glutamatergic synapse; parallel fiber to Purkinje cell synapse; postsynaptic membrane; synaptic cleft
identical protein binding
Homo sapiens
3D-structure Cell membrane Direct protein sequencing Disulfide bond Glycoprotein Membrane Postsynaptic cell membrane Reference proteome Secreted Sialic acid Signal Synapse
MLGVLELLLL
MLGVLELLLLGAAWLAGPARGQNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPL
cerebellar granule cell differentiation chemical synaptic transmission establishment of localization in cell heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules maintenance of synapse structure negative regulation of excitatory postsynaptic potential negative regulation of inhibitory synapse ass...
entrainment of circadian clock by photoperiod retina development in camera-type eye signal transduction visual perception
photoreceptor disc membrane; photoreceptor outer segment membrane
3',5'-cyclic-GMP phosphodiesterase activity 3',5'-cyclic-nucleotide phosphodiesterase activity metal ion binding
Bos taurus
3D-structure Acetylation Cell projection cGMP Hydrolase Lipoprotein Membrane Metal-binding Methylation Prenylation Reference proteome Repeat Sensory transduction Vision
MSLSEGQVHR
MSLSEGQVHRFLDQNPGFADQYFGRKLSPEDVANACEDGCPEGCTSFRELCQVEESAALFELVQDMQENVNMERVVFKILRRLCSILHADRCSLFMYRQRNGVAELATRLFSVQPDSVLEDCLVPPDSEIVFPLDIGVVGHVAQTKKMVNVQDVMECPHFSSFADELTDYVTRNILATPIMNGKDVVAVIMAVNKLDGPCFTSEDEDVFLKYLNFGTLNLKIYHLSYLHNCETRRGQVLLWSANKVFEELTDIERQFHKAFYTVRAYLNCDRYSVGLLDMTKEKEFFDVWPVLMGEAQAYSGPRTPDGREILFYKVIDYI...
entrainment of circadian clock by photoperiod retina development in camera-type eye signal transduction visual perception photoreceptor disc membrane; photoreceptor outer segment membrane 3',5'-cyclic-GMP phosphodiesterase activity 3',5'-cyclic-nucleotide phosphodiesterase activity metal ion binding Bos taurus 3D-struc...
detection of light stimulus entrainment of circadian clock by photoperiod retina development in camera-type eye retinal cell apoptotic process signal transduction visual perception
photoreceptor outer segment; photoreceptor outer segment membrane; plasma membrane
3',5'-cyclic-GMP phosphodiesterase activity 3',5'-cyclic-nucleotide phosphodiesterase activity metal ion binding
Mus musculus
Acetylation Alternative splicing Cell projection cGMP Hydrolase Lipoprotein Magnesium Manganese Membrane Metal-binding Prenylation Reference proteome Repeat Sensory transduction Vision Zinc
MSLSEEQVRS
MSLSEEQVRSFLDGNPTFAHQYFGKKLSPENVAGACEDGWLADCGSLRELCQVEESAALFELVQDMQESVNMERVVFKILRRLCTILHADRCSLFMYRQRNGIAELATRLFSVQPDSLLEDCLVPPDSEIVFPLDIGIVGHVAQTKKMINVQDVAECPHFSSFADELTDYVTKNILSTPIMNGKDVVAVIMAVNKLDGPCFTSEDEDVFTKYLNFATLNLKIYHLSYLHNCETRRGQVLLWSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDMTKEKEFFDVWPVLMGEAQPYSGPRTPDGREIVFYKVIDYI...
detection of light stimulus entrainment of circadian clock by photoperiod retina development in camera-type eye retinal cell apoptotic process signal transduction visual perception photoreceptor outer segment; photoreceptor outer segment membrane; plasma membrane 3',5'-cyclic-GMP phosphodiesterase activity 3',5'-cyclic...
daunorubicin metabolic process doxorubicin metabolic process hippocampus development progesterone metabolic process prostaglandin metabolic process steroid metabolic process
cytosol
alditol:NADP+ 1-oxidoreductase activity androsterone dehydrogenase (B-specific) activity androsterone dehydrogenase activity bile acid binding ketosteroid monooxygenase activity steroid dehydrogenase activity
Rattus norvegicus
3D-structure Cytoplasm Direct protein sequencing NAD NADP Oxidoreductase Reference proteome
MDSISLRVAL
MDSISLRVALNDGNFIPVLGFGTTVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVKREDIFYTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALQPGDIFFPRDEHGKLLFETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSSRDKTWVDQKSPVLLDDPVLCAIAKKYKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNAKYFDDHPNHPFT...
daunorubicin metabolic process doxorubicin metabolic process hippocampus development progesterone metabolic process prostaglandin metabolic process steroid metabolic process cytosol alditol:NADP+ 1-oxidoreductase activity androsterone dehydrogenase (B-specific) activity androsterone dehydrogenase activity bile acid bin...
negative regulation of insulin receptor signaling pathway protein dephosphorylation
cytoplasm; nucleus; plasma membrane
protein tyrosine phosphatase activity transmembrane receptor protein tyrosine phosphatase activity
Homo sapiens
3D-structure Alternative initiation Alternative promoter usage Cell membrane Cytoplasm Glycoprotein Hydrolase Membrane Phosphoprotein Protein phosphatase Reference proteome Repeat Signal Transmembrane Transmembrane helix
MEPLCPLLLV
MEPLCPLLLVGFSLPLARALRGNETTADSNETTTTSGPPDPGASQPLLAWLLLPLLLLLLVLLLAAYFFRFRKQRKAVVSTSDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGPKQETVNDFWRMVWEQKSATIVMLTNLKERKEEKCHQYWPDQGCWTYGNIRVCVEDCVVLVDYTIRKFCIQPQLPDGCKAPRLVSQLHFTSWPDFGVPFTPIGMLKFLKKV...
negative regulation of insulin receptor signaling pathway protein dephosphorylation cytoplasm; nucleus; plasma membrane protein tyrosine phosphatase activity transmembrane receptor protein tyrosine phosphatase activity Homo sapiens 3D-structure Alternative initiation Alternative promoter usage Cell membrane Cytoplasm G...
chitin catabolic process polysaccharide catabolic process
vacuole
chitinase activity lysozyme activity
Hevea brasiliensis
3D-structure Carbohydrate metabolism Chitin degradation Direct protein sequencing Disulfide bond Glycosidase Hydrolase Multifunctional enzyme Polysaccharide degradation Signal Vacuole
MAKRTQAILL
MAKRTQAILLLLLAISLIMSSSHVDGGGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFDIEHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFYNNPPCQYSSGNINNIINSWNRWTTSINAGKIFLGLPAAPEAAGSGYVPPDVLISRILPEIKKSPKYGGVMLWSKFYDDKNGYSSSILDSVLFLHSEECMTVL
chitin catabolic process polysaccharide catabolic process vacuole chitinase activity lysozyme activity Hevea brasiliensis 3D-structure Carbohydrate metabolism Chitin degradation Direct protein sequencing Disulfide bond Glycosidase Hydrolase Multifunctional enzyme Polysaccharide degradation Signal Vacuole MAKRTQAILL MA...
activation of innate immune response cellular hyperosmotic salinity response cellular response to gamma radiation cellular response to X-ray DNA damage response double-strand break repair double-strand break repair via classical nonhomologous end joining double-strand break repair via nonhomologous end joining innate i...
chromosome; cytoplasm; DNA-dependent protein kinase complex; DNA-dependent protein kinase-DNA ligase 4 complex; Ku70:Ku80 complex; nonhomologous end joining complex; nucleolus; nucleoplasm; nucleus; protein-containing complex; protein-DNA complex; transcription regulator complex
5'-deoxyribose-5-phosphate lyase activity ATP binding ATP hydrolysis activity ATP-dependent activity, acting on DNA cyclin binding damaged DNA binding DNA helicase activity double-stranded DNA binding protein-containing complex binding scaffold protein binding telomeric DNA binding transcription cis-regulatory region b...
Mus musculus
Acetylation Activator ADP-ribosylation ATP-binding Chromosome DNA damage DNA recombination DNA repair DNA-binding Helicase Hydrolase Immunity Innate immunity Isopeptide bond Lyase Multifunctional enzyme Nucleotide-binding Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation Ubl conjugation
MSEWESYYKT
MSEWESYYKTEGEEEEEEEESPDTGGEYKYSGRDSLIFLVDASRAMFESQGEDELTPFDMSIQCIQSVYTSKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQDLDNPGAKRVLELDQFKGQQGKKHFRDTVGHGSDYSLSEVLWVCANLFSDVQLKMSHKRIMLFTNEDDPHGRDSAKASRARTKASDLRDTGIFLDLMHLKKPGGFDVSVFYRDIITTAEDEDLGVHFEESSKLEDLLRKVRAKETKKRVLSRLKFKLGEDVVLMVGIYNLVQKANKPFPVRLYRETNEPVKTKTRTFNVNTGSLLLPSDTKRSLTY...
activation of innate immune response cellular hyperosmotic salinity response cellular response to gamma radiation cellular response to X-ray DNA damage response double-strand break repair double-strand break repair via classical nonhomologous end joining double-strand break repair via nonhomologous end joining innate i...
DNA-templated transcription initiation intracellular iron ion homeostasis iron ion transport regulation of DNA-templated transcription regulation of DNA-templated transcription initiation
cytosolic DNA-directed RNA polymerase complex
bacterial-type RNA polymerase core enzyme binding core promoter sequence-specific DNA binding sigma factor activity
Escherichia coli
Direct protein sequencing DNA-binding Ion transport Iron Iron transport Reference proteome Sigma factor Transcription Transcription regulation Transport
MSDRATTTAS
MSDRATTTASLTFESLYGTHHGWLKSWLTRKLQSAFDADDIAQDTFLRVMVSETLSTIRDPRSFLCTIAKRVMVDLFRRNALEKAYLEMLALMPEGGAPSPEERESQLETLQLLDSMLDGLNGKTREAFLLSQLDGLTYSEIAHKLGVSISSVKKYVAKAVEHCLLFRLEYGL
DNA-templated transcription initiation intracellular iron ion homeostasis iron ion transport regulation of DNA-templated transcription regulation of DNA-templated transcription initiation cytosolic DNA-directed RNA polymerase complex bacterial-type RNA polymerase core enzyme binding core promoter sequence-specific DNA ...
keratinization keratinocyte differentiation peptide cross-linking
cornified envelope; cytoplasm; cytosol; nucleoplasm
structural constituent of cytoskeleton structural constituent of skin epidermis
Homo sapiens
Cytoplasm Direct protein sequencing Disulfide bond Ichthyosis Isopeptide bond Keratinization Nucleus Palmoplantar keratoderma Reference proteome Repeat
MSYQKKQPTP
MSYQKKQPTPQPPVDCVKTSGGGGGGGGSGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSGCFSSGGGGGSVCGYSGGGSGCGGGSSGGSGSGYVSSQQVTQTSCAPQPSYGGGSSGGGGSGGSGCFSSGGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKGVPICHQTQQKQAPTWPSK
keratinization keratinocyte differentiation peptide cross-linking cornified envelope; cytoplasm; cytosol; nucleoplasm structural constituent of cytoskeleton structural constituent of skin epidermis Homo sapiens Cytoplasm Direct protein sequencing Disulfide bond Ichthyosis Isopeptide bond Keratinization Nucleus Palmopla...
binding of sperm to zona pellucida blastocyst formation egg coat formation humoral immune response mediated by circulating immunoglobulin negative regulation of binding of sperm to zona pellucida negative regulation of DNA-templated transcription oocyte development positive regulation of acrosomal vesicle exocytosis po...
collagen-containing extracellular matrix; egg coat; extracellular space; plasma membrane
carbohydrate binding receptor ligand activity structural constituent of egg coat
Mesocricetus auratus
Cell membrane Cleavage on pair of basic residues Disulfide bond Extracellular matrix Fertilization Glycoprotein Membrane Pyrrolidone carboxylic acid Receptor Reference proteome Secreted Signal Transmembrane Transmembrane helix
MGLSYQLLLC
MGLSYQLLLCLLLCGGAKQCCSQPLWLLPGGTPTPGKLTSSVEVECLEAELVVTVSRDLFGTGKLIQPEDLTLGSENCRPLVSVATDVVRFKAQLHECSNRVQVTEDALVYSTVLLHQPRPVPGLSILRTNRADVPIECRYPRQGNVSSHAIRPTWVPFSTTVSSEEKLVFSLRLMEENWNTEKLSPTSHLGEVAYLQAEVQTGSHLPLLLFVDRCVPTPSPDQTASPYHVIVDFHGCLVDGLSESFSAFQVPRPRPETLQFTVDVFHFANSSRNTIYITCHLKVTPANQTPDELNKACSFNRSSKSWSPVEGDAEVCGC...
binding of sperm to zona pellucida blastocyst formation egg coat formation humoral immune response mediated by circulating immunoglobulin negative regulation of binding of sperm to zona pellucida negative regulation of DNA-templated transcription oocyte development positive regulation of acrosomal vesicle exocytosis po...
iron-sulfur cluster assembly
CIA complex; cytosol; membrane; nucleus
4 iron, 4 sulfur cluster binding ferredoxin hydrogenase activity iron-sulfur cluster binding metal ion binding
Saccharomyces cerevisiae
4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding Nucleus Reference proteome
MSALLSESDL
MSALLSESDLNDFISPALACVKPTQVSGGKKDNVNMNGEYEVSTEPDQLEKVSITLSDCLACSGCITSSEEILLSSQSHSVFLKNWGKLSQQQDKFLVVSVSPQCRLSLAQYYGLTLEAADLCLMNFFQKHFQCKYMVGTEMGRIISISKTVEKIIAHKKQKENTGADRKPLLSAVCPGFLIYTEKTKPQLVPMLLNVKSPQQITGSLIRATFESLAIARESFYHLSLMPCFDKKLEASRPESLDDGIDCVITPREIVTMLQELNLDFKSFLTEDTSLYGRLSPPGWDPRVHWASNLGGTCGGYAYQYVTAVQRLHPGSQ...
iron-sulfur cluster assembly CIA complex; cytosol; membrane; nucleus 4 iron, 4 sulfur cluster binding ferredoxin hydrogenase activity iron-sulfur cluster binding metal ion binding Saccharomyces cerevisiae 4Fe-4S Cytoplasm Iron Iron-sulfur Metal-binding Nucleus Reference proteome MSALLSESDL MSALLSESDLNDFISPALACVKPTQVSG...
methylation negative regulation of cardiac muscle cell apoptotic process protein modification process S-adenosylhomocysteine metabolic process S-adenosylmethionine metabolic process
basolateral plasma membrane; brush border membrane; cytoplasm; cytosol; extracellular space; perikaryon
protein-L-isoaspartate (D-aspartate) O-methyltransferase activity S-adenosylmethionine-dependent methyltransferase activity
Mus musculus
Acetylation Alternative splicing Cytoplasm Direct protein sequencing Methyltransferase Reference proteome S-adenosyl-L-methionine Transferase
MAWKSGGASH
MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKSNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGNSGKVIGIDHIKELVDDSITNVKKDDPMLLSSGRVRLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSVKMKPLMGVIYVPLTDKEKQWSRWK
methylation negative regulation of cardiac muscle cell apoptotic process protein modification process S-adenosylhomocysteine metabolic process S-adenosylmethionine metabolic process basolateral plasma membrane; brush border membrane; cytoplasm; cytosol; extracellular space; perikaryon protein-L-isoaspartate (D-aspartat...
establishment of protein localization negative regulation of canonical Wnt signaling pathway negative regulation of epithelial cell migration negative regulation of epithelial cell proliferation signal transduction Wnt signaling pathway
cytoplasm; cytosol; lamellipodium; nucleoplasm; nucleus; plasma membrane
signaling receptor activity
Homo sapiens
3D-structure Alternative splicing Cell membrane Cell projection Cytoplasm Membrane Nucleus Phosphoprotein Reference proteome Tumor suppressor Wnt signaling pathway
MNSGVAMKYG
MNSGVAMKYGNDSSAELSELHSAALASLKGDIVELNKRLQQTERERDLLEKKLAKAQCEQSHLMREHEDVQERTTLRYEERITELHSVIAELNKKIDRLQGTTIREEDEYSELRSELSQSQHEVNEDSRSMDQDQTSVSIPENQSTMVTADMDNCSDLNSELQRVLTGLENVVCGRKKSSCSLSVAEVDKHIEQLTTASEHCDLAIKTVEEIEGVLGRDLYPNLAEERSRWEKELAGLREENESLTAMLCSKEEELNRTKATMNAIREERDRLRRRVRELQTRLQSVQATGPSSPGRLTSTNRPINPSTGELSTSSSSND...
establishment of protein localization negative regulation of canonical Wnt signaling pathway negative regulation of epithelial cell migration negative regulation of epithelial cell proliferation signal transduction Wnt signaling pathway cytoplasm; cytosol; lamellipodium; nucleoplasm; nucleus; plasma membrane signaling ...
glycogen biosynthetic process starch biosynthetic process
amyloplast; chloroplast
ATP binding glucose-1-phosphate adenylyltransferase activity
Solanum tuberosum
3D-structure Allosteric enzyme Amyloplast ATP-binding Chloroplast Nucleotide-binding Nucleotidyltransferase Plastid Reference proteome Starch biosynthesis Transferase Transit peptide
MAASIGALKS
MAASIGALKSSPSSNNCINERRNDSTRAVSSRNLSFSSSHLAGDKLMPVSSLRSQGVRFNVRRSPMIVSPKAVSDSQNSQTCLDPDASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPDWFQGTADAVRQYLWLFEEHTVLEYLILAGDHLYRMDYEKFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVMLNLLRDKFPG...
glycogen biosynthetic process starch biosynthetic process amyloplast; chloroplast ATP binding glucose-1-phosphate adenylyltransferase activity Solanum tuberosum 3D-structure Allosteric enzyme Amyloplast ATP-binding Chloroplast Nucleotide-binding Nucleotidyltransferase Plastid Reference proteome Starch biosynthesis Tran...