Biological Process
stringlengths
7
1.01k
Cellular Component
stringlengths
6
867
Molecular Function
stringlengths
11
871
Organism
stringlengths
8
73
Keywords
stringlengths
1
810
Sequence 10
stringlengths
5
10
Sequence
stringlengths
5
1.02k
Combined
stringlengths
136
3.91k
mitochondrial translation mitochondrial translational termination translational termination
mitochondrion
translation release factor activity
Saccharomyces cerevisiae
Methylation Mitochondrion Protein biosynthesis Reference proteome Transit peptide
MWLSKFQFPS
MWLSKFQFPSRSIFKGVFLGHKLPLLVRLTSTTTNSKSNGSIPTQYTELSPLLVKQAEKYEAELKDLDKDLSCGIHFDVNKQKHYAKLSALTDTFIEYKEKLNELKSLQEMIVSDPSLRAEAEQEYAELVPQYETTSSRLVNKLLPPHPFADKPSLLELRPGVGGIEAMIFTQNLLDMYIGYANYRKWKYRIISKNENESGSGIIDAILSIEEAGSYDRLRFEAGVHRVQRIPSTETKGRTHTSTAAVVVLPQIGDESAKSIDAYERTFKPGEIRVDIMRASGKGGQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNKA...
mitochondrial translation mitochondrial translational termination translational termination mitochondrion translation release factor activity Saccharomyces cerevisiae Methylation Mitochondrion Protein biosynthesis Reference proteome Transit peptide MWLSKFQFPS MWLSKFQFPSRSIFKGVFLGHKLPLLVRLTSTTTNSKSNGSIPTQYTELSPLLVKQAEK...
cell division chromatin looping DNA damage response double-strand break repair mitotic sister chromatid cohesion mitotic sister chromatid segregation mitotic telomere tethering at nuclear periphery replication-born double-strand break repair via sister chromatid exchange
chromatin; chromosome, subtelomeric region; cohesin complex; condensed chromosome, centromeric region; heterochromatin island; mitotic cohesin complex; nucleus; pericentric heterochromatin; rDNA heterochromatin
chromatin binding
Schizosaccharomyces pombe
3D-structure Cell cycle Cell division Centromere Chromosome Chromosome partition DNA damage DNA repair Mitosis Nucleus Phosphoprotein Reference proteome
MFYSEAILSK
MFYSEAILSKKGPLAKVWLAAHWEKKLSKVQTLHTSIEQSVHAIVTEETAPMALRLSGQLMLGVVRIYSRKARYLLEDCTEALMRLKMSFQPGQVDMIEPATALQSLKGKDAVTQSANLTLPETITEFDLLVPDSTFDFQWSQLLRTPSRSSNTLELHSLPISSSPSFPSSQLSIEAGRNAQVESGFSLGESFAHVGNDMQFHLPISNSGAATPRSVHSDNQSQISIEVGRDAPAAAATDLSGIIGPQMTKSPASSVTHFSTPSMLPIGGTSLDDELLAPVDDLNLDLGLDDLLGDEQGANAPAIEADEQAETSSIHLPS...
cell division chromatin looping DNA damage response double-strand break repair mitotic sister chromatid cohesion mitotic sister chromatid segregation mitotic telomere tethering at nuclear periphery replication-born double-strand break repair via sister chromatid exchange chromatin; chromosome, subtelomeric region; cohe...
7,8-dihydroneopterin 3'-triphosphate biosynthetic process dopamine biosynthetic process negative regulation of blood pressure negative regulation of cardiac muscle cell apoptotic process negative regulation of cellular senescence neuromuscular process controlling posture nitric oxide biosynthetic process positive regul...
cytoplasm; cytoplasmic vesicle; cytosol; mitochondrion; neuron projection terminus; nuclear membrane; nucleoplasm; nucleus; protein-containing complex
calcium ion binding GTP binding GTP cyclohydrolase I activity GTP-dependent protein binding GTPase activity identical protein binding mitogen-activated protein kinase binding protein homodimerization activity protein-containing complex binding zinc ion binding
Homo sapiens
3D-structure Allosteric enzyme Alternative splicing Cytoplasm Disease variant Dystonia GTP-binding Hydrolase Metal-binding Nucleotide-binding Nucleus Parkinsonism Phenylketonuria Phosphoprotein Reference proteome Tetrahydrobiopterin biosynthesis Zinc
MEKGPVRAPA
MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS
7,8-dihydroneopterin 3'-triphosphate biosynthetic process dopamine biosynthetic process negative regulation of blood pressure negative regulation of cardiac muscle cell apoptotic process negative regulation of cellular senescence neuromuscular process controlling posture nitric oxide biosynthetic process positive regul...
amino acid import across plasma membrane basic amino acid transport L-amino acid transport L-arginine import across plasma membrane L-arginine transmembrane transport L-histidine import across plasma membrane L-ornithine transmembrane transport lysine transport ornithine transport positive regulation of T cell prolifer...
apical plasma membrane; basal plasma membrane; basolateral plasma membrane; plasma membrane; protein-containing complex
amino acid transmembrane transporter activity basic amino acid transmembrane transporter activity L-arginine transmembrane transporter activity L-histidine transmembrane transporter activity L-lysine transmembrane transporter activity L-ornithine transmembrane transporter activity virus receptor activity
Rattus norvegicus
Amino-acid transport Cell membrane Glycoprotein Membrane Phosphoprotein Receptor Reference proteome Transmembrane Transmembrane helix Transport
MGCKNLLSLG
MGCKNLLSLGQQMLRRKVVDCSREESRLSRCLNTYDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIGKPIGEFSRQHMALNAPGVLAQTPDIFAVIIIIILTGLLTLGVKESAMVNKIFTCINVLVLCFIMVSGFVKGSIENWQLTENKSSPLCGNNDTNVKYGEGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDTDSPLPG...
amino acid import across plasma membrane basic amino acid transport L-amino acid transport L-arginine import across plasma membrane L-arginine transmembrane transport L-histidine import across plasma membrane L-ornithine transmembrane transport lysine transport ornithine transport positive regulation of T cell prolifer...
amino acid import across plasma membrane amino acid transport L-amino acid transport L-arginine import across plasma membrane L-arginine transmembrane transport L-histidine import across plasma membrane L-ornithine transmembrane transport lysine transport ornithine transport positive regulation of T cell proliferation ...
apical plasma membrane; basal plasma membrane; basolateral plasma membrane; membrane; plasma membrane; protein-containing complex
amino acid transmembrane transporter activity basic amino acid transmembrane transporter activity L-arginine transmembrane transporter activity L-histidine transmembrane transporter activity L-lysine transmembrane transporter activity L-ornithine transmembrane transporter activity virus receptor activity
Homo sapiens
Amino-acid transport Cell membrane Direct protein sequencing Glycoprotein Membrane Receptor Reference proteome Transmembrane Transmembrane helix Transport
MGCKVLLNIG
MGCKVLLNIGQQMLRRKVVDCSREETRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIGRPIGEFSRTHMTLNAPGVLAENPDIFAVIIILILTGLLTLGVKESAMVNKIFTCINVLVLGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDNN...
amino acid import across plasma membrane amino acid transport L-amino acid transport L-arginine import across plasma membrane L-arginine transmembrane transport L-histidine import across plasma membrane L-ornithine transmembrane transport lysine transport ornithine transport positive regulation of T cell proliferation ...
regulation of signal transduction
extracellular region; nematocyst
sodium channel regulator activity toxin activity
Heteractis crispa
Amidation Direct protein sequencing Disulfide bond Ion channel impairing toxin Nematocyst Neurotoxin Secreted Toxin Voltage-gated sodium channel impairing toxin
GNCKCDDEGP
GNCKCDDEGPYVRTAPLTGYVDLGYCNEGWEKCASYYSPIAECCRKKK
regulation of signal transduction extracellular region; nematocyst sodium channel regulator activity toxin activity Heteractis crispa Amidation Direct protein sequencing Disulfide bond Ion channel impairing toxin Nematocyst Neurotoxin Secreted Toxin Voltage-gated sodium channel impairing toxin GNCKCDDEGP GNCKCDDEGPYVR...
canonical glycolysis fructose 1,6-bisphosphate metabolic process fructose 6-phosphate metabolic process glycolytic process glycolytic process through fructose-6-phosphate negative regulation of insulin secretion response to glucose
6-phosphofructokinase complex; cytosol; membrane
6-phosphofructokinase activity AMP binding ATP binding fructose binding fructose-2,6-bisphosphate 2-phosphatase activity fructose-6-phosphate binding identical protein binding kinase binding metal ion binding monosaccharide binding
Rattus norvegicus
Acetylation Allosteric enzyme ATP-binding Cytoplasm Glycolysis Glycoprotein Kinase Magnesium Metal-binding Nucleotide-binding Phosphoprotein Reference proteome Transferase
MATVDLEKLR
MATVDLEKLRMSGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKPANWLSVSNIIQLGGTIIGSARCKAFTTREGRLAAAYNLLQHGITNLCVIGGDGSLTGANIFRNEWGSLLEELVKEGKISESTAQNYAHLSIAGLVGSIDNDFCGTDMTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWENFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPISSSYVKDLVVQRLGFDTRVTVLGHVQRGGTPSAFDRVLSSKMGMEA...
canonical glycolysis fructose 1,6-bisphosphate metabolic process fructose 6-phosphate metabolic process glycolytic process glycolytic process through fructose-6-phosphate negative regulation of insulin secretion response to glucose 6-phosphofructokinase complex; cytosol; membrane 6-phosphofructokinase activity AMP bind...
calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules leukocyte tethering or rolling positive regulation of neutrophil chemotaxis regulation of apoptotic process response to ATP response to cytokine response to hypero...
cell surface; external side of plasma membrane; extracellular space; plasma membrane
calcium ion binding cell adhesion molecule binding glycolipid binding oligosaccharide binding protease binding sialic acid binding
Rattus norvegicus
Calcium Cell adhesion Cell membrane Disulfide bond EGF-like domain Glycoprotein Lectin Membrane Metal-binding Reference proteome Repeat Signal Sushi Transmembrane Transmembrane helix
MVFPWRCQSA
MVFPWRCQSAQRGSWSFLKLWIRTLLCCDLLPHHGTHCWTYHYSERSMNWENARKFCKHNYTDLVAIQNKREIEYLEKTLPKNPTYYWIGIRKIGKTWTWVGTNKTLTKEAENWGTGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPESCNRHGECVETINNNTCICDPGYYGPQCQYVIQCEPLKAPELGTMNCIHPLGDFSFQSQCAFNCSEGSELLGNAKTECGASGNWTYLEPICQVIQCMPLAAPDLGTMECSHPLANFSFTSACTFTCSEETDLIGERKTVCRSSGSWSSPSPICQKTK...
calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules leukocyte tethering or rolling positive regulation of neutrophil chemotaxis regulation of apoptotic process response to ATP response to cytokine response to hypero...
carbohydrate metabolic process ethanol catabolic process
cytosol; mitochondrial matrix; mitochondrion; nucleoplasm
aldehyde dehydrogenase (NAD+) activity glyceraldehyde-3-phosphate dehydrogenase (NAD+) (non-phosphorylating) activity NAD binding
Homo sapiens
3D-structure Acetylation Mitochondrion NAD Oxidoreductase Reference proteome Transit peptide
MLRFLAPRLL
MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHVDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCC...
carbohydrate metabolic process ethanol catabolic process cytosol; mitochondrial matrix; mitochondrion; nucleoplasm aldehyde dehydrogenase (NAD+) activity glyceraldehyde-3-phosphate dehydrogenase (NAD+) (non-phosphorylating) activity NAD binding Homo sapiens 3D-structure Acetylation Mitochondrion NAD Oxidoreductase Refe...
cellular aldehyde metabolic process lipid metabolic process xenobiotic metabolic process
cytoplasm; cytosol; endoplasmic reticulum; extracellular space; plasma membrane
3-chloroallyl aldehyde dehydrogenase activity alcohol dehydrogenase (NADP+) activity aldehyde dehydrogenase (NAD+) activity aldehyde dehydrogenase activity benzaldehyde dehydrogenase (NAD+) activity
Homo sapiens
3D-structure Acetylation Cytoplasm Direct protein sequencing Lipid metabolism NAD NADP Oxidoreductase Reference proteome
MSKISEAVKR
MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNLTIQPMVGAIAAGNSVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKERFDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNSGQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEGQKVAYGGTGDAATRYIAPTI...
cellular aldehyde metabolic process lipid metabolic process xenobiotic metabolic process cytoplasm; cytosol; endoplasmic reticulum; extracellular space; plasma membrane 3-chloroallyl aldehyde dehydrogenase activity alcohol dehydrogenase (NADP+) activity aldehyde dehydrogenase (NAD+) activity aldehyde dehydrogenase act...
cellular aldehyde metabolic process central nervous system development epidermis development fatty acid metabolic process formaldehyde metabolic process hexadecanal metabolic process peripheral nervous system development phytol metabolic process response to reactive oxygen species
cytoplasm; endoplasmic reticulum; endoplasmic reticulum membrane; intracellular membrane-bounded organelle; membrane
3-chloroallyl aldehyde dehydrogenase activity aldehyde dehydrogenase (NAD+) activity glyceraldehyde-3-phosphate dehydrogenase (NAD+) (non-phosphorylating) activity long-chain-alcohol oxidase activity long-chain-aldehyde dehydrogenase activity medium-chain-aldehyde dehydrogenase activity protein homodimerization activit...
Rattus norvegicus
Direct protein sequencing Endoplasmic reticulum Fatty acid metabolism Lipid metabolism Membrane Microsome NAD Oxidoreductase Phosphoprotein Reference proteome Transmembrane Transmembrane helix
MERQVQRLRQ
MERQVQRLRQTFRSGRSRPLRFRLQQLEALRRMVQEREKDILAAIAADLSKSELNAYSHEVITILGEIDFMLGNLPELASARPAKKNLLTMMDEAYVQPEPLGVVLIIGAWNYPFVLTLQPLVGAIAAGNAAIVKPSELSENTAKILAELLPQYLDQDLYMIVNGGVEETTELLRQRFDHILYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDRDCDLDVACRRITWGKYMNCGQTCIAPDYILCEASSQDQIVQKIKDTVKDFYGENVKASPDYERIINLRHFKRIKSLLEGQKIAFGGETDEATRYIAPTILTD...
cellular aldehyde metabolic process central nervous system development epidermis development fatty acid metabolic process formaldehyde metabolic process hexadecanal metabolic process peripheral nervous system development phytol metabolic process response to reactive oxygen species cytoplasm; endoplasmic reticulum; endo...
phosphorelay signal transduction system response to iron(III) ion response to zinc ion signal transduction
membrane; plasma membrane
ATP binding phosphoprotein phosphatase activity phosphorelay sensor kinase activity protein histidine kinase activity
Escherichia coli
ATP-binding Cell inner membrane Cell membrane Kinase Membrane Nucleotide-binding Phosphoprotein Reference proteome Transferase Transmembrane Transmembrane helix Two-component regulatory system
MHFLRRPISL
MHFLRRPISLRQRLILTIGAILLVFELISVFWLWHESTEQIQLFEQALRDNRNNDRHIMREIREAVASLIVPGVFMVSLTLFICYQAVRRITRPLAELQKELEARTADNLTPIAIHSATLEIEAVVSALNDLVSRLTSTLDNERLFTADVAHELRTPLAGVRLHLELLAKTHHIDVAPLVARLDQMMESVSQLLQLARAGQSFSSGNYQHVKLLEDVILPSYDELSTMLDQRQQTLLLPESAADITVQGDATLLRMLLRNLVENAHRYSPQGSNIMIKLQEDDGAVMAVEDEGPGIDESKCGELSKAFVRMDSRYGGIGL...
phosphorelay signal transduction system response to iron(III) ion response to zinc ion signal transduction membrane; plasma membrane ATP binding phosphoprotein phosphatase activity phosphorelay sensor kinase activity protein histidine kinase activity Escherichia coli ATP-binding Cell inner membrane Cell membrane Kinase...
cellular response to cell envelope stress signal transduction
membrane; plasma membrane
ATP binding phosphorelay sensor kinase activity
Escherichia coli
ATP-binding Cell inner membrane Cell membrane Kinase Membrane Nucleotide-binding Phosphoprotein Reference proteome Stress response Transferase Transmembrane Transmembrane helix Two-component regulatory system
MKFWRPGITG
MKFWRPGITGKLFLAIFATCIVLLISMHWAVRISFERGFIDYIKHGNEQRLQLLSDALGEQYAQHGNWRFLRNNDRFVFQILRSFEHDNSEDKPGPGMPPHGWRTQFWVVDQNNKVLVGPRAPIPPDGTRRPILVNGAEVGAVIASPVERLTRNTDINFDKQQRQTSWLIVALATLLAALATFLLARGLLAPVKRLVDGTHKLAAGDFTTRVTPTSEDELGKLAQDFNQLASTLEKNQQMRRDFMADISHELRTPLAVLRGELEAIQDGVRKFTPETVASLQAEVGTLTKLVDDLHQLSMSDEGALAYQKAPVDLIPLLE...
cellular response to cell envelope stress signal transduction membrane; plasma membrane ATP binding phosphorelay sensor kinase activity Escherichia coli ATP-binding Cell inner membrane Cell membrane Kinase Membrane Nucleotide-binding Phosphoprotein Reference proteome Stress response Transferase Transmembrane Transmembr...
mRNA catabolic process
cytosol
3'-5' exonuclease activity exoribonuclease II activity RNA binding
Escherichia coli
3D-structure Acetylation Cytoplasm Exonuclease Hydrolase Nuclease Reference proteome RNA-binding
MFQDNPLLAQ
MFQDNPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRIIAVIHSEKERESAEPEELVEPFLTRFVGKVQGKNDRLAIVPDHPLLKDAIPCRAARGLNHEFKEGDWAVAEMRRHPLKGDRSFYAELTQYITFGDDHFVPWWVTLARHNLEKEAPDGVATEMLDEGLVREDLTALDFVTIDSASTEDMDDALFAKALPDDKLQLIVAIADPTAWIAEGSKLDKAAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPVLACRMTLSADGTIEDNIEFFAATIESKAKLVYDQVSDWL...
mRNA catabolic process cytosol 3'-5' exonuclease activity exoribonuclease II activity RNA binding Escherichia coli 3D-structure Acetylation Cytoplasm Exonuclease Hydrolase Nuclease Reference proteome RNA-binding MFQDNPLLAQ MFQDNPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRIIAVIHSEKERESAEPEELVEPFLTRFVGKVQGKNDRL...
metabolic process regulation of glutamine family amino acid metabolic process
cytosol
adenylyltransferase activity -adenylyl-L-tyrosine phosphorylase activity ATP binding magnesium ion binding
Escherichia coli
3D-structure ATP-binding Magnesium Multifunctional enzyme Nucleotide-binding Nucleotidyltransferase Reference proteome Transferase
MKPLSSPLQQ
MKPLSSPLQQYWQTVVERLPEPLAEESLSAQAKSVLTFSDFVQDSVIAHPEWLTELESQPPQADEWQHYAAWLQEALCNVSDEAGLMRELRLFRRRIMVRIAWAQTLALVTEESILQQLSYLAETLIVAARDWLYDACCREWGTPCNAQGEAQPLLILGMGKLGGGELNFSSDIDLIFAWPEHGCTQGGRRELDNAQFFTRMGQRLIKVLDQPTQDGFVYRVDMRLRPFGESGPLVLSFAALEDYYQEQGRDWERYAMVKARIMGDSEGVYANELRAMLRPFVFRRYIDFSVIQSLRNMKGMIAREVRRRGLTDNIKLGA...
metabolic process regulation of glutamine family amino acid metabolic process cytosol adenylyltransferase activity -adenylyl-L-tyrosine phosphorylase activity ATP binding magnesium ion binding Escherichia coli 3D-structure ATP-binding Magnesium Multifunctional enzyme Nucleotide-binding Nucleotidyltransferase Reference...
cellular response to estradiol stimulus cellular response to leukemia inhibitory factor cerebellum development forebrain development G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger glutamate receptor signaling pathway negative regulation of cell population proliferation neuro...
neuron projection; plasma membrane
neuropeptide binding somatostatin receptor activity
Homo sapiens
Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Lipoprotein Membrane Palmitate Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MFPNGTASSP
MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDDATVSQLSVILGYANSCANP...
cellular response to estradiol stimulus cellular response to leukemia inhibitory factor cerebellum development forebrain development G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger glutamate receptor signaling pathway negative regulation of cell population proliferation neuro...
cellular response to estradiol stimulus cellular response to leukemia inhibitory factor cerebellum development forebrain development G protein-coupled receptor signaling pathway glutamate receptor signaling pathway neuropeptide signaling pathway response to starvation spermatogenesis
membrane; neuron projection; plasma membrane
neuropeptide binding somatostatin receptor activity
Mus musculus
Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Lipoprotein Membrane Palmitate Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MFPNGTASSP
MFPNGTASSPSSSPSPSPGSCGEGACSRGPGSGAADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDDATVSQLSVILGYANSCANP...
cellular response to estradiol stimulus cellular response to leukemia inhibitory factor cerebellum development forebrain development G protein-coupled receptor signaling pathway glutamate receptor signaling pathway neuropeptide signaling pathway response to starvation spermatogenesis membrane; neuron projection; plasma...
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway cellular response to estradiol stimulus cellular response to glucocorticoid stimulus cerebellum development forebrain development G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger negative regulation of c...
cytosol; neuron projection; plasma membrane
neuropeptide binding PDZ domain binding somatostatin receptor activity
Homo sapiens
3D-structure Alternative splicing Cell membrane Cytoplasm Disulfide bond G-protein coupled receptor Glycoprotein Lipoprotein Membrane Palmitate Phosphoprotein Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MDMADEPLNG
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFK...
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway cellular response to estradiol stimulus cellular response to glucocorticoid stimulus cerebellum development forebrain development G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger negative regulation of c...
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway cellular response to estradiol stimulus cellular response to glucocorticoid stimulus cerebellum development forebrain development G protein-coupled receptor signaling pathway neuropeptide signaling pathway peristalsis response to starvation sperm...
cytosol; membrane; neuron projection; plasma membrane
neuropeptide binding PDZ domain binding somatostatin receptor activity
Mus musculus
Alternative splicing Cell membrane Cytoplasm Disulfide bond G-protein coupled receptor Glycoprotein Lipoprotein Membrane Palmitate Phosphoprotein Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MEMSSEQLNG
MEMSSEQLNGSQVWVSSPFDLNGSLGPSNGSNQTEPYYDMTSNAVLTFIYFVVCVVGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWCVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVILTYANSCANPILYAFLSDNFK...
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway cellular response to estradiol stimulus cellular response to glucocorticoid stimulus cerebellum development forebrain development G protein-coupled receptor signaling pathway neuropeptide signaling pathway peristalsis response to starvation sperm...
carbohydrate transport organic substance transport sodium ion transport
plasma membrane
symporter activity
Salmonella typhimurium
3D-structure Cell inner membrane Cell membrane Membrane Reference proteome Sugar transport Symport Transmembrane Transmembrane helix Transport
MSISLTTKLS
MSISLTTKLSYGFGAFGKDFAIGIVYMYLMYYYTDVVGLSVGLVGTLFLVARIWDAINDPIMGWIVNATRSRWGKFKPWILIGTLTNSLVLFLLFSAHLFEGTAQVVFVCVTYILWGMTYTIMDIPFWSLVPTITLDKREREQLVPFPRFFASLAGFVTAGITLPFVSYVGGADRGFGFQMFTLVLIAFFIASTIVTLRNVHEVYSSDNGVTAGRPHLTLKTIVGLIYKNDQLSCLLGMALAYNIASNIINGFAIYYFTYVIGDADLFPYYLSYAGAANLLTLIVFPRLVKMLSRRILWAGASVMPVLSCAGLFAMALAD...
carbohydrate transport organic substance transport sodium ion transport plasma membrane symporter activity Salmonella typhimurium 3D-structure Cell inner membrane Cell membrane Membrane Reference proteome Sugar transport Symport Transmembrane Transmembrane helix Transport MSISLTTKLS MSISLTTKLSYGFGAFGKDFAIGIVYMYLMYYYTDV...
proton motive force-driven ATP synthesis
mitochondrial inner membrane; mitochondrial proton-transporting ATP synthase complex; mitochondrial proton-transporting ATP synthase, stator stalk; mitochondrion
proton transmembrane transporter activity
Saccharomyces cerevisiae
3D-structure Acetylation ATP synthesis CF(0) Direct protein sequencing Hydrogen ion transport Ion transport Membrane Mitochondrion Mitochondrion inner membrane Reference proteome Transport
MSLAKSAANK
MSLAKSAANKLDWAKVISSLRITGSTATQLSSFKKRNDEARRQLLELQSQPTEVDFSHYRSVLKNTSVIDKIESYVKQYKPVKIDASKQLQVIESFEKHAMTNAKETESLVSKELKDLQSTLDNIQSARPFDELTVDDLTKIKPEIDAKVEEMVKKGKWDVPGYKDRFGNLNVM
proton motive force-driven ATP synthesis mitochondrial inner membrane; mitochondrial proton-transporting ATP synthase complex; mitochondrial proton-transporting ATP synthase, stator stalk; mitochondrion proton transmembrane transporter activity Saccharomyces cerevisiae 3D-structure Acetylation ATP synthesis CF(0) Dire...
proteolysis
cytoplasm; endoplasmic reticulum; extracellular space; lysosome
asparaginase activity beta-aspartyl-peptidase activity N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity protein self-association
Rattus norvegicus
Autocatalytic cleavage Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Lysosome Protease Reference proteome Signal
MARKWNLPFL
MARKWNLPFLLLPLVLGIPLVRGSNPLPLVVNTWPFKNATEAAWWTLVSGGSALDAVEKGCAMCEKEQCGGTVGFGGSPDEVGETTLDAMIMDGTAMDVGAVGGLRRIKNAIGVARKVLEHTTHTLLVGDSATKFAVSMGFTSEDLSTNTSRALHSDWLSRNCQPNYWRNVIPDPSKYCGPYKPPDFLEQNNRAHKEVDIHSHDTIGMVVIHKTGHTAAGTSTNGLKFKIPGRVGDSPIPGAGAYADDMAGAAAATGDGDTLLRFLPSYQAVEYMRGGDDPARACQKVISRIQKYYPKFFGAVICANVTGSYGAACNRLP...
proteolysis cytoplasm; endoplasmic reticulum; extracellular space; lysosome asparaginase activity beta-aspartyl-peptidase activity N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity protein self-association Rattus norvegicus Autocatalytic cleavage Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Lyso...
carbohydrate metabolic process
extracellular region
alpha-amylase activity cyclomaltodextrin glucanotransferase activity metal ion binding starch binding
Niallia circulans
3D-structure Calcium Disulfide bond Glycosyltransferase Metal-binding Secreted Signal Transferase
MFQMAKRAFL
MFQMAKRAFLSTTLTLGLLAGSALPFLPASAVYADPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVDAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFN...
carbohydrate metabolic process extracellular region alpha-amylase activity cyclomaltodextrin glucanotransferase activity metal ion binding starch binding Niallia circulans 3D-structure Calcium Disulfide bond Glycosyltransferase Metal-binding Secreted Signal Transferase MFQMAKRAFL MFQMAKRAFLSTTLTLGLLAGSALPFLPASAVYADPDTA...
activation of NF-kappaB-inducing kinase activity apoptotic process carbohydrate metabolic process cellular response to tumor necrosis factor chitin catabolic process inflammatory response lung development positive regulation of angiogenesis positive regulation of ERK1 and ERK2 cascade positive regulation of interleukin...
cytoplasm; endoplasmic reticulum; extracellular region; extracellular space; perinuclear region of cytoplasm
carbohydrate binding chitin binding
Bos taurus
3D-structure Antimicrobial Apoptosis Cytoplasm Direct protein sequencing Disulfide bond Endoplasmic reticulum Glycoprotein Inflammatory response Lectin Reference proteome Secreted Signal
MGLRAAHTGF
MGLRAAHTGFVVLVLLQSCAAYKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVPAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSDRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGQFTKEKGILAYYEICDFLHGATTHRFRDQQVPYAT...
activation of NF-kappaB-inducing kinase activity apoptotic process carbohydrate metabolic process cellular response to tumor necrosis factor chitin catabolic process inflammatory response lung development positive regulation of angiogenesis positive regulation of ERK1 and ERK2 cascade positive regulation of interleukin...
behavioral response to nicotine locomotory behavior monoatomic ion transport neuronal action potential positive regulation of transmission of nerve impulse regulation of neurotransmitter secretion regulation of smooth muscle contraction signal transduction smooth muscle contraction synaptic transmission involved in mic...
acetylcholine-gated channel complex; cholinergic synapse; membrane; neuron projection; plasma membrane; postsynaptic membrane; specific granule membrane; synapse; tertiary granule membrane
acetylcholine receptor activity acetylcholine-gated monoatomic cation-selective channel activity ligand-gated monoatomic ion channel activity
Homo sapiens
3D-structure Alternative splicing Cell membrane Disulfide bond Glycoprotein Ion channel Ion transport Ligand-gated ion channel Membrane Postsynaptic cell membrane Receptor Reference proteome Signal Synapse Transmembrane Transmembrane helix Transport
MRRAPSLVLF
MRRAPSLVLFFLVALCGRGNCRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQLSLAQLISVNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNNADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTEIDMVLMTPTASMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVH...
behavioral response to nicotine locomotory behavior monoatomic ion transport neuronal action potential positive regulation of transmission of nerve impulse regulation of neurotransmitter secretion regulation of smooth muscle contraction signal transduction smooth muscle contraction synaptic transmission involved in mic...
cholesterol metabolic process lipid metabolic process phosphatidylcholine metabolic process
extracellular space
1-alkyl-2-acetylglycerophosphocholine esterase activity phosphatidylcholine-sterol O-acyltransferase activity platelet-activating factor acetyltransferase activity
Sus scrofa
Acyltransferase Cholesterol metabolism Direct protein sequencing Glycoprotein Hydrolase Lipid metabolism Reference proteome Secreted Steroid metabolism Sterol metabolism Transferase
FWLLNVLFPP
FWLLNVLFPPHTTPKAELSNHTRPVILVPGCLGNPDVVNWMCYRFTIWLDLNMFLPLGVDVPGFGKTYSVEYLDNSKAAPYDWRLEPSQQEEYYLKISLGAPWGGSDLHFEEGWYDLLAGLPAPGVEVYCLYGVGLPTPRXYIFDXGFPYXDPVQQQPVHLLPLPGTQHLNMVFSXQTLEXINAILLG
cholesterol metabolic process lipid metabolic process phosphatidylcholine metabolic process extracellular space 1-alkyl-2-acetylglycerophosphocholine esterase activity phosphatidylcholine-sterol O-acyltransferase activity platelet-activating factor acetyltransferase activity Sus scrofa Acyltransferase Cholesterol metab...
cellular response to estradiol stimulus cellular response to glucocorticoid stimulus cerebellum development forebrain development neuropeptide signaling pathway response to starvation spermatogenesis
ciliary membrane; cilium; neuron projection; non-motile cilium; plasma membrane
G protein-coupled receptor activity neuropeptide binding signaling receptor binding somatostatin receptor activity
Mus musculus
Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Membrane Phosphoprotein Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MATVTYPSSE
MATVTYPSSEPTTLDPGNASSTWPLDTTLGNTSAGASLTGLAVSGILISLVYLVVCVVGLLGNSLVIYVVLRHTSSPSVTSVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVMAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVVFSGVPRGMSTCHMQWPEPAAAWRTAFIIYTAALGFFGPLLVICLCYLLIVVKVRSTTRRVRAPSCQWVQAPACQRRRRSERRVTRMVVAVVALFVLCWMPFYLLNIVNVVCPLPEEPAFFGLYFLVVALPYANSCANPI...
cellular response to estradiol stimulus cellular response to glucocorticoid stimulus cerebellum development forebrain development neuropeptide signaling pathway response to starvation spermatogenesis ciliary membrane; cilium; neuron projection; non-motile cilium; plasma membrane G protein-coupled receptor activity neur...
cellular response to estradiol stimulus cellular response to glucocorticoid stimulus cerebellum development forebrain development neuropeptide signaling pathway response to starvation spermatogenesis
ciliary membrane; cilium; neuron projection; non-motile cilium; plasma membrane
G protein-coupled receptor activity neuropeptide binding signaling receptor binding somatostatin receptor activity
Rattus norvegicus
Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Membrane Phosphoprotein Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MAAVTYPSSV
MAAVTYPSSVPTTLDPGNASSAWPLDTSLGNASAGTSLAGLAVSGILISLVYLVVCVVGLLGNSLVIYVVLRHTSSPSVTSVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVMAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARMVSAAVWVASAVVVLPVVVFSGVPRGMSTCHMQWPEPAAAWRTAFIIYTAALGFFGPLLVICLCYLLIVVKVRSTTRRVRAPSCQWVQAPACQRRRRSERRVTRMVVAVVALFVLCWMPFYLLNIVNVVCPLPEEPAFFGLYFLVVALPYANSCANPI...
cellular response to estradiol stimulus cellular response to glucocorticoid stimulus cerebellum development forebrain development neuropeptide signaling pathway response to starvation spermatogenesis ciliary membrane; cilium; neuron projection; non-motile cilium; plasma membrane G protein-coupled receptor activity neur...
cell migration cellular response to glucocorticoid stimulus forebrain development negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway neuropeptide signaling pathway positive regulation of arachidonic acid secretion positive regulation of ERK1 and ERK2 cascade
neuron projection; plasma membrane
neuropeptide binding somatostatin receptor activity
Rattus norvegicus
Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Lipoprotein Membrane Palmitate Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MNTPATLPLG
MNTPATLPLGGEDTTWTPGINASWAPDEEEDAVRSDGTGTAGMVTIQCIYALVCLVGLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASAAALRHWPFGAVLCRAVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLPIAVFADTRPARGGEAVACNLHWPHPAWSAVFVIYTFLLGFLLPVLAIGLCYLLIVGKMRAVALRAGWQQRRRSEKKITRLVLMVVTVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILSYANSCANPILYGFLSDNFRRSFQR...
cell migration cellular response to glucocorticoid stimulus forebrain development negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway neuropeptide signaling pathway positive regulation of arachidonic acid secretion positive regulation of ERK1 and ERK2 cascade neuron projecti...
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway cellular response to glucocorticoid stimulus glucose homeostasis neuropeptide signaling pathway positive regulation of cytokinesis regulation of insulin secretion
neuron projection; plasma membrane
neuropeptide binding somatostatin receptor activity
Rattus norvegicus
Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Lipoprotein Membrane Palmitate Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MEPLSLASTP
MEPLSLASTPSWNASAASSGNHNWSLVGSASPMGARAVLVPVLYLLVCTVGLSGNTLVIYVVLRHAKMKTVTNVYILNLAVADVLFMLGLPFLATQNAVVSYWPFGSFLCRLVMTLDGINQFTSIFCLMVMSVDRYLAVVHPLRSARWRRPRVAKMASAAVWVFSLLMSLPLLVFADVQEGWGTCNLSWPEPVGLWGAAFITYTSVLGFFGPLLVICLCYLLIVVKVKAAGMRVGSSRRRRSEPKVTRMVVVVVLVFVGCWLPFFIVNIVNLAFTLPEEPTSAGLYFFVVVLSYANSCANPLLYGFLSDNFRQSFRKVLC...
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway cellular response to glucocorticoid stimulus glucose homeostasis neuropeptide signaling pathway positive regulation of cytokinesis regulation of insulin secretion neuron projection; plasma membrane neuropeptide binding somatostatin receptor activ...
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway adenylate cyclase-inhibiting serotonin receptor signaling pathway chemical synaptic transmission G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
dendrite; plasma membrane; synapse
G protein-coupled serotonin receptor activity neurotransmitter receptor activity serotonin binding
Homo sapiens
3D-structure Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Membrane Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MDFLNSSDQN
MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHAGIMITIVWIISVFISMPPLFWRHQGTSRDDECIIKHDHIVSTIYSTFGAFYIPLALILILYYKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCD...
adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway adenylate cyclase-inhibiting serotonin receptor signaling pathway chemical synaptic transmission G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger dendrite; plasma membrane; synapse G protein-coupled sero...
activation of innate immune response cellular response to virus positive regulation of defense response to virus by host positive regulation of interferon-beta production regulation of apoptotic process response to antibiotic response to cold response to heat
cytoplasm; melanosome; mitochondrion; nucleus; plasma membrane
ATP binding ATP hydrolysis activity ATP-dependent protein folding chaperone phosphoprotein binding unfolded protein binding
Oryctolagus cuniculus
Acetylation ATP-binding Cell membrane Chaperone Cytoplasm Direct protein sequencing Hydrolase Membrane Mitochondrion Nucleotide-binding Nucleus Phosphoprotein Reference proteome S-nitrosylation Stress response Ubl conjugation
MPEETQTQDQ
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDAGEPMGRGTKVVLHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAKQPDDKPEIEDVGSDEEEEEKKDGDIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVP...
activation of innate immune response cellular response to virus positive regulation of defense response to virus by host positive regulation of interferon-beta production regulation of apoptotic process response to antibiotic response to cold response to heat cytoplasm; melanosome; mitochondrion; nucleus; plasma membra...
negative regulation of proteasomal ubiquitin-dependent protein catabolic process negative regulation of transforming growth factor beta activation positive regulation of transforming growth factor beta receptor signaling pathway regulation of cell cycle
aryl hydrocarbon receptor complex; cytoplasm; dynein axonemal particle; extracellular region; melanosome; nucleus; plasma membrane
ATP binding ATP hydrolysis activity ATP-dependent protein folding chaperone protein dimerization activity unfolded protein binding
Oryctolagus cuniculus
Acetylation ATP-binding Cell membrane Chaperone Cytoplasm Direct protein sequencing Glycoprotein Membrane Methylation Nucleotide-binding Nucleus Phosphoprotein Reference proteome S-nitrosylation Secreted Stress response Ubl conjugation
MPEEVHHGEE
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELKIDIIPSPQDRTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEEKKEEEDKEDDEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAV...
negative regulation of proteasomal ubiquitin-dependent protein catabolic process negative regulation of transforming growth factor beta activation positive regulation of transforming growth factor beta receptor signaling pathway regulation of cell cycle aryl hydrocarbon receptor complex; cytoplasm; dynein axonemal part...
glyoxylate cycle tricarboxylic acid cycle
cytoplasm; cytosol; peroxisomal matrix; peroxisome
malate synthase activity
Saccharomyces cerevisiae
Glyoxylate bypass Peroxisome Reference proteome Transferase Tricarboxylic acid cycle
MVKVSLDNVK
MVKVSLDNVKLLVDVDKEPFFKPSSTTVGDILTKDALEFIVLLHRTFNNKRKQLLENRQVVQKKLDSGSYHLDFLPETANIRNDPTWQGPILAPGLINRSTEITGPPLRNMLINALNAPVNTYMTDFEDSASPTWNNMVYGQVNLYDAIRNQIDFDTPRKSYKLNGNVANLPTIIVRPRGWHMVEKHLYVDDEPISASIFDFGLYFYHNAKELIKLGKGPYFYLPKMEHHLEAKLWNDVFCVAQDYIGIPRGTIRATVLIETLPAAFQMEEIIYQLRQHSSGLNCGRWDYIFSTIKRLRNDPNHILPNRNQVTMTSPFMD...
glyoxylate cycle tricarboxylic acid cycle cytoplasm; cytosol; peroxisomal matrix; peroxisome malate synthase activity Saccharomyces cerevisiae Glyoxylate bypass Peroxisome Reference proteome Transferase Tricarboxylic acid cycle MVKVSLDNVK MVKVSLDNVKLLVDVDKEPFFKPSSTTVGDILTKDALEFIVLLHRTFNNKRKQLLENRQVVQKKLDSGSYHLDFLPETAN...
cellular response to hormone stimulus G protein-coupled receptor signaling pathway gonadotropin secretion
membrane; plasma membrane
gonadotropin-releasing hormone receptor activity peptide binding
Homo sapiens
3D-structure Alternative splicing Cell membrane Disease variant Disulfide bond G-protein coupled receptor Glycoprotein Hypogonadotropic hypogonadism Membrane Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MANSASPEQN
MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDP...
cellular response to hormone stimulus G protein-coupled receptor signaling pathway gonadotropin secretion membrane; plasma membrane gonadotropin-releasing hormone receptor activity peptide binding Homo sapiens 3D-structure Alternative splicing Cell membrane Disease variant Disulfide bond G-protein coupled receptor Glyc...
G protein-coupled receptor signaling pathway inter-male aggressive behavior neuropeptide signaling pathway tachykinin receptor signaling pathway
membrane; plasma membrane
neuropeptide receptor activity tachykinin receptor activity
Drosophila melanogaster
Cell membrane G-protein coupled receptor Glycoprotein Membrane Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MSEIVDTELL
MSEIVDTELLVNCTILAVRRFELNSIVNTTLLGSLNRTEVVSLLSSIIDNRDNLESINEAKDFLTECLFPSPTRPYELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCVFNFIFMLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRRTSRRKVRIILVLIWALSCVLSAPCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAYNLIILVLTYGIPMIVMLICYSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWL...
G protein-coupled receptor signaling pathway inter-male aggressive behavior neuropeptide signaling pathway tachykinin receptor signaling pathway membrane; plasma membrane neuropeptide receptor activity tachykinin receptor activity Drosophila melanogaster Cell membrane G-protein coupled receptor Glycoprotein Membrane Re...
detection of chemical stimulus involved in sensory perception of smell G protein-coupled receptor signaling pathway negative regulation of synaptic transmission neuropeptide signaling pathway olfactory behavior positive regulation of sensory perception of pain tachykinin receptor signaling pathway
membrane; plasma membrane
neuropeptide receptor activity tachykinin receptor activity
Drosophila melanogaster
Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Lipoprotein Membrane Palmitate Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MENRSDFEAD
MENRSDFEADDYGDISWSNWSNWSTPAGVLFSAMSSVLSASNHTPLPDFGQELALSTSSFNHSQTLSTDLPAVGDVEDAAEDAAASMETGSFAFVVPWWRQVLWSILFGGMVIVATGGNLIVVWIVMTTKRMRTVTNYFIVNLSIADAMVSSLNVTFNYYYMLDSDWPFGEFYCKLSQFIAMLSICASVFTLMAISIDRYVAIIRPLQPRMSKRCNLAIAAVIWLASTLISCPMMIIYRTEEVPVRGLSNRTVCYPEWPDGPTNHSTMESLYNILIIILTYFLPIVSMTVTYSRVGIELWGSKTIGECTPRQVENVRSKR...
detection of chemical stimulus involved in sensory perception of smell G protein-coupled receptor signaling pathway negative regulation of synaptic transmission neuropeptide signaling pathway olfactory behavior positive regulation of sensory perception of pain tachykinin receptor signaling pathway membrane; plasma memb...
alkaloid metabolic process
cytoplasmic vesicle
FAD binding reticuline oxidase activity
Eschscholzia californica
3D-structure Alkaloid metabolism Cytoplasmic vesicle Direct protein sequencing Disulfide bond FAD Flavoprotein Glycoprotein Oxidoreductase Signal
MENKTPIFFS
MENKTPIFFSLSIFLSLLNCALGGNDLLSCLTFNGVRNHTVFSADSDSDFNRFLHLSIQNPLFQNSLISKPSAIILPGSKEELSNTIRCIRKGSWTIRLRSGGHSYEGLSYTSDTPFILIDLMNLNRVSIDLESETAWVESGSTLGELYYAITESSSKLGFTAGWCPTVGTGGHISGGGFGMMSRKYGLAADNVVDAILIDANGAILDRQAMGEDVFWAIRGGGGGVWGAIYAWKIKLLPVPEKVTVFRVTKNVAIDEATSLLHKWQFVAEELEEDFTLSVLGGADEKQVWLTMLGFHFGLKTVAKSTFDLLFPELGLVE...
alkaloid metabolic process cytoplasmic vesicle FAD binding reticuline oxidase activity Eschscholzia californica 3D-structure Alkaloid metabolism Cytoplasmic vesicle Direct protein sequencing Disulfide bond FAD Flavoprotein Glycoprotein Oxidoreductase Signal MENKTPIFFS MENKTPIFFSLSIFLSLLNCALGGNDLLSCLTFNGVRNHTVFSADSDSDFN...
adenylate cyclase-activating G protein-coupled receptor signaling pathway cellular response to lipopolysaccharide inflammatory response negative regulation of cell migration involved in sprouting angiogenesis positive regulation of angiogenesis positive regulation of blood coagulation positive regulation of blood press...
acrosomal vesicle; nuclear speck; plasma membrane
thromboxane receptor activity
Mus musculus
Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Membrane Phosphoprotein Receptor Reference proteome Transducer Transmembrane Transmembrane helix
MWPNGTSLGA
MWPNGTSLGACFRPVNITLQERRAIASPWFAASFCALGLGSNLLALSVLAGARPGAGPRSSFLALLCGLVLTDFLGLLVTGAIVASQHAALLDWRATDPSCRLCYFMGVAMVFFGLCPLLLGAAMASERFVGITRPFSRPTATSRRAWATVGLVWVAAGALGLLPLLGLGRYSVQYPGSWCFLTLGTQRGDVVFGLIFALLGSASVGLSLLLNTVSVATLCRVYHTREATQRPRDCEVEMMVQLVGIMVVATVCWMPLLVFIMQTLLQTPPVMSFSGQLLRATEHQLLIYLRVATWNQILDPWVYILFRRSVLRRLHPRF...
adenylate cyclase-activating G protein-coupled receptor signaling pathway cellular response to lipopolysaccharide inflammatory response negative regulation of cell migration involved in sprouting angiogenesis positive regulation of angiogenesis positive regulation of blood coagulation positive regulation of blood press...
adenylate cyclase-activating G protein-coupled receptor signaling pathway amylin receptor signaling pathway cell surface receptor signaling pathway cross-receptor inhibition within G protein-coupled receptor heterodimer negative regulation of ossification ossification osteoclast differentiation positive regulation of a...
acrosomal vesicle; amylin receptor complex 1; amylin receptor complex 2; amylin receptor complex 3; axon; cilium; plasma membrane
amylin receptor activity amyloid-beta binding calcitonin binding calcitonin gene-related peptide receptor activity calcitonin receptor activity
Homo sapiens
3D-structure Alternative promoter usage Alternative splicing Cell membrane Direct protein sequencing Disulfide bond G-protein coupled receptor Glycoprotein Membrane Receptor Reference proteome Signal Transducer Transmembrane Transmembrane helix
MRFTFTSRCL
MRFTFTSRCLALFLLLNHPTPILPAFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIVGHSLSIFTLVISLGIFVFFRSLGCQRVTLHKNMFLTYILNSMIIIIHLVEVVPNGELVRRDPVSCKILHFFHQYMMACNYFWMLCEGIYLHTLIVVAVFTEKQRLRWYYLLGWGFPLVPTTIHAITRAVYFNDNCWLSVETHLLYIIHGPVMAALVVNFFFLLNIV...
adenylate cyclase-activating G protein-coupled receptor signaling pathway amylin receptor signaling pathway cell surface receptor signaling pathway cross-receptor inhibition within G protein-coupled receptor heterodimer negative regulation of ossification ossification osteoclast differentiation positive regulation of a...
blood vessel diameter maintenance negative regulation of gene expression neuropeptide signaling pathway positive regulation of gene expression positive regulation of NF-kappaB transcription factor activity positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction signal transduction
axon terminus; extracellular region; intracellular membrane-bounded organelle; transport vesicle
neuropeptide hormone activity neuropeptide receptor binding receptor ligand activity
Homo sapiens
3D-structure Cleavage on pair of basic residues Cytoplasmic vesicle Pyrrolidone carboxylic acid Reference proteome Secreted Signal Vasoactive
MMAGMKIQLV
MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY
blood vessel diameter maintenance negative regulation of gene expression neuropeptide signaling pathway positive regulation of gene expression positive regulation of NF-kappaB transcription factor activity positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction signal transduction axon...
amyloid-beta clearance astrocyte activation cell proliferation in hindbrain cognition complement component C5a signaling pathway complement receptor mediated signaling pathway defense response to Gram-positive bacterium inflammatory response microglial cell activation mRNA transcription by RNA polymerase II negative re...
apical part of cell; basolateral plasma membrane; cell surface; cytoplasmic vesicle; plasma membrane
complement component C5a binding complement component C5a receptor activity G protein-coupled receptor activity
Mus musculus
Cell membrane Chemotaxis Cytoplasmic vesicle Disulfide bond G-protein coupled receptor Glycoprotein Membrane Phosphoprotein Receptor Reference proteome Sulfation Transducer Transmembrane Transmembrane helix
MDPIDNSSFE
MDPIDNSSFEINYDHYGTMDPNIPADGIHLPKRQPGDVAALIIYSVVFLVGVPGNALVVWVTAFEARRAVNAIWFLNLAVADLLSCLALPVLFTTVLNHNYWYFDATACIVLPSLILLNMYASILLLATISADRFLLVFKPIWCQKVRGTGLAWMACGVAWVLALLLTIPSFVYREAYKDFYSEHTVCGINYGGGSFPKEKAVAILRLMVGFVLPLLTLNICYTFLLLRTWSRKATRSTKTLKVVMAVVICFFIFWLPYQVTGVMIAWLPPSSPTLKRVEKLNSLCVSLAYINCCVNPIIYVMAGQGFHGRLLRSLPSII...
amyloid-beta clearance astrocyte activation cell proliferation in hindbrain cognition complement component C5a signaling pathway complement receptor mediated signaling pathway defense response to Gram-positive bacterium inflammatory response microglial cell activation mRNA transcription by RNA polymerase II negative re...
axonogenesis brain morphogenesis cell migration cell-cell adhesion dendrite morphogenesis epithelial cell differentiation neural crest cell migration protein localization regulation of synapse structural plasticity trigeminal ganglion formation
actin cytoskeleton; adherens junction; axon; catenin complex; cytoplasm; cytosol; nucleus; plasma membrane
actin filament binding beta-catenin binding cadherin binding structural molecule activity
Gallus gallus
Cell adhesion Cell junction Cell membrane Cell projection Cytoplasm Cytoskeleton Developmental protein Differentiation Membrane Nucleus Reference proteome
MTSATSPIIL
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVLAASVEQATQNFLEKGDQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKRGTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFGKEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANRDYVFKQVQEAIAGISNAAQATSPTDENKGHTGIGELAAALNEFDNKIILDPMTFSEARFRPSLEERLESIISGAALMADS...
axonogenesis brain morphogenesis cell migration cell-cell adhesion dendrite morphogenesis epithelial cell differentiation neural crest cell migration protein localization regulation of synapse structural plasticity trigeminal ganglion formation actin cytoskeleton; adherens junction; axon; catenin complex; cytoplasm; cy...
cell adhesion cell-cell adhesion cell-cell adhesion mediated by cadherin cell-cell junction assembly epithelial cell differentiation involved in salivary gland development glomerulus morphogenesis kidney development morphogenesis of a polarized epithelium negative regulation of canonical Wnt signaling pathway positive ...
adherens junction; apicolateral plasma membrane; bicellular tight junction; catenin complex; cell surface; cell-cell junction; cytoplasm; cytosol; dendritic spine; flotillin complex; glutamatergic synapse; growth cone; hippocampal mossy fiber to CA3 synapse; lamellipodium; membrane; midbody; nucleus; plasma membrane; p...
beta-catenin binding cadherin binding cell adhesion molecule binding protein domain specific binding protein kinase binding protein phosphatase binding protein sequestering activity protein tyrosine kinase binding signaling receptor binding
Mus musculus
Acetylation Alternative splicing Cell adhesion Cell junction Cell membrane Coiled coil Cytoplasm Isopeptide bond Membrane Nucleus Phosphoprotein Reference proteome Repeat Transcription Transcription regulation Ubl conjugation Wnt signaling pathway
MDDSEVESTA
MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANSLMANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQDHNHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETTDDGTTRRTETTVKKVVKTMTTRTVQPVPMGPDGLPVDASAVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYGRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRS...
cell adhesion cell-cell adhesion cell-cell adhesion mediated by cadherin cell-cell junction assembly epithelial cell differentiation involved in salivary gland development glomerulus morphogenesis kidney development morphogenesis of a polarized epithelium negative regulation of canonical Wnt signaling pathway positive ...
astrocyte development Bergmann glial cell differentiation cellular response to fibroblast growth factor stimulus cellular response to lipopolysaccharide cellular response to muramyl dipeptide cellular response to type II interferon decidualization fat cell differentiation intermediate filament organization intermediate...
axon; cell body; cell leading edge; cell projection; cytoplasm; cytoskeleton; cytosol; intermediate filament; neuron projection; nuclear matrix; perinuclear region of cytoplasm; peroxisome; phagocytic vesicle; plasma membrane; polysome; ribonucleoprotein complex; type III intermediate filament
double-stranded RNA binding identical protein binding keratin filament binding kinase binding molecular adaptor activity protein domain specific binding protein phosphatase 2A binding protein tyrosine kinase binding RNA binding scaffold protein binding structural constituent of cytoskeleton structural constituent of ey...
Rattus norvegicus
Acetylation Cell membrane Coiled coil Cytoplasm Cytoskeleton Direct protein sequencing Glycoprotein Intermediate filament Isopeptide bond Membrane Nucleus Phosphoprotein Reference proteome S-nitrosylation Ubl conjugation
MSTRSVSSSS
MSTRSVSSSSYRRMFGGSGTSSRPSSNRSYVTTSTRTYSLGSALRPSTSRSLYSSSPGGAYVTRSSAVRLRSSMPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYR...
astrocyte development Bergmann glial cell differentiation cellular response to fibroblast growth factor stimulus cellular response to lipopolysaccharide cellular response to muramyl dipeptide cellular response to type II interferon decidualization fat cell differentiation intermediate filament organization intermediate...
intermediate filament organization muscle organ development skeletal muscle organ development
cardiac myofibril; cell-cell junction; contractile fiber; cytoplasm; cytoskeleton; fascia adherens; gap junction; intercalated disc; intermediate filament cytoskeleton; neuromuscular junction; nucleus; sarcolemma; type III intermediate filament; Z disc
cytoskeletal protein binding identical protein binding structural constituent of cytoskeleton
Mus musculus
ADP-ribosylation Cell membrane Coiled coil Cytoplasm Intermediate filament Membrane Methylation Muscle protein Nucleus Phosphoprotein Reference proteome Ubl conjugation
MSQAYSSSQR
MSQAYSSSQRVSSYRRTFGGAPGFSLGSPLSSPVFPRAGFGTKGSSSSMTSRVYQVSRTSGGAGGLGSLRSSRLGTTRAPSYGAGELLDFSLADAVNQEFLATRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEEMRELRRQVEVLTNQRARVDVERDNLIDDLQRLKAKLQEEIQLREEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEM...
intermediate filament organization muscle organ development skeletal muscle organ development cardiac myofibril; cell-cell junction; contractile fiber; cytoplasm; cytoskeleton; fascia adherens; gap junction; intercalated disc; intermediate filament cytoskeleton; neuromuscular junction; nucleus; sarcolemma; type III int...
methanol catabolic process
cytoplasm
magnesium ion binding methanol dehydrogenase activity zinc ion binding
Bacillus methanolicus
Cytoplasm Direct protein sequencing Magnesium Methanol utilization NAD Oxidoreductase Zinc
MTNFFIPPAS
MTNFFIPPASVIGRGAVKEVGTRLKQIGAKKALIVTDAFLHSTGLSEEVAKNIREAGLDVAIFPKAQPDPADTQVHEGVDVFKQENCDALVSIGGGSSHDTAKAIGLVAANGGRINDYQGVNSVEKPVVPVVAITTTAGTGSETTSLAVITDSARKVKMPVIDEKITPTVAIVDPELMVKKPAGLTIATGMDALSHAIEAYVAKGATPVTDAFAIQAMKLINEYLPKAVANGEDIEAREAMAYAQYMAGVAFNNGGLGLVHSISHQVGGVYKLQHGICNSVNMPHVCAFNLIAKTERFAHIAELLGENVSGLSTAAAAER...
methanol catabolic process cytoplasm magnesium ion binding methanol dehydrogenase activity zinc ion binding Bacillus methanolicusCytoplasm Direct protein sequencing Magnesium Methanol utilization NAD Oxidoreductase Zinc MTNFFIPPAS MTNFFIPPASVIGRGAVKEVGTRLKQIGAKKALIVTDAFLHSTGLSEEVAKNIREAGLDVAIFPKAQPDPADTQVHEGVDVFKQENCDA...
phosphorylation purine nucleotide metabolic process
cytosol; photoreceptor inner segment
ATP binding guanylate kinase activity nucleoside monophosphate kinase activity
Sus scrofa
Acetylation ATP-binding Cytoplasm Direct protein sequencing Kinase Nucleotide-binding Reference proteome Transferase
MGSPRPVVLS
MGSPRPVVLSGPSGAGKSTLLKKLLQEHSSIFGFSVSHTTRDPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKAAVRAVQAMNRICVLDVDLQGVRNIKKTDLQPIYIFVQPPSLDVLEQRLRQRNTETEESLAKRLAAAKADMESSKEPGLFDLIIINDSLDKAYWALKEALSEEIKKAQATGHS
phosphorylation purine nucleotide metabolic process cytosol; photoreceptor inner segment ATP binding guanylate kinase activity nucleoside monophosphate kinase activity Sus scrofa Acetylation ATP-binding Cytoplasm Direct protein sequencing Kinase Nucleotide-binding Reference proteome Transferase MGSPRPVVLS MGSPRPVVLSGPS...
adhesion of symbiont to host cell phagocytosis positive regulation of phagocytosis protein localization to phagocytic vesicle small GTPase mediated signal transduction
cell projection; cytoskeleton; phagocytic cup; phagocytic vesicle
GTP binding GTPase activity magnesium ion binding
Entamoeba histolytica
3D-structure Cell membrane Cell projection Cytoplasm Cytoplasmic vesicle Cytoskeleton GTP-binding Hydrolase Lipoprotein Magnesium Membrane Metal-binding Methylation Nucleotide-binding Phagocytosis Prenylation Reference proteome
MLAFSDMNTG
MLAFSDMNTGAGKIENGKKALKIVVVGDGAVGKTCLLLAFSKGEIPTAYVPTVFENFSHVMKYKNEEFILHLWDTAGQEEYDRLRPLSYADSDVVLLCFAVNNRTSFDNISTKWEPEIKHYIDTAKTVLVGLKVDLRKDGSDDVTKQEGDDLCQKLGCVAYIEASSVAKIGLNEVFEKSVDCIFSNKPVPKASVTTQAKSQESTQQKKKSKCLLQ
adhesion of symbiont to host cell phagocytosis positive regulation of phagocytosis protein localization to phagocytic vesicle small GTPase mediated signal transduction cell projection; cytoskeleton; phagocytic cup; phagocytic vesicle GTP binding GTPase activity magnesium ion binding Entamoeba histolytica 3D-structure C...
proteolysis response to stimulus sensory perception of taste
extracellular region; extracellular space
chloride ion binding cysteine-type endopeptidase inhibitor activity signaling receptor binding small molecule binding zinc ion binding
Homo sapiens
3D-structure Direct protein sequencing Disulfide bond Reference proteome Secreted Sensory transduction Signal Taste Transport
MKPLLLAVSL
MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD
proteolysis response to stimulus sensory perception of taste extracellular region; extracellular space chloride ion binding cysteine-type endopeptidase inhibitor activity signaling receptor binding small molecule binding zinc ion binding Homo sapiens 3D-structure Direct protein sequencing Disulfide bond Reference prote...
eating behavior hippocampus development MAPK cascade negative regulation of MAPK cascade negative regulation of protein phosphorylation positive regulation of acetylcholine biosynthetic process positive regulation of acetylcholine metabolic process positive regulation of cAMP-mediated signaling positive regulation of m...
apical part of cell; axon terminus; cell surface; extracellular space; mitochondrial outer membrane; neuronal cell body; synaptic vesicle
ATP binding enzyme binding kinase binding lipid binding mitogen-activated protein kinase binding protein kinase binding receptor serine/threonine kinase binding serine-type endopeptidase inhibitor activity signaling receptor binding
Rattus norvegicus
3D-structure Acetylation ATP-binding Cytoplasm Direct protein sequencing Disulfide bond Lipid-binding Membrane Nucleotide-binding Phosphoprotein Protease inhibitor Reference proteome Serine protease inhibitor
MAADISQWAG
MAADISQWAGPLSLQEVDEPPQHALRVDYGGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPKFREWHHFLVVNMKGNDISSGTVLSEYVGSGPPKDTGLHRYVWLVYEQEQPLNCDEPILSNKSGDNRGKFKVESFRKKYHLGAPVAGTCFQAEWDDSVPKLHDQLAGK
eating behavior hippocampus development MAPK cascade negative regulation of MAPK cascade negative regulation of protein phosphorylation positive regulation of acetylcholine biosynthetic process positive regulation of acetylcholine metabolic process positive regulation of cAMP-mediated signaling positive regulation of m...
glycolytic process
cytoplasm
dihydrolipoyl dehydrogenase activity flavin adenine dinucleotide binding
Pseudomonas putida
Cytoplasm Direct protein sequencing Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center
MTQKFDVVVI
MTQKFDVVVIGAGPGGYVAAIKAAQLGLKTACIEKYTDAEGKLALGGTCLNVGCIPSKALLDSSWKYKEAKESFNVHGISTGEVKMDVAAMVGRKAGIVKNLTGGVATLFKANGVTSIQGHGKLLAGKKVEVTKADGTTEVIEAENVILASGSRPIDIPPAPVDQNVIVDSTGALEFQAVPKRLGVIGAGVIGLELGSVWARLGAEVTVLEALDTFLMAADTAVSKEAQKTLTKQGLDIKLGARVTGSKVNGNEVEVTYTNAEGEQKITFDKLIVAVGRRPVTTDLLAADSGVTIDERGYIFVDDYCATSVPGVYAIGDV...
glycolytic process cytoplasm dihydrolipoyl dehydrogenase activity flavin adenine dinucleotide binding Pseudomonas putida Cytoplasm Direct protein sequencing Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center MTQKFDVVVI MTQKFDVVVIGAGPGGYVAAIKAAQLGLKTACIEKYTDAEGKLALGGTCLNVGCIPSKALLDSSWKYKEA...
pantothenate biosynthetic process
cytoplasm; cytosol; membrane
3-methyl-2-oxobutanoate hydroxymethyltransferase activity identical protein binding magnesium ion binding
Escherichia coli
3D-structure Cytoplasm Direct protein sequencing Magnesium Metal-binding Pantothenate biosynthesis Reference proteome Transferase
MKPTTISLLQ
MKPTTISLLQKYKQEKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTAAVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVQMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEAGDQLLSDALALEAAGAQLLVLECVPVELAKRITEALAIPVIGIGAGNVTDGQILVMHDAFGITGGHIPKFAKNFLAETGDIRAAVRQYMAEVESGVYPGEEHSFH
pantothenate biosynthetic process cytoplasm; cytosol; membrane 3-methyl-2-oxobutanoate hydroxymethyltransferase activity identical protein binding magnesium ion binding Escherichia coli 3D-structure Cytoplasm Direct protein sequencing Magnesium Metal-binding Pantothenate biosynthesis Reference proteome Transferase MKPT...
monoatomic ion transmembrane transport potassium ion transport
plasma membrane; protein-containing complex
identical protein binding
Escherichia coli
3D-structure Cell inner membrane Cell membrane Ion channel Ion transport Membrane Reference proteome Transmembrane Transmembrane helix Transport
MSHWATFKQT
MSHWATFKQTATNLWVTLRHDILALAVFLNGLLIFKTIYGMSVNLLDIFHIKAFSELDLSLLANAPLFMLGVFLVLNSIGLLFRAKLAWAISIILLLIALIYTLHFYPWLKFSIGFCIFTLVFLLILRKDFSHSSAAAGTIFAFISFTTLLFYSTYGALYLSEGFNPRIESLMTAFYFSIETMSTVGYGDIVPVSESARLFTISVIISGITVFATSMTSIFGPLIRGGFNKLVKGNNHTMHRKDHFIVCGHSILAINTILQLNQRGQNVTVISNLPEDDIKQLEQRLGDNADVIPGDSNDSSVLKKAGIDRCRAILALSD...
monoatomic ion transmembrane transport potassium ion transport plasma membrane; protein-containing complex identical protein binding Escherichia coli 3D-structure Cell inner membrane Cell membrane Ion channel Ion transport Membrane Reference proteome Transmembrane Transmembrane helix Transport MSHWATFKQT MSHWATFKQTATNL...
apoptotic mitochondrial changes mitochondrial unfolded protein response positive regulation of interferon-alpha production positive regulation of interleukin-6 production positive regulation of T cell activation positive regulation of type II interferon production protein folding protein import into mitochondrial inter...
chaperonin-containing T-complex; cytoplasm; mitochondrial inner membrane; mitochondrial matrix; protein-containing complex
ATP binding ATP-dependent protein folding chaperone isomerase activity protein-folding chaperone binding
Bos taurus
Acetylation ATP-binding Chaperone Direct protein sequencing Isomerase Isopeptide bond Mitochondrion Nucleotide-binding Phosphoprotein Reference proteome Transit peptide Ubl conjugation
MLRLPAVLRQ
MLRLPAVLRQMRPVSRALALHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPRVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIVELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIAT...
apoptotic mitochondrial changes mitochondrial unfolded protein response positive regulation of interferon-alpha production positive regulation of interleukin-6 production positive regulation of T cell activation positive regulation of type II interferon production protein folding protein import into mitochondrial inter...
photosynthetic electron transport in photosystem I
photosystem I; plasma membrane-derived thylakoid membrane
4 iron, 4 sulfur cluster binding electron transfer activity metal ion binding
Synechococcus sp.
4Fe-4S Direct protein sequencing Electron transport Iron Iron-sulfur Membrane Metal-binding Oxidoreductase Photosynthesis Photosystem I Repeat Thylakoid Transport
MSHSVKIYDT
MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIAASPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY
photosynthetic electron transport in photosystem I photosystem I; plasma membrane-derived thylakoid membrane 4 iron, 4 sulfur cluster binding electron transfer activity metal ion binding Synechococcus sp. 4Fe-4S Direct protein sequencing Electron transport Iron Iron-sulfur Membrane Metal-binding Oxidoreductase Photosy...
photosynthetic electron transport in photosystem I
photosystem I; plasma membrane-derived thylakoid membrane
4 iron, 4 sulfur cluster binding electron transfer activity ion binding metal ion binding molecular adaptor activity
Synechococcus sp.
3D-structure 4Fe-4S Direct protein sequencing Electron transport Iron Iron-sulfur Membrane Metal-binding Oxidoreductase Photosynthesis Photosystem I Reference proteome Repeat Thylakoid Transport
MSHSVKIYDT
MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY
photosynthetic electron transport in photosystem I photosystem I; plasma membrane-derived thylakoid membrane 4 iron, 4 sulfur cluster binding electron transfer activity ion binding metal ion binding molecular adaptor activity Synechococcus sp. 3D-structure 4Fe-4S Direct protein sequencing Electron transport Iron Iron-...
biomineral tissue development cell adhesion osteoblast differentiation positive regulation of bone resorption
extracellular region; extracellular space
cytokine activity extracellular matrix binding integrin binding
Bos taurus
Biomineralization Cell adhesion Cytokine Direct protein sequencing Glycoprotein Phosphoprotein Proteoglycan Reference proteome Secreted Sialic acid Signal
MRIAVICFCL
MRIAVICFCLLGIASALPVKPTSSGSSEEKQLNNKYPDAVATWLKPDPSQKQTFLAPQNSVSSEETDDNKQNTLPSKSNESPEQTDDLDDDDDNSQDVNSNDSDDAETTDDPDHSDESHHSDESDEVDFPTDIPTIAVFTPFIPTESANDGRGDSVAYGLKSRSKKFRRSNVQSPDATEEDFTSHIESEEMHDAPKKTSQLTDHSKETNSSELSKELTPKAKDKNKHSNLIESQENSKLSQEFHSLEDKLDLDHKSEEDKHLKIRISHELDSASSEVN
biomineral tissue development cell adhesion osteoblast differentiation positive regulation of bone resorption extracellular region; extracellular space cytokine activity extracellular matrix binding integrin binding Bos taurus Biomineralization Cell adhesion Cytokine Direct protein sequencing Glycoprotein Phosphoprotei...
arachidonic acid secretion lipid catabolic process phospholipid metabolic process
extracellular region
calcium ion binding phospholipase A2 activity phospholipase A2 inhibitor activity toxin activity
Daboia siamensis
3D-structure Calcium Direct protein sequencing Disulfide bond Hydrolase Lipid degradation Lipid metabolism Metal-binding Neurotoxin Phospholipase A2 inhibitor Presynaptic neurotoxin Secreted Signal Toxin
MRTLWIVAVC
MRTLWIVAVCLIGVEGNLFQFGEMILEKTGKEVVHSYAIYGCYCGWGGQGRAQDATDRCCFVHDCCYGTVNDCNPKTATYSYSFENGDIVCGDNDLCLRTVCECDRAAAICLGQNVNTYDKNYEYYSISHCTEESEQC
arachidonic acid secretion lipid catabolic process phospholipid metabolic process extracellular region calcium ion binding phospholipase A2 activity phospholipase A2 inhibitor activity toxin activity Daboia siamensis 3D-structure Calcium Direct protein sequencing Disulfide bond Hydrolase Lipid degradation Lipid metabo...
defense response to fungus defense response to Gram-negative bacterium defense response to Gram-positive bacterium innate immune response killing of cells of another organism
extracellular region; membrane; other organism cell membrane
guanyl-nucleotide exchange factor activity
Phyllomedusa bicolor
Amidation Amphibian defense peptide Antibiotic Antimicrobial Cleavage on pair of basic residues Direct protein sequencing Fungicide Immunity Innate immunity Membrane Secreted Signal Target cell membrane Target membrane
MAFLKKSLFL
MAFLKKSLFLVLFLGLVSLSICEEEKRENEDEEEQEDDEQSEMKRGLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAVGEQ
defense response to fungus defense response to Gram-negative bacterium defense response to Gram-positive bacterium innate immune response killing of cells of another organism extracellular region; membrane; other organism cell membrane guanyl-nucleotide exchange factor activity Phyllomedusa bicolor Amidation Amphibian...
ascospore-type prospore assembly endocytosis exocytosis Golgi to endosome transport Golgi to plasma membrane transport Golgi vesicle fusion to target membrane intracellular protein transport retrograde transport, endosome to Golgi SNARE complex assembly sporulation vesicle fusion vesicle fusion to plasma membrane vesic...
cell periphery; cellular bud; cellular bud neck; cytosol; endosome; endosome membrane; Golgi membrane; plasma membrane; prospore membrane; SNARE complex; trans-Golgi network; transport vesicle membrane
molecular adaptor activity SNAP receptor activity SNARE binding syntaxin binding
Saccharomyces cerevisiae
3D-structure Coiled coil Isopeptide bond Lipoprotein Membrane Palmitate Reference proteome Transmembrane Transmembrane helix Ubl conjugation
MSSSTPFDPY
MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMCLALVIIILLVVIIVPIAVHFSR
ascospore-type prospore assembly endocytosis exocytosis Golgi to endosome transport Golgi to plasma membrane transport Golgi vesicle fusion to target membrane intracellular protein transport retrograde transport, endosome to Golgi SNARE complex assembly sporulation vesicle fusion vesicle fusion to plasma membrane vesic...
homologous chromosome pairing at meiosis homologous recombination negative regulation of reciprocal meiotic recombination positive regulation of protein sumoylation protein localization to site of double-strand break reciprocal meiotic recombination
chromosome, centromeric region; condensed nuclear chromosome; synaptonemal complex; transverse filament
SUMO polymer binding
Saccharomyces cerevisiae
Chromosome Coiled coil Meiosis Nucleus Phosphoprotein Reference proteome
MSNFFRDSSM
MSNFFRDSSMGFKPRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTSTEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIENDTDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKAPLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQSYASNSDKINEKVGKYKSCLETLQERIATLTSHKNNQETKLKDLRQNHQLYQRRISGFKTSIENLNKTINDLGKNKKEADAELMKKGKEIEYLKRELDDCSGQLSEE...
homologous chromosome pairing at meiosis homologous recombination negative regulation of reciprocal meiotic recombination positive regulation of protein sumoylation protein localization to site of double-strand break reciprocal meiotic recombination chromosome, centromeric region; condensed nuclear chromosome; synapton...
mRNA pseudouridine synthesis tRNA pseudouridine synthesis
cytoplasm; nucleus
pseudouridine synthase activity RNA binding tRNA pseudouridine synthase activity
Saccharomyces cerevisiae
Isomerase Nucleus Reference proteome tRNA processing
MSNFIRRLVG
MSNFIRRLVGKMKAISTGTNAIVSKKDSIYANWSKEQLIRRITELENANKPHSEKFQHIEDNKKRKISQEEVTRSKAKKAPKKFDFSKHNTRFIALRFAYLGWNYNGLAVQKEYTPLPTVEGTILEAMNKCKLVPSMVLQDYKFSRCGRTDKGVSAMNQVISLEVRSNLTDEEQRDPTNDSREIPYVHVLNQLLPDDIRISAVCLRPPPNFDARFSCVHRHYKYIFNGKNLNIEKMSKAASYFVGERDFRNFCKLDGSKQITNFKRTIISSKILPLSETFYCFDLVGSAFLWHQVRCMMAILFLVGQSLEVPEIVLRLTD...
mRNA pseudouridine synthesis tRNA pseudouridine synthesis cytoplasm; nucleus pseudouridine synthase activity RNA binding tRNA pseudouridine synthase activity Saccharomyces cerevisiae Isomerase Nucleus Reference proteome tRNA processing MSNFIRRLVG MSNFIRRLVGKMKAISTGTNAIVSKKDSIYANWSKEQLIRRITELENANKPHSEKFQHIEDNKKRKISQEEV...
aspartate family amino acid biosynthetic process homoserine biosynthetic process isoleucine biosynthetic process methionine biosynthetic process threonine biosynthetic process
cytoplasm; nucleus
aspartate kinase activity homoserine dehydrogenase activity NADP binding
Saccharomyces cerevisiae
3D-structure Amino-acid biosynthesis Branched-chain amino acid biosynthesis Direct protein sequencing Isoleucine biosynthesis Isopeptide bond Methionine biosynthesis NADP Oxidoreductase Reference proteome Threonine biosynthesis Ubl conjugation
MSTKVVNVAV
MSTKVVNVAVIGAGVVGSAFLDQLLAMKSTITYNLVLLAEAERSLISKDFSPLNVGSDWKAALAASTTKTLPLDDLIAHLKTSPKPVILVDNTSSAYIAGFYTKFVENGISIATPNKKAFSSDLATWKALFSNKPTNGFVYHEATVGAGLPIISFLREIIQTGDEVEKIEGIFSGTLSYIFNEFSTSQANDVKFSDVVKVAKKLGYTEPDPRDDLNGLDVARKVTIVGRISGVEVESPTSFPVQSLIPKPLESVKSADEFLEKLSDYDKDLTQLKKEAATENKVLRFIGKVDVATKSVSVGIEKYDYSHPFASLKGSDNV...
aspartate family amino acid biosynthetic process homoserine biosynthetic process isoleucine biosynthetic process methionine biosynthetic process threonine biosynthetic process cytoplasm; nucleus aspartate kinase activity homoserine dehydrogenase activity NADP binding Saccharomyces cerevisiae 3D-structure Amino-acid bi...
fatty acid metabolic process phospholipid biosynthetic process
membrane; plasma membrane
acyl--phospholipid O-acyltransferase activity ATP binding long-chain fatty acid ligase activity long-chain fatty acid-CoA ligase activity
Escherichia coli
Acyltransferase ATP-binding Cell inner membrane Cell membrane Ligase Membrane Multifunctional enzyme Nucleotide-binding Reference proteome Transferase Transmembrane Transmembrane helix
MLFSFFRNLC
MLFSFFRNLCRVLYRVRVTGDTQALKGERVLITPNHVSFIDGILLGLFLPVRPVFAVYTSISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDGAGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVAMPDAPRARDRRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTKTLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRMPAMMNYTAGVKGLTSAITAAEIKTIFTSRQFLDKGKLWH...
fatty acid metabolic process phospholipid biosynthetic process membrane; plasma membrane acyl--phospholipid O-acyltransferase activity ATP binding long-chain fatty acid ligase activity long-chain fatty acid-CoA ligase activity Escherichia coli Acyltransferase ATP-binding Cell inner membrane Cell membrane Ligase Membra...
carbohydrate metabolic process peptidoglycan biosynthetic process UDP-N-acetylglucosamine biosynthetic process
cytosol
identical protein binding magnesium ion binding phosphoglucosamine mutase activity phosphomannomutase activity
Escherichia coli
Direct protein sequencing Isomerase Magnesium Metal-binding Phosphoprotein Reference proteome
MSNRKYFGTD
MSNRKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVLARHGSRKIIIGKDTRISGYMLESALEAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLPDAVEEAIEAEMEKEISCVDSAELGKASRIVDAAGRYIEFCKATFPNELSLSELKIVVDCANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATDVRALQARVLAEKADLGIAFDGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRGGAVGTLMSNMGLELALKQLGIPFARAKVGDRYVLEKMQEKGW...
carbohydrate metabolic process peptidoglycan biosynthetic process UDP-N-acetylglucosamine biosynthetic process cytosol identical protein binding magnesium ion binding phosphoglucosamine mutase activity phosphomannomutase activity Escherichia coli Direct protein sequencing Isomerase Magnesium Metal-binding Phosphoprotei...
cell adhesion involved in single-species biofilm formation metabolic process negative regulation of bacterial-type flagellum assembly negative regulation of bacterial-type flagellum-dependent cell motility positive regulation of single-species biofilm formation on inanimate substrate
cell pole; plasma membrane
diguanylate cyclase activity GTP binding identical protein binding protein homodimerization activity zinc ion binding
Escherichia coli
3D-structure Allosteric enzyme GTP-binding Magnesium Metal-binding Nucleotide-binding Reference proteome Transferase
MIKKTTEIDA
MIKKTTEIDAILLNLNKAIDAHYQWLVSMFHSVVARDASKPEITDNHSYGLCQFGRWIDHLGPLDNDELPYVRLMDSAHQHMHNCGRELMLAIVENHWQDAHFDAFQEGLLSFTAALTDYKIYLLTIRSNMDVLTGLPGRRVLDESFDHQLRNAEPLNLYLMLLDIDRFKLVNDTYGHLIGDVVLRTLATYLASWTRDYETVYRYGGEEFIIIVKAANDEEACRAGVRICQLVDNHAITHSEGHINITVTAGVSRAFPEEPLDVVIGRADRAMYEGKQTGRNRCMFIDEQNVINRV
cell adhesion involved in single-species biofilm formation metabolic process negative regulation of bacterial-type flagellum assembly negative regulation of bacterial-type flagellum-dependent cell motility positive regulation of single-species biofilm formation on inanimate substrate cell pole; plasma membrane diguanyl...
putrescine transport
ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing; membrane; outer membrane-bounded periplasmic space
putrescine binding
Escherichia coli
3D-structure Direct protein sequencing Disulfide bond Periplasm Reference proteome Signal Transport
MTALNKKWLS
MTALNKKWLSGLVAGALMAVSVGTLAAEQKTLHIYNWSDYIAPDTVANFEKETGIKVVYDVFDSNEVLEGKLMAGSTGFDLVVPSASFLERQLTAGVFQPLDKSKLPEWKNLDPELLKLVAKHDPDNKFAMPYMWATTGIGYNVDKVKAVLGENAPVDSWDLILKPENLEKLKSCGVSFLDAPEEVFATVLNYLGKDPNSTKADDYTGPATDLLLKLRPNIRYFHSSQYINDLANGDICVAIGWAGDVWQASNRAKEAKNGVNVSFSIPKEGAMAFFDVFAMPADAKNKDEAYQFLNYLLRPDVVAHISDHVFYANANKA...
putrescine transport ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing; membrane; outer membrane-bounded periplasmic space putrescine binding Escherichia coli 3D-structure Direct protein sequencing Disulfide bond Periplasm Reference proteome Signal Transport MTALNKKWLS MTALNKKWLSGLVAG...
putrescine transport
ATP-binding cassette (ABC) transporter complex; ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing; membrane
ABC-type putrescine transporter activity ATP binding ATP hydrolysis activity
Escherichia coli
ATP-binding Cell inner membrane Cell membrane Membrane Nucleotide-binding Reference proteome Translocase Transport
MNDAIPRPQA
MNDAIPRPQAKTRKALTPLLEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIMLDGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASRVNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNVFEGVLKERQEDGLVLDSPGLVHPLKVDADASVVDNVPVHVALRPEKIMLCEEPPANGCNFAVGEV...
putrescine transport ATP-binding cassette (ABC) transporter complex; ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing; membrane ABC-type putrescine transporter activity ATP binding ATP hydrolysis activity Escherichia coli ATP-binding Cell inner membrane Cell membrane Membrane Nucleot...
DNA protection response to antibiotic response to oxidative stress
cytosol
3-mercaptopyruvate sulfurtransferase activity thiosulfate sulfurtransferase activity
Escherichia coli
3D-structure Cytoplasm Direct protein sequencing Reference proteome Repeat Transferase
MSTTWFVGAD
MSTTWFVGADWLAEHIDDPEIQIIDARMASPGQEDRNVAQEYLNGHIPGAVFFDIEALSDHTSPLPHMLPRPETFAVAMRELGVNQDKHLIVYDEGNLFSAPRAWWMLRTFGVEKVSILGGGLAGWQRDDLLLEEGAVELPEGEFNAAFNPEAVVKVTDVLLASHENTAQIIDARPAARFNAEVDEPRPGLRRGHIPGALNVPWTELVREGELKTTDELDAIFFGRGVSYDKPIIVSCGSGVTAAVVLLALATLDVPNVKLYDGAWSEWGARADLPVEPVK
DNA protection response to antibiotic response to oxidative stress cytosol 3-mercaptopyruvate sulfurtransferase activity thiosulfate sulfurtransferase activity Escherichia coli 3D-structure Cytoplasm Direct protein sequencing Reference proteome Repeat Transferase MSTTWFVGAD MSTTWFVGADWLAEHIDDPEIQIIDARMASPGQEDRNVAQEYLNG...
actin cytoskeleton organization actin filament organization calcium ion transport cell migration cell-substrate adhesion cellular response to interleukin-4 early endosome to recycling endosome transport epithelial cell migration homeostasis of number of cells within a tissue innate immune response leukocyte chemotaxis ...
actin filament; axon; cell-cell junction; cortical actin cytoskeleton; cytoplasm; cytosol; early endosome; extracellular exosome; glutamatergic synapse; immunological synapse; lamellipodium; membrane; phagocytic cup; phagocytic vesicle; phagocytic vesicle membrane; plasma membrane; protein-containing complex
actin binding actin filament binding actin monomer binding cytoskeletal protein binding myosin heavy chain binding phosphatidylinositol 3-kinase binding protein homodimerization activity RNA binding
Homo sapiens
Acetylation Actin-binding Coiled coil Cytoplasm Cytoplasmic vesicle Cytoskeleton Direct protein sequencing Disease variant Membrane Phosphoprotein Reference proteome Repeat Ubl conjugation WD repeat
MSRQVVRSSK
MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIYSVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMG...
actin cytoskeleton organization actin filament organization calcium ion transport cell migration cell-substrate adhesion cellular response to interleukin-4 early endosome to recycling endosome transport epithelial cell migration homeostasis of number of cells within a tissue innate immune response leukocyte chemotaxis ...
negative regulation of axonogenesis negative regulation of protein targeting to membrane positive regulation of axon extension protein transport Rab protein signal transduction response to calcium ion signal transduction vesicle-mediated transport
axon; cytoplasm; cytosol; Golgi apparatus; midbody; myelin sheath; neuronal cell body; presynaptic cytosol; protein-containing complex
GDP-dissociation inhibitor activity GTPase activator activity Rab GDP-dissociation inhibitor activity small GTPase binding
Homo sapiens
Cytoplasm Direct protein sequencing Disease variant Golgi apparatus GTPase activation Intellectual disability Reference proteome
MDEEYDVIVL
MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDANSCQII...
negative regulation of axonogenesis negative regulation of protein targeting to membrane positive regulation of axon extension protein transport Rab protein signal transduction response to calcium ion signal transduction vesicle-mediated transport axon; cytoplasm; cytosol; Golgi apparatus; midbody; myelin sheath; neuro...
angiogenesis antimicrobial humoral immune response mediated by antimicrobial peptide epidermis development keratinocyte differentiation positive regulation of ERK1 and ERK2 cascade positive regulation of granulocyte chemotaxis positive regulation of monocyte chemotaxis positive regulation of T cell chemotaxis response ...
azurophil granule lumen; collagen-containing extracellular matrix; cytoplasm; cytosol; endoplasmic reticulum; extracellular region; extracellular space; focal adhesion; nucleus
calcium ion binding calcium-dependent protein binding RAGE receptor binding zinc ion binding zinc ion sequestering activity
Homo sapiens
3D-structure Acetylation Calcium Cytoplasm Direct protein sequencing Disulfide bond Metal-binding Reference proteome Repeat Secreted Zinc
MSNTQAERSI
MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
angiogenesis antimicrobial humoral immune response mediated by antimicrobial peptide epidermis development keratinocyte differentiation positive regulation of ERK1 and ERK2 cascade positive regulation of granulocyte chemotaxis positive regulation of monocyte chemotaxis positive regulation of T cell chemotaxis response ...
cell cycle intracellular signal transduction protein phosphorylation
cytoplasm; cytosol; nucleoplasm; nucleus
ATP binding MAP kinase activity protein heterodimerization activity protein homodimerization activity protein kinase binding protein serine kinase activity protein serine/threonine kinase activity
Homo sapiens
ATP-binding Cell cycle Cytoplasm Kinase Nucleotide-binding Nucleus Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase
MAEKGDCIAS
MAEKGDCIASVYGYDLGGRFVDFQPLGFGVNGLVLSAVDSRACRKVAVKKIALSDARSMKHALREIKIIRRLDHDNIVKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGTLAEEHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYSHKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGAHELEQMQLILETIPVIREEDKDELLRVMPSFVSSTWEVKRPLRKLLPEVNSEAIDFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPED...
cell cycle intracellular signal transduction protein phosphorylation cytoplasm; cytosol; nucleoplasm; nucleus ATP binding MAP kinase activity protein heterodimerization activity protein homodimerization activity protein kinase binding protein serine kinase activity protein serine/threonine kinase activity Homo sapiens ...
cellular response to leukemia inhibitory factor one-carbon metabolic process protein heterooligomerization protein hexamerization S-adenosylmethionine biosynthetic process
cytosol; methionine adenosyltransferase complex
ATP binding identical protein binding metal ion binding methionine adenosyltransferase activity small molecule binding
Homo sapiens
3D-structure Acetylation Alternative splicing ATP-binding Isopeptide bond Magnesium Metal-binding Nucleotide-binding One-carbon metabolism Phosphoprotein Potassium Reference proteome Transferase Ubl conjugation
MNGQLNGFHE
MNGQLNGFHEAFIEEGTFLFTSESVGEGHPDKICDQISDAVLDAHLQQDPDAKVACETVAKTGMILLAGEITSRAAVDYQKVVREAVKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGVHLDRNEEDIGAGDQGLMFGYATDETEECMPLTIVLAHKLNAKLAELRRNGTLPWLRPDSKTQVTVQYMQDRGAVLPIRVHTIVISVQHDEEVCLDEMRDALKEKVIKAVVPAKYLDEDTIYHLQPSGRFVIGGPQGDAGLTGRKIIVDTYGGWGAHGGGAFSGKDYTKVDRSAAYAARWVAKSLVKGGLCRRVLVQVSY...
cellular response to leukemia inhibitory factor one-carbon metabolic process protein heterooligomerization protein hexamerization S-adenosylmethionine biosynthetic process cytosol; methionine adenosyltransferase complex ATP binding identical protein binding metal ion binding methionine adenosyltransferase activity smal...
adenine salvage AMP salvage cytokinin metabolic process purine ribonucleoside salvage
chloroplast; cytosol
adenine phosphoribosyltransferase activity
Arabidopsis thaliana
Acetylation Alternative splicing Chloroplast Cytoplasm Glycosyltransferase Plastid Purine salvage Reference proteome Transferase Transit peptide
MQTIIISPLV
MQTIIISPLVSHRLCLARAVPCNRLLNNHHRAPPSIRLSNHRSTTSLRLFSSAAASRDSEMATEDVQDPRIAKIASSIRVIPDFPKPGIMFQDITTLLLDTEAFKDTIALFVDRYKDKGISVVAGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDTIEMHVGAVEPGERAIIIDDLIATGGTLAAAIRLLERVGVKIVECACVIELPELKGKEKLGETSLFVLVKSAA
adenine salvage AMP salvage cytokinin metabolic process purine ribonucleoside salvage chloroplast; cytosol adenine phosphoribosyltransferase activity Arabidopsis thaliana Acetylation Alternative splicing Chloroplast Cytoplasm Glycosyltransferase Plastid Purine salvage Reference proteome Transferase Transit peptide MQTI...
mitochondrial ADP transmembrane transport mitochondrial ATP transmembrane transport purine nucleotide transport
chloroplast; chloroplast envelope; cytosol; mitochondrial envelope; mitochondrial inner membrane; mitochondrion; nucleolus; plant-type cell wall; plant-type vacuole; plasma membrane; vacuole
ATP:ADP antiporter activity copper ion binding mRNA binding
Arabidopsis thaliana
Antiport Membrane Mitochondrion Mitochondrion inner membrane Reference proteome Repeat Transit peptide Transmembrane Transmembrane helix Transport
MVDQVQHPTI
MVDQVQHPTIAQKAAGQFMRSSVSKDVQVGYQRPSMYQRHATYGNYSNAAFQFPPTSRMLATTASPVFVQTPGEKGFTNFALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDAKAAKKGGGGRQFDGLVDVYRKTLKTDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVLLTGDLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGE...
mitochondrial ADP transmembrane transport mitochondrial ATP transmembrane transport purine nucleotide transport chloroplast; chloroplast envelope; cytosol; mitochondrial envelope; mitochondrial inner membrane; mitochondrion; nucleolus; plant-type cell wall; plant-type vacuole; plasma membrane; vacuole ATP:ADP antiporte...
cold acclimation defense response to fungus heat acclimation response to abscisic acid response to cold response to heat response to osmotic stress response to water deprivation
cytosol; nucleus
copper ion binding nickel cation binding
Arabidopsis thaliana
Acetylation Phosphoprotein Reference proteome Repeat Stress response
MAEEYKNNVP
MAEEYKNNVPEHETPTVATEESPATTTEVTDRGLFDFLGKKEEEVKPQETTTLESEFDHKAQISEPELAAEHEEVKENKITLLEELQEKTEEDEENKPSVIEKLHRSNSSSSSSSDEEGEEKKEKKKKIVEGEEDKKGLVEKIKEKLPGHHDKTAEDDVPVSTTIPVPVSESVVEHDHPEEEKKGLVEKIKEKLPGHHDEKAEDSPAVTSTPLVVTEHPVEPTTELPVEHPEEKKGILEKIKEKLPGYHAKTTEEEVKKEKESDD
cold acclimation defense response to fungus heat acclimation response to abscisic acid response to cold response to heat response to osmotic stress response to water deprivation cytosol; nucleus copper ion binding nickel cation binding Arabidopsis thaliana Acetylation Phosphoprotein Reference proteome Repeat Stress res...
chloroplast organization regulation of DNA-templated transcription response to heat response to light stimulus
chloroplast nucleoid; protein folding chaperone complex
protein self-association
Arabidopsis thaliana
3D-structure Chaperone Chloroplast Plastid Reference proteome Stress response Transcription Transcription regulation Transit peptide
MASTLSFAAS
MASTLSFAASALCSPLAPSPSVSSKSATPFSVSFPRKIPSRIRAQDQRENSIDVVQQGQQKGNQGSSVEKRPQQRLTMDVSPFGLLDPLSPMRTMRQMLDTMDRMFEDTMPVSGRNRGGSGVSEIRAPWDIKEEEHEIKMRFDMPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEKDKIKAELKNGVLFITIPKTKVERKVIDVQIQ
chloroplast organization regulation of DNA-templated transcription response to heat response to light stimulus chloroplast nucleoid; protein folding chaperone complex protein self-association Arabidopsis thaliana 3D-structure Chaperone Chloroplast Plastid Reference proteome Stress response Transcription Transcription r...
cell wall organization proteolysis
extracellular matrix; extracellular region
metalloendopeptidase activity zinc ion binding
Chlamydomonas reinhardtii
Cell wall Cell wall biogenesis/degradation Direct protein sequencing Glycoprotein Hydrolase Metal-binding Metalloprotease Periplasm Protease Secreted Signal Zinc Zymogen
MSLATRRFGA
MSLATRRFGAAAALLVAACVLCTAPAWAQNETTGTGMVKTKSAFRWIRPPPARPPPFRRPPPAQTPYVHKVEYTELQILCPQTIDSVTGYPMDDPRCNVPRATVAAGEEALTIRNEFELLNGDVLNVTLEEVDTPENPSRRRLLSIIREEQRTGRVLLATSAELPTPTFRLKSLKSILKGSQKEIYAGKPIDLRTIVYIMDFSSCKLSGWSAPATLTPEKVTSDMLRGASAPTNNLANYYGACSYEKTLFNPDNFLVLGPVPVPCIGGVTPPPRPPRPPRPPPRAGSTISSLSRRNDTYDDWWDLSKYCTASEQQAWERA...
cell wall organization proteolysis extracellular matrix; extracellular region metalloendopeptidase activity zinc ion binding Chlamydomonas reinhardtii Cell wall Cell wall biogenesis/degradation Direct protein sequencing Glycoprotein Hydrolase Metal-binding Metalloprotease Periplasm Protease Secreted Signal Zinc Zymogen...
mRNA 3'-end processing mRNA transport nuclear-transcribed mRNA poly(A) tail shortening regulation of nuclear-transcribed mRNA poly(A) tail shortening regulation of translation
cytoplasm; cytoplasmic stress granule; cytosol; nucleus; post-mRNA release spliceosomal complex; ribonucleoprotein complex
mRNA 3'-UTR binding poly(A) binding poly(U) RNA binding
Schizosaccharomyces pombe
Cytoplasm mRNA processing mRNA transport Nucleus Phosphoprotein Reference proteome Repeat RNA-binding Translation regulation Transport
MPSTDLKKQA
MPSTDLKKQADAAVESDVNTNNEAVESSTKEESSNTPSTETQPEKKAEEPEAAAEPSESTSTPTNASSVATPSGTAPTSASLYVGELDPSVTEAMLFELFNSIGPVASIRVCRDAVTRRSLGYAYVNFHNMEDGEKALDELNYTLIKGRPCRIMWSQRDPSLRKMGTGNVFIKNLDPAIDNKALHDTFSAFGKILSCKVAVDELGNAKGYGFVHFDSVESANAAIEHVNGMLLNDKKVYVGHHVSRRERQSKVEALKANFTNVYIKNLDTEITEQEFSDLFGQFGEITSLSLVKDQNDKPRGFGFVNYANHECAQKAVDE...
mRNA 3'-end processing mRNA transport nuclear-transcribed mRNA poly(A) tail shortening regulation of nuclear-transcribed mRNA poly(A) tail shortening regulation of translation cytoplasm; cytoplasmic stress granule; cytosol; nucleus; post-mRNA release spliceosomal complex; ribonucleoprotein complex mRNA 3'-UTR binding p...
androgen metabolic process bile acid biosynthetic process bile acid catabolic process C21-steroid hormone metabolic process cholesterol catabolic process digestion
cytosol
3-oxo-5-beta-steroid 4-dehydrogenase activity alditol:NADP+ 1-oxidoreductase activity delta4-3-oxosteroid 5beta-reductase activity ketosteroid monooxygenase activity steroid dehydrogenase activity
Rattus norvegicus
Bile acid catabolism Cytoplasm Direct protein sequencing Lipid degradation Lipid metabolism NADP Oxidoreductase Reference proteome Steroid metabolism
MNLSTANHHI
MNLSTANHHIPLNDGNSIPIIGLGTYSDPRPVPGKTFIAVKTAIDEGYRHIDGAYVYRNEHEVGEAIREKVAEGKVKREEIFYCGKLWSTDHDPEMVRPALERTLQTLKLDYIDLYIIEMPMAFKPGEEFYPKDENGRVIYHKSNLCATWEALEACKDAGLVKSLGVSNFNRRQLEVILNKPGLKYKPVTNQVECHPYFTQTKLLEVSASSMTSFIVAYSPLGTCRNPLWVNVSSPPLLKDELLTSLGKKYNKTQAQIVLRFDIQRGLVVIPKSTTPERIKENFQIFDFSLTKEEMKDIEALNKNVRFVEMLMWSDHPEY...
androgen metabolic process bile acid biosynthetic process bile acid catabolic process C21-steroid hormone metabolic process cholesterol catabolic process digestion cytosol 3-oxo-5-beta-steroid 4-dehydrogenase activity alditol:NADP+ 1-oxidoreductase activity delta4-3-oxosteroid 5beta-reductase activity ketosteroid monoo...
glucocorticoid metabolic process
extracellular space
serine-type endopeptidase inhibitor activity steroid binding
Rattus norvegicus
3D-structure Direct protein sequencing Glycoprotein Lipid-binding Reference proteome Secreted Signal Steroid-binding Transport
MSLALYTCLL
MSLALYTCLLWLCTSGLWTAQASTNESSNSHRGLAPTNVDFAFNLYQRLVALNPDKNTLISPVSISMALAMVSLGSAQTQSLQSLGFNLTETSEAEIHQSFQYLNYLLKQSDTGLEMNMGNAMFLLQKLKLKDSFLADVKQYYESEALAIDFEDWTKASQQINQHVKDKTQGKIEHVFSDLDSPASFILVNYIFLRGIWELPFSPENTREEDFYVNETSTVKVPMMVQSGSIGYFRDSVFPCQLIQMDYVGNGTAFFILPDQGQMDTVIAALSRDTIDRWGKLMTPRQVNLYIPKFSISDTYDLKDMLEDLNIKDLLTNQ...
glucocorticoid metabolic process extracellular space serine-type endopeptidase inhibitor activity steroid binding Rattus norvegicus 3D-structure Direct protein sequencing Glycoprotein Lipid-binding Reference proteome Secreted Signal Steroid-binding Transport MSLALYTCLL MSLALYTCLLWLCTSGLWTAQASTNESSNSHRGLAPTNVDFAFNLYQRLV...
androgen biosynthetic process androgen metabolic process biphenyl metabolic process bone development cell differentiation cell-cell signaling dibenzo-p-dioxin metabolic process female genitalia development hippocampus development hypothalamus development male genitalia development male gonad development phthalate metab...
cell body fiber; endoplasmic reticulum membrane; neuronal cell body
3-oxo-5-alpha-steroid 4-dehydrogenase activity 3-oxo-5alpha-steroid 4-dehydrogenase (NADP+) amide binding sterol 5-alpha reductase activity testosterone dehydrogenase activity
Homo sapiens
3D-structure Differentiation Disease variant Endoplasmic reticulum Lipid metabolism Membrane Microsome NADP Oxidoreductase Pseudohermaphroditism Reference proteome Sexual differentiation Transmembrane Transmembrane helix
MQVQCQQSPV
MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCTGNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRIPQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFEDYPKSRKALIPFIF
androgen biosynthetic process androgen metabolic process biphenyl metabolic process bone development cell differentiation cell-cell signaling dibenzo-p-dioxin metabolic process female genitalia development hippocampus development hypothalamus development male genitalia development male gonad development phthalate metab...
androgen biosynthetic process androgen metabolic process biphenyl metabolic process bone development cell differentiation dibenzo-p-dioxin metabolic process female genitalia development hippocampus development hypothalamus development male genitalia development male gonad development phthalate metabolic process respons...
cell body fiber; endoplasmic reticulum membrane; neuronal cell body
3-oxo-5-alpha-steroid 4-dehydrogenase activity 3-oxo-5alpha-steroid 4-dehydrogenase (NADP+) amide binding sterol 5-alpha reductase activity testosterone dehydrogenase activity
Rattus norvegicus
Differentiation Endoplasmic reticulum Lipid metabolism Membrane Microsome NADP Oxidoreductase Reference proteome Sexual differentiation Transmembrane Transmembrane helix
MQIVCHQVPV
MQIVCHQVPVLAGSATLATMGTLILCLGKPASYGKHTESVSSGVPFLPARIAWFLQELPSFVVSVGMLAWQPRSLFGPPGNVLLALFSAHYFHRTFIYSLLTRGRPFPAVLFLRATAFCIGNGLLQAYYLVYCAEYPEEWYTDVRFSFGVFLFILGMGINIHSDYTLRQLRKPGEVIYRIPRGGLFTYVSGANFLGEIIEWIGYALATWSVPAFAFAFFTLCFLGMQAFYHHRFYLKMFKDYPKSRKALIPFIF
androgen biosynthetic process androgen metabolic process biphenyl metabolic process bone development cell differentiation dibenzo-p-dioxin metabolic process female genitalia development hippocampus development hypothalamus development male genitalia development male gonad development phthalate metabolic process respons...
aspartate catabolic process D-amino acid catabolic process nervous system process
cytoplasm; peroxisomal matrix
D-aspartate oxidase activity FAD binding
Bos taurus
Direct protein sequencing FAD Flavoprotein Oxidoreductase Peroxisome Reference proteome
MDTVRIAVVG
MDTVRIAVVGAGVMGLSTAVCISKMVPGCSITVISDKFTPETTSDVAAGMLIPPTYPDTPIQKQKQWFKETFDHLFAIVNSAEAEDAGVILVSGWQIFQSIPTEEVPYWADVVLGFRKMTKDELKKFPQHVFGHAFTTLKCEGPAYLPWLQKRVKGNGGLILTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIFPVRGQVLKVQAPWVKHFIRDSSGLTYIYPGVSNVTLGGTRQKGDWNLSPDAEISKEILSRCCALEPSLRGAYDLREKVGLRPTRPSVRLEKELLAQDSRRLPVVHHYGHGSGGIAMHWGTALE...
aspartate catabolic process D-amino acid catabolic process nervous system process cytoplasm; peroxisomal matrix D-aspartate oxidase activity FAD binding Bos taurus Direct protein sequencing FAD Flavoprotein Oxidoreductase Peroxisome Reference proteome MDTVRIAVVG MDTVRIAVVGAGVMGLSTAVCISKMVPGCSITVISDKFTPETTSDVAAGMLIPPTYP...
angiogenesis apoptotic process cell-cell signaling inflammatory response leukocyte migration negative regulation of endothelial cell proliferation positive regulation of glucagon secretion translation
aminoacyl-tRNA synthetase multienzyme complex; cell surface; cytosol; endoplasmic reticulum; extracellular space; Golgi apparatus; nucleus
cytokine activity GTPase binding protein homodimerization activity tRNA binding
Mus musculus
Acetylation Angiogenesis Apoptosis Cytokine Cytoplasm Direct protein sequencing Endoplasmic reticulum Golgi apparatus Inflammatory response Nucleus Phosphoprotein Protein biosynthesis Reference proteome RNA-binding Secreted tRNA-binding
MATNDAVLKR
MATNDAVLKRLEQKGAEADQIIEYLKQQVALLKEKAILQATMREEKKLRVENAKLKKEIEELKQELILAEIHNGVEQVRVRLSTPLQTNCTASESVVQSPSVATTASPATKEQIKAGEEKKVKEKTEKKGEKKEKQQSAAASTDSKPIDASRLDLRIGCIVTAKKHPDADSLYVEEVDVGEAAPRTVVSGLVNHVPLEQMQNRMVVLLCNLKPAKMRGVLSQAMVMCASSPEKVEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNAECVATYKGAPFEVKGKGVCRAQTMANSGIK
angiogenesis apoptotic process cell-cell signaling inflammatory response leukocyte migration negative regulation of endothelial cell proliferation positive regulation of glucagon secretion translation aminoacyl-tRNA synthetase multienzyme complex; cell surface; cytosol; endoplasmic reticulum; extracellular space; Golgi...
global genome nucleotide-excision repair nucleotide-excision repair nucleotide-excision repair, DNA damage recognition protein localization response to UV ubiquitin-dependent protein catabolic process
Cul3-RING ubiquitin ligase complex; nucleotide-excision repair factor 4 complex; nucleus
ATP binding ATP-dependent chromatin remodeler activity DNA binding helicase activity hydrolase activity metal ion binding
Saccharomyces cerevisiae
ATP-binding DNA damage DNA repair DNA-binding Helicase Hydrolase Metal-binding Nucleotide-binding Nucleus Phosphoprotein Reference proteome Zinc Zinc-finger
MQEGGFIRRR
MQEGGFIRRRRTRSTKKSVNYNELSDDDTAVKNSKTLQLKGNSENVNDSQDEEYRDDATLVKSPDDDDKDFIIDLTGSDKERTATDENTHAIKNDNDEIIEIKEERDVSDDDEPLTKKRKTTARKKKKKTSTKKKSPKVTPYERNTLRLYEHHPELRNVFTDLKNAPPYVPQRSKQPDGMTIKLLPFQLEGLHWLISQEESIYAGGVLADEMGMGKTIQTIALLMNDLTKSPSLVVAPTVALMQWKNEIEQHTKGQLKIYIYHGASRTTDIKDLQGYDVVLTTYAVLESVFRKQNYGFRRKNGLFKQPSVLHNIDFYRVI...
global genome nucleotide-excision repair nucleotide-excision repair nucleotide-excision repair, DNA damage recognition protein localization response to UV ubiquitin-dependent protein catabolic process Cul3-RING ubiquitin ligase complex; nucleotide-excision repair factor 4 complex; nucleus ATP binding ATP-dependent chro...
anterior/posterior pattern specification brain segmentation cell fate commitment cell fate determination cellular response to retinoic acid dorsal/ventral pattern formation embryonic skeletal system development embryonic skeletal system morphogenesis embryonic viscerocranium morphogenesis middle ear morphogenesis motor...
intracellular membrane-bounded organelle; nucleoplasm; nucleus
DNA-binding transcription repressor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific DNA binding sequence-specific double-stranded DNA binding
Mus musculus
Developmental protein DNA-binding Homeobox Nucleus Reference proteome Transcription Transcription regulation
MNYEFEREIG
MNYEFEREIGFINSQPSLAECLTSFPPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRHGAGVGGRPKSSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALPPAAASTGPACLGHKESLEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQNSEGKFKNLEDSDKVEEDEEEKSLFEQALSVSGALLEREGYTFQQNALSQQQAPNGHNGDSQTFPVSPLTSNEKNLKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEAIEVPSLQD...
anterior/posterior pattern specification brain segmentation cell fate commitment cell fate determination cellular response to retinoic acid dorsal/ventral pattern formation embryonic skeletal system development embryonic skeletal system morphogenesis embryonic viscerocranium morphogenesis middle ear morphogenesis motor...
anterior/posterior pattern specification brain segmentation cell fate commitment cell fate determination cellular response to retinoic acid dorsal/ventral pattern formation embryonic skeletal system development embryonic skeletal system morphogenesis embryonic viscerocranium morphogenesis middle ear morphogenesis motor...
nucleus
DNA-binding transcription factor activity DNA-binding transcription repressor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific DNA binding sequence-specific double-stranded DNA binding
Rattus norvegicus
Developmental protein DNA-binding Homeobox Nucleus Reference proteome Transcription Transcription regulation
MNYEFEREIG
MNYEFEREIGFINSQPSLAECLTSFPPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRQSAGAGGRPKSSPAGSRGSPVPARALQPPEYPWMKEKKAAKKTALPPAAASTGPACLGHKESLEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQNSEGKFKNLEDSDKVEEDEEEKSLFEQALSVSGALLEREGYTFQQNALSQQQAPNGHNGDSQTFPVSPLTSNEKNLKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEALEVPSLQD...
anterior/posterior pattern specification brain segmentation cell fate commitment cell fate determination cellular response to retinoic acid dorsal/ventral pattern formation embryonic skeletal system development embryonic skeletal system morphogenesis embryonic viscerocranium morphogenesis middle ear morphogenesis motor...
anterior/posterior pattern specification cartilage development cell-matrix adhesion DNA-templated transcription embryonic skeletal system morphogenesis glossopharyngeal nerve morphogenesis Notch signaling pathway positive regulation of gene expression positive regulation of neuron differentiation positive regulation of...
aggresome; chromatin; nuclear body; nucleoplasm; nucleus
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding RNA polymerase II transcription regulatory region sequence-specific DNA binding sequence-specific double-st...
Homo sapiens
Developmental protein DNA-binding Homeobox Nucleus Reference proteome Transcription Transcription regulation
MLFEQGQQAL
MLFEQGQQALELPECTMQKAAYYENPGLFGGYGYSKTTDTYGYSTPHQPYPPPAAASSLDTDYPGSACSIQSSAPLRAPAHKGAELNGSCMRPGTGNSQGGGGGSQPPGLNSEQQPPQPPPPPPTLPPSSPTNPGGGVPAKKPKGGPNASSSSATISKQIFPWMKESRQNSKQKNSCATAGESCEDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAKGILHSPASQSPERSPPLGGAAGHVAYSGQLPPVPGLAYDAPSPPAFAKSQPNMYGLAAYTAPLS...
anterior/posterior pattern specification cartilage development cell-matrix adhesion DNA-templated transcription embryonic skeletal system morphogenesis glossopharyngeal nerve morphogenesis Notch signaling pathway positive regulation of gene expression positive regulation of neuron differentiation positive regulation of...
anterior/posterior pattern specification embryonic limb morphogenesis negative regulation of cold-induced thermogenesis neuromuscular process positive regulation of transcription by RNA polymerase II proximal/distal pattern formation regulation of transcription by RNA polymerase II skeletal system development spinal co...
nuclear body; nucleoplasm; nucleus
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding RNA polymerase II transcription regulatory region sequence-specific DNA binding sequence-specific double-st...
Mus musculus
Developmental protein DNA-binding Homeobox Isopeptide bond Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation Ubl conjugation
MTCPRNVTPN
MTCPRNVTPNSYAEPLAAPGGGERYNRNAGMYMQSGSDFNCGVMRGCGLAPSLSKRDEGGSPNLALNTYPSYLSQLDSWGDPKAAYRLEQPVGRPLSSCSYPPSVKEENVCCMYSAEKRAKSGPEAALYSHPLPESCLGEHEVPVPSYYRASPSYSALDKTPHCAGANEFEAPFEQRASLNPRTEHLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLAGPKASPSESEKERAKTADSSPDTSDNEAKEEIKAENTTGNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNRR...
anterior/posterior pattern specification embryonic limb morphogenesis negative regulation of cold-induced thermogenesis neuromuscular process positive regulation of transcription by RNA polymerase II proximal/distal pattern formation regulation of transcription by RNA polymerase II skeletal system development spinal co...
anatomical structure development anterior/posterior pattern specification branching involved in ureteric bud morphogenesis cartilage development involved in endochondral bone morphogenesis chondrocyte development developmental growth dorsal/ventral pattern formation embryonic digit morphogenesis embryonic forelimb morp...
nucleoplasm; nucleus; protein-DNA complex; transcription regulator complex
DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding
Gallus gallus
Developmental protein DNA-binding Homeobox Nucleus Reference proteome Transcription Transcription regulation
MMDFDERVPC
MMDFDERVPCSSNMYLPSCTYYVSGPDFSSLPSFLPQTPSSRPMTYSYSSNLPQVQPVREVTFREYAIDPSSKWHPRNNLPHCYSAEEIMHRDCLPSTTTASMGEVFGKSTANVYHHPSANVSSNFYSTVGRNGVLPQAFDQFFETAYGTAENPSSADYPPDKSGEKAPAAAGATAATSSSEGGCGGAAAAAGKERRRRPESGSSPESSSGNNEEKSGSSSGQRTRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKINRDRLQYYSANPLL
anatomical structure development anterior/posterior pattern specification branching involved in ureteric bud morphogenesis cartilage development involved in endochondral bone morphogenesis chondrocyte development developmental growth dorsal/ventral pattern formation embryonic digit morphogenesis embryonic forelimb morp...
anterior/posterior pattern specification embryonic limb morphogenesis male gonad development positive regulation of transcription by RNA polymerase II prostate gland development proximal/distal pattern formation regulation of transcription by RNA polymerase II response to estrogen response to testosterone single fertil...
chromatin; cytoplasm; nucleoplasm; nucleus; transcription regulator complex
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity, RNA polymerase II-specific histone deacetylase binding RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific double-stranded DNA binding
Homo sapiens
Alternative splicing Developmental protein DNA-binding Homeobox Nucleus Reference proteome Transcription Transcription regulation
MSARKGYLLP
MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPPAADLPYGLQSCGLFPTLGGKRNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLDAPRSCRMEPPDGPPPPPQQQPPPPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGYGSGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLG...
anterior/posterior pattern specification embryonic limb morphogenesis male gonad development positive regulation of transcription by RNA polymerase II prostate gland development proximal/distal pattern formation regulation of transcription by RNA polymerase II response to estrogen response to testosterone single fertil...
cell division drought recovery embryo development ending in seed dormancy lateral root development pollen tube growth positive regulation of microtubule depolymerization post-embryonic development regulation of cell growth regulation of mitotic cell cycle regulation of multicellular organism growth regulation of stomat...
apoplast; chloroplast; cytosol; Golgi apparatus; nucleus; plant-type vacuole; plasma membrane; plasmodesma; pollen tube; thylakoid
microtubule binding protein domain specific binding
Arabidopsis thaliana
Calcium Cytoplasm Reference proteome
MLVYQDLLTG
MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVTVGAVDVNIGANPSAEEGGEDEGVDDSTQKVVDIVDTFRLQEQPTYDKKGFIAYIKKYIKLLTPKLSEEDQAVFKKGIEGATKFLLPRLSDFQFFVGEGMHDDSTLVFAYYKEGSTNPTFLYFAHGLKEVKC
cell division drought recovery embryo development ending in seed dormancy lateral root development pollen tube growth positive regulation of microtubule depolymerization post-embryonic development regulation of cell growth regulation of mitotic cell cycle regulation of multicellular organism growth regulation of stomat...
angiogenesis anterior/posterior pattern specification embryonic skeletal system morphogenesis negative regulation of cell-matrix adhesion negative regulation of DNA-templated transcription negative regulation of keratinocyte differentiation negative regulation of leukocyte migration negative regulation of monocyte diff...
chromatin; nuclear membrane; nucleoplasm; nucleus
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity, RNA polymerase II-specific DNA-binding transcription factor binding RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific DNA binding sequence-specific double-stranded DN...
Homo sapiens
Developmental protein DNA-binding Homeobox Nucleus Reference proteome Transcription Transcription regulation
MSSSYYVNAL
MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGAAEANFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDEEEEDEEE
angiogenesis anterior/posterior pattern specification embryonic skeletal system morphogenesis negative regulation of cell-matrix adhesion negative regulation of DNA-templated transcription negative regulation of keratinocyte differentiation negative regulation of leukocyte migration negative regulation of monocyte diff...
anterior/posterior pattern specification definitive hemopoiesis DNA-templated transcription embryonic forelimb morphogenesis embryonic skeletal system morphogenesis endothelial cell activation male gonad development mammary gland development negative regulation of myeloid cell differentiation prostate gland development...
chromatin; cytoplasm; nucleoplasm; nucleus; transcription regulator complex
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific enzyme binding RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific double-stranded DNA binding
Homo sapiens
Chromosomal rearrangement Cytoplasm Developmental protein DNA-binding Homeobox Methylation Nucleus Proto-oncogene Reference proteome Transcription Transcription regulation
MATTGALGNY
MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPDFSPCSFQSKATVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE
anterior/posterior pattern specification definitive hemopoiesis DNA-templated transcription embryonic forelimb morphogenesis embryonic skeletal system morphogenesis endothelial cell activation male gonad development mammary gland development negative regulation of myeloid cell differentiation prostate gland development...
anatomical structure development anatomical structure morphogenesis anterior/posterior pattern specification branching involved in ureteric bud morphogenesis cartilage development involved in endochondral bone morphogenesis chondrocyte development developmental growth dorsal/ventral pattern formation embryonic digit mo...
nucleoplasm; nucleus; protein-containing complex; protein-DNA complex; transcription regulator complex
DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific double-stranded DNA binding
Homo sapiens
Developmental protein DNA-binding Homeobox Nucleus Reference proteome Transcription Transcription regulation
MDFDERGPCS
MDFDERGPCSSNMYLPSCTYYVSGPDFSSLPSFLPQTPSSRPMTYSYSSNLPQVQPVREVTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQFFETAYGTPENLASSDYPGDKSAEKGPPAATATSAAAAAAATGAPATSSSDSGGGGGCRETAAAAEEKERRRRPESSSSPESSSGHTEDKAGGSSGQRTRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKINRDRLQYYSANPLL
anatomical structure development anatomical structure morphogenesis anterior/posterior pattern specification branching involved in ureteric bud morphogenesis cartilage development involved in endochondral bone morphogenesis chondrocyte development developmental growth dorsal/ventral pattern formation embryonic digit mo...
artery morphogenesis branching involved in prostate gland morphogenesis embryonic forelimb morphogenesis embryonic hindgut morphogenesis endothelial cell fate specification endothelial cell morphogenesis inner ear development male genitalia development mesenchymal cell apoptotic process mitotic nuclear division positiv...
chromatin; chromosome; intermediate filament cytoskeleton; nucleoplasm
DNA binding DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific DNA binding sequence-specific double-stranded DNA binding
Homo sapiens
3D-structure Developmental protein Disease variant DNA-binding Homeobox Nucleus Reference proteome Transcription Transcription regulation
MTASVLLHPR
MTASVLLHPRWIEPTVMFLYDNGGGLVADELNKNMEGAAAAAAAAAAAAAAGAGGGGFPHPAAAAAGGNFSVAAAAAAAAAAAANQCRNLMAHPAPLAPGAASAYSSAPGEAPPSAAAAAAAAAAAAAAAAAASSSGGPGPAGPAGAEAAKQCSPCSAAAQSSSGPAALPYGYFGSGYYPCARMGPHPNAIKSCAQPASAAAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSYR...
artery morphogenesis branching involved in prostate gland morphogenesis embryonic forelimb morphogenesis embryonic hindgut morphogenesis endothelial cell fate specification endothelial cell morphogenesis inner ear development male genitalia development mesenchymal cell apoptotic process mitotic nuclear division positiv...
anterior/posterior pattern specification negative regulation of transcription by RNA polymerase II neuron differentiation regulation of transcription by RNA polymerase II skeletal system morphogenesis
chromatin; microtubule cytoskeleton; nucleoplasm; nucleus
DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II transcription regulatory region sequence-specific DNA binding sequence-specific double-stranded DNA binding
Homo sapiens
Developmental protein DNA-binding Homeobox Nucleus Reference proteome Transcription Transcription regulation
MSSYFVNPLF
MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD
anterior/posterior pattern specification negative regulation of transcription by RNA polymerase II neuron differentiation regulation of transcription by RNA polymerase II skeletal system morphogenesis chromatin; microtubule cytoskeleton; nucleoplasm; nucleus DNA-binding transcription factor activity, RNA polymerase II-...