Biological Process
stringlengths
7
1.01k
Cellular Component
stringlengths
6
867
Molecular Function
stringlengths
11
871
Organism
stringlengths
8
73
Keywords
stringlengths
1
810
Sequence 10
stringlengths
5
10
Sequence
stringlengths
5
1.02k
Combined
stringlengths
136
3.91k
maintenance of translational fidelity positive regulation of translational elongation translational elongation
cytosol; ribonucleoprotein complex
GTP binding GTPase activity identical protein binding protein-folding chaperone binding ribosome binding rRNA binding translation elongation factor activity
Saccharomyces cerevisiae
3D-structure Cytoplasm Direct protein sequencing Elongation factor GTP-binding Hydrolase Isopeptide bond Methylation Nucleotide-binding Phosphoprotein Protein biosynthesis Reference proteome RNA-binding rRNA-binding Ubl conjugation
MVAFTVDQMR
MVAFTVDQMRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAAKAGEARFTDTRKDEQERGITIKSTAISLYSEMSDEDVKEIKQKTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINKVDRALLELQVSKEDLYQTFARTVESVNVIVSTYADEVLGDVQVYPARGTVAFGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSFFNPKTKKWTNKDTDAEGKPLERAFNMFILDPIFRLFTAIMNFKKDEIPVLLEKLEIVLKGDEKDLEGKALL...
maintenance of translational fidelity positive regulation of translational elongation translational elongation cytosol; ribonucleoprotein complex GTP binding GTPase activity identical protein binding protein-folding chaperone binding ribosome binding rRNA binding translation elongation factor activity Saccharomyces cer...
cell division chromosome segregation DNA replication initiation mitotic DNA replication checkpoint signaling negative regulation of exit from mitosis positive regulation of DNA replication initiation positive regulation of kinetochore assembly positive regulation of meiosis I positive regulation of meiotic DNA double-s...
centrosome; chromatin; chromosome, centromeric region; cytoplasm; Dbf4-dependent protein kinase complex; nucleus
DNA replication origin binding protein serine/threonine kinase activator activity zinc ion binding
Saccharomyces cerevisiae
3D-structure Cell cycle Cell division Chromosome partition DNA replication DNA-binding Meiosis Metal-binding Mitosis Phosphoprotein Reference proteome Zinc Zinc-finger
MVSPTKMIIR
MVSPTKMIIRSPLKETDTNLKHNNGIAASTTAAGHLNVFSNDNNCNNNNTTESFPKKRSLERLELQQQQHLHEKKRARIERARSIEGAVQVSKGTGLKNVEPRVTPKELLEWQTNWKKIMKRDSRIYFDITDDVEMNTYNKSKMDKRRDLLKRGFLTLGAQITQFFDTTVTIVITRRSVENIYLLKDTDILSRAKKNYMKVWSYEKAARFLKNLDVDLDHLSKTKSASLAAPTLSNLLHNEKLYGPTDRDPRTKRDDIHYFKYPHVYLYDLWQTWAPIITLEWKPQELTNLDELPYPILKIGSFGRCPFIGDRNYDESSY...
cell division chromosome segregation DNA replication initiation mitotic DNA replication checkpoint signaling negative regulation of exit from mitosis positive regulation of DNA replication initiation positive regulation of kinetochore assembly positive regulation of meiosis I positive regulation of meiotic DNA double-s...
division septum assembly exit from mitosis intracellular signal transduction mitotic cytokinesis phosphorylation regulation of cytokinesis regulation of mRNA catabolic process
cellular bud neck; cytoplasm; serine/threonine protein kinase complex; spindle pole body
ATP binding protein serine kinase activity protein serine/threonine kinase activity
Saccharomyces cerevisiae
ATP-binding Kinase Nucleotide-binding Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase
MFSRSDREVD
MFSRSDREVDDLAGNMSHLGFYDLNIPKPTSPQAQYRPARKSENGRLTPGLPRSYKPCDSDDQDTFKNRISLNHSPKKLPKDFHERASQSKTQRVVNVCQLYFLDYYCDMFDYVISRRQRTKQVLRYLEQQRSVKNVSNKVLNEEWALYLQREHEVLRKRRLKPKHKDFQILTQVGQGGYGQVYLAKKKDSDEICALKILNKKLLFKLNETNHVLTERDILTTTRSDWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRILKSGHARFYISEMFCAVNALHELGYTHRDLKPENFLIDATGHIKLTDFGLAAGTVSN...
division septum assembly exit from mitosis intracellular signal transduction mitotic cytokinesis phosphorylation regulation of cytokinesis regulation of mRNA catabolic process cellular bud neck; cytoplasm; serine/threonine protein kinase complex; spindle pole body ATP binding protein serine kinase activity protein seri...
fungal-type cell wall organization peptide mating pheromone maturation involved in positive regulation of conjugation with cellular fusion protein processing signal transduction involved in filamentous growth
extracellular region; fungal-type cell wall; plasma membrane; side of membrane
aspartic-type endopeptidase activity
Saccharomyces cerevisiae
Aspartyl protease Autocatalytic cleavage Cell membrane Cleavage on pair of basic residues Direct protein sequencing Disulfide bond Glycoprotein GPI-anchor Hydrolase Lipoprotein Membrane Protease Reference proteome Signal Zymogen
MKLKTVRSAV
MKLKTVRSAVLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSAIGPTATGLGGGSGTATQSVPASEATMDCQQYGTFSTSGSSTFRSNNTYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTG...
fungal-type cell wall organization peptide mating pheromone maturation involved in positive regulation of conjugation with cellular fusion protein processing signal transduction involved in filamentous growth extracellular region; fungal-type cell wall; plasma membrane; side of membrane aspartic-type endopeptidase acti...
isopropylmalate transport oxaloacetate transport sulfate transport
mitochondrial inner membrane; mitochondrion
isopropylmalate transmembrane transporter activity malonate(1-) transmembrane transporter activity oxaloacetate transmembrane transporter activity sulfate transmembrane transporter activity transmembrane transporter activity
Saccharomyces cerevisiae
Membrane Mitochondrion Mitochondrion inner membrane Reference proteome Repeat Transmembrane Transmembrane helix Transport
MSSDNSKQDK
MSSDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIESRV...
isopropylmalate transport oxaloacetate transport sulfate transport mitochondrial inner membrane; mitochondrion isopropylmalate transmembrane transporter activity malonate(1-) transmembrane transporter activity oxaloacetate transmembrane transporter activity sulfate transmembrane transporter activity transmembrane trans...
mitochondrial cytochrome c oxidase assembly mRNA processing negative regulation of mitochondrial translation positive regulation of mitochondrial translation protein stabilization RNA splicing
mitochondrial inner membrane; mitochondrion
translation regulator activity
Saccharomyces cerevisiae
Membrane Mitochondrion Mitochondrion inner membrane mRNA processing mRNA splicing Reference proteome Transit peptide
MTVLYAPSGA
MTVLYAPSGATQLYFHLLRKSPHNRLVVSHQTRRHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEA...
mitochondrial cytochrome c oxidase assembly mRNA processing negative regulation of mitochondrial translation positive regulation of mitochondrial translation protein stabilization RNA splicing mitochondrial inner membrane; mitochondrion translation regulator activity Saccharomyces cerevisiae Membrane Mitochondrion Mit...
astral microtubule organization cell division establishment of spindle localization initial mitotic spindle pole body separation meiotic chromosome segregation positive regulation of exit from mitosis
cytoplasm; nuclear envelope; outer plaque of mitotic spindle pole body
signaling adaptor activity
Saccharomyces cerevisiae
Cell cycle Cell division Cytoplasm Cytoskeleton Isopeptide bond Leucine-rich repeat Meiosis Mitosis Nucleus Phosphoprotein Reference proteome Repeat Ubl conjugation
MDMDTQEAEL
MDMDTQEAELSSQLENLTINSPRKLRSNAHSNSGKVFKEYESNHDFQDSNFTSQVVEPAISDSVKKPPTMTVLNNYSTVHQKVPSGFSGTTATSHQEAQWKQYFPGIGSGGGTNFGGAVGTANKVPESDLIVSDLVKDLSGVLETNTFKRHLDMKNKTTTMQTHENHDTISISHSKDFFNAEKVSSSFSDDSDSGPAAEAHDVFDGILQKQKSNYLVGSYPSNSNNKNNNNNNNNNNNNSININNKDNARTKEEDEEDTSNSFEFSSSSSMSSSQTQSGRKSKVLKKPPLNTISPGQLGYQFNHTHGAWDPPLNQGLDVS...
astral microtubule organization cell division establishment of spindle localization initial mitotic spindle pole body separation meiotic chromosome segregation positive regulation of exit from mitosis cytoplasm; nuclear envelope; outer plaque of mitotic spindle pole body signaling adaptor activity Saccharomyces cerevis...
SRP-dependent cotranslational protein targeting to membrane SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition
nucleus; signal recognition particle, endoplasmic reticulum targeting
RNA binding
Saccharomyces cerevisiae
Acetylation Cytoplasm Direct protein sequencing Nucleus Reference proteome Ribonucleoprotein RNA-binding Signal recognition particle
MSVKPIDNYI
MSVKPIDNYITNSVRLFEVNPSQTLFSISYKPPTQKTDTKVSFRTHNSHLSLNYKFTTNKSKDVSRLLSALGPRGVSITPGKIEKIAQSKKKNNKIKESSKKIKGKSIQDIVGLATLIVNTDVEKSDPAAKKTATEPKQKANAVQNNNGNSAASKKKKNKNKGKKKR
SRP-dependent cotranslational protein targeting to membrane SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition nucleus; signal recognition particle, endoplasmic reticulum targeting RNA binding Saccharomyces cerevisiae Acetylation Cytoplasm Direct protein sequencing Nucleus Referen...
double-strand break repair via homologous recombination meiotic recombination checkpoint signaling negative regulation of DNA damage checkpoint negative regulation of glucose mediated signaling pathway positive regulation of double-strand break repair via nonhomologous end joining positive regulation of nitrogen compou...
cytoplasm; nuclear periphery; nucleus; protein phosphatase 4 complex
metal ion binding myosin phosphatase activity protein serine/threonine phosphatase activity
Saccharomyces cerevisiae
Cytoplasm Hydrolase Manganese Metal-binding Methylation Nucleus Protein phosphatase Reference proteome
MMDLDKIIAS
MMDLDKIIASLRDGKHIPEETVFRLCLNSQELLMNEGNVTQVDTPVTICGDIHGQLHDLLTLFEKSGGVEKTRYIFLGDFVDRGFYSLESFLLLLCYKLRYPDRITLIRGNHETRQITKVYGFYDEVVRKYGNSNVWRYCCEVFDYLSLGAIINNSIFCVHGGLSPDMTTVDEIRTIDRKQEVPHEGAMCDLLWSDPEDVDTWSLSPRGAGFLFGKREVDQFLEKNNVELIARAHQLVMEGYKEMFDGGLVTVWSAPNYCYRCGNVAAVLKIDDDLNREYTIFEAVQAQNEVGNAIIPTKKSQMDYFL
double-strand break repair via homologous recombination meiotic recombination checkpoint signaling negative regulation of DNA damage checkpoint negative regulation of glucose mediated signaling pathway positive regulation of double-strand break repair via nonhomologous end joining positive regulation of nitrogen compou...
heme biosynthetic process protoporphyrinogen IX biosynthetic process
cytoplasm; cytosol; nucleus
uroporphyrinogen decarboxylase activity
Saccharomyces cerevisiae
Cytoplasm Decarboxylase Heme biosynthesis Lyase Nucleus Porphyrin biosynthesis Reference proteome
MGNFPAPKND
MGNFPAPKNDLILRAAKGEKVERPPCWIMRQAGRYLPEYHEVKNNRDFFQTCRDAEIASEITIQPVRRYRGLIDAAIIFSDILVIPQAMGMRVEMLEGKGPHFPEPLRNPEDLQTVLDYKVDVLKELDWAFKAITMTRIKLDGEVPLFGFCGGPWTLMVYMTEGGGSRLFRFAKQWINMYPELSHKLLQKITDVAVEFLSQQVVAGAQILQVFESWGGELSSVDFDEFSLPYLRQIAERVPKRLQELGIMEQIPMIVFAKGSWYALDKLCCSGFDVVSLDWSWDPREAVKINKNRVTLQGNLDPGVMYGSKEVITKKVKQ...
heme biosynthetic process protoporphyrinogen IX biosynthetic process cytoplasm; cytosol; nucleus uroporphyrinogen decarboxylase activity Saccharomyces cerevisiae Cytoplasm Decarboxylase Heme biosynthesis Lyase Nucleus Porphyrin biosynthesis Reference proteome MGNFPAPKND MGNFPAPKNDLILRAAKGEKVERPPCWIMRQAGRYLPEYHEVKNNRDF...
termination of RNA polymerase III transcription transcription by RNA polymerase III transcription initiation at RNA polymerase III promoter tRNA transcription by RNA polymerase III
cytoplasm; nucleoplasm; nucleus; RNA polymerase III complex
single-stranded DNA binding
Saccharomyces cerevisiae
3D-structure Cytoplasm Direct protein sequencing DNA-directed RNA polymerase Nucleus Phosphoprotein Reference proteome Transcription Zinc
MDELLGEALS
MDELLGEALSAENQTGESTVESEKLVTPEDVMTISSLEQRTLNPDLFLYKELVKAHLGERAASVIGMLVALGRLSVRELVEKIDGMDVDSVKTTLVSLTQLRCVKYLQETAISGKKTTYYYYNEEGIHILLYSGLIIDEIITQMRVNDEEEHKQLVAEIVQNVISLGSLTVEDYLSSVTSDSMKYTISSLFVQLCEMGYLIQISKLHYTPIEDLWQFLYEKHYKNIPRNSPLSDLKKRSQAKMNAKTDFAKIINKPNELSQILTVDPKTSLRIVKPTVSLTINLDRFMKGRRSKQLINLAKTRVGSVTAQVYKIALRLTE...
termination of RNA polymerase III transcription transcription by RNA polymerase III transcription initiation at RNA polymerase III promoter tRNA transcription by RNA polymerase III cytoplasm; nucleoplasm; nucleus; RNA polymerase III complex single-stranded DNA binding Saccharomyces cerevisiae 3D-structure Cytoplasm Di...
negative regulation of transcription by RNA polymerase III phosphorylation regulation of RNA splicing
cytoplasm; nucleus
ATP binding protein kinase activity protein serine kinase activity protein serine/threonine kinase activity protein serine/threonine/tyrosine kinase activity protein tyrosine kinase activity
Saccharomyces cerevisiae
ATP-binding Kinase Nucleotide-binding Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase Tyrosine-protein kinase
MSQNIQIGTR
MSQNIQIGTRKRSRANMNNSTTTGPANNTSSNKTFLDNFEETRTNKLLDEMFARQNSFLTDNLRNSLDLNQADNPLRPRQHQHQLFLDNENAIELDEEPRIINTTINNSNNHNSSRVDEDADDDIIFIKEQPIQFSSPLILPSSSSINNNNNIVTSNNPGCGTAATSNSTYITTPKKFKKQRTISLPQLPLSKLSYQSNYFNVPDQTNAIVPRVTQTENELLHLTGSCAKTLEGNKAVNLTIAHSTSPFSNPPAQIASLPQSNLKKQIGSSLRKFTSNGSSESASSNKSNFKTDKDGHYVYQENDIFGSGGRFVVKDLLG...
negative regulation of transcription by RNA polymerase III phosphorylation regulation of RNA splicing cytoplasm; nucleus ATP binding protein kinase activity protein serine kinase activity protein serine/threonine kinase activity protein serine/threonine/tyrosine kinase activity protein tyrosine kinase activity Saccharo...
ergosterol biosynthetic process sterol biosynthetic process
endoplasmic reticulum; endoplasmic reticulum lumen; endoplasmic reticulum membrane; membrane
C-5 sterol desaturase activity delta7-sterol 5(6)-desaturase activity iron ion binding
Saccharomyces cerevisiae
Endoplasmic reticulum Iron Isopeptide bond Lipid biosynthesis Lipid metabolism Membrane Oxidoreductase Reference proteome Steroid biosynthesis Steroid metabolism Sterol biosynthesis Sterol metabolism Transmembrane Transmembrane helix Ubl conjugation
MDLVLEVADH
MDLVLEVADHYVLDDLYAKVLPASLAANIPVKWQKLLGLNSGFSNSTILQETLNSKNAVKECRRFYGQVPFLFDMSTTSFASLLPRSSILREFLSLWVIVTIFGLLLYLFTASLSYVFVFDKSIFNHPRYLKNQMAMEIKLAVSAIPWMSMLTVPWFVMELNGHSKLYMKIDYENHGVRKLIIEYFTFIFFTDCGVYLAHRWLHWPRVYRALHKPHHKWLVCTPFASHSFHPVDGFLQSISYHIYPLILPLHKVSYLILFTFVNFWTVMIHDGQYLSNNPAVNGTACHTVHHLYFNYNYGQFTTLWDRLGGSYRRPDDSL...
ergosterol biosynthetic process sterol biosynthetic process endoplasmic reticulum; endoplasmic reticulum lumen; endoplasmic reticulum membrane; membrane C-5 sterol desaturase activity delta7-sterol 5(6)-desaturase activity iron ion binding Saccharomyces cerevisiae Endoplasmic reticulum Iron Isopeptide bond Lipid biosy...
cell cycle DNA replication initiation DNA strand elongation involved in DNA replication double-strand break repair via break-induced replication silent mating-type cassette heterochromatin formation subtelomeric heterochromatin formation
chromosome, telomeric region; nuclear replication fork; nucleus; replication fork; replication fork protection complex
DNA replication origin binding double-stranded DNA binding metal ion binding single-stranded DNA binding
Saccharomyces cerevisiae
Cell cycle DNA replication Metal-binding Nucleus Phosphoprotein Reference proteome Ubl conjugation Zinc Zinc-finger
MNDPREILAV
MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEAIEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKKC...
cell cycle DNA replication initiation DNA strand elongation involved in DNA replication double-strand break repair via break-induced replication silent mating-type cassette heterochromatin formation subtelomeric heterochromatin formation chromosome, telomeric region; nuclear replication fork; nucleus; replication fork;...
cellular response to desiccation trehalose catabolic process
cytoplasm
alpha,alpha-trehalase activity calcium ion binding trehalase activity
Saccharomyces cerevisiae
3D-structure Acetylation Calcium Cytoplasm Glycosidase Hydrolase Metal-binding Phosphoprotein Reference proteome
MSQVNTSQGP
MSQVNTSQGPVAQGRQRRLSSLSEFNDPFSNAEVYYGPPTDPRKQKQAKPAKINRTRTMSVFDNVSPFKKTGFGKLQQTRRGSEDDTYSSSQGNRRFFIEDVDKTLNELLAAEDTDKNYQITIEDTGPKVLKVGTANSYGYKHINIRGTYMLSNLLQELTIAKSFGRHQIFLDEARINENPVNRLSRLINTQFWNSLTRRVDLNNVGEIAKDTKIDTPGAKNPRIYVPYDCPEQYEFYVQASQMHPSLKLEVEYLPKKITAEYVKSVNDTPGLLALAMEEHFNPSTGEKTLIGYPYAVPGGRFNELYGWDSYMMALGLLE...
cellular response to desiccation trehalose catabolic process cytoplasm alpha,alpha-trehalase activity calcium ion binding trehalase activity Saccharomyces cerevisiae 3D-structure Acetylation Calcium Cytoplasm Glycosidase Hydrolase Metal-binding Phosphoprotein Reference proteome MSQVNTSQGP MSQVNTSQGPVAQGRQRRLSSLSEFNDPF...
cellular response to arsenic-containing substance heme A biosynthetic process heme B biosynthetic process heme biosynthetic process heme metabolic process heme O biosynthetic process liver development porphyrin-containing compound biosynthetic process porphyrin-containing compound catabolic process porphyrin-containing...
cytosol
ferrous iron binding uroporphyrinogen decarboxylase activity
Rattus norvegicus
Cytoplasm Decarboxylase Direct protein sequencing Heme biosynthesis Lyase Porphyrin biosynthesis Reference proteome
NGLGLQNFPE
NGLGLQNFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLEPVRRFPLDAAIIFSDILVVPQALAMEVTMVPGKGPSFPEPLREERDLERLRDPAAVASELGYVFQAITLTRQQLAGRVPLIGFAGAPWTLMTYMVEGGSFKTMAQAKRWLYQKPVASHKLLGILTHALVPYLIGQVAAGAQALQLFESHAGHLGSELFSKFALPYIRDVAKRVKAGLQKAGLTRMPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKAREPVGKTVTLQGELDPCALYASEEEIGRLVQQ...
cellular response to arsenic-containing substance heme A biosynthetic process heme B biosynthetic process heme biosynthetic process heme metabolic process heme O biosynthetic process liver development porphyrin-containing compound biosynthetic process porphyrin-containing compound catabolic process porphyrin-containing...
fungal-type cell wall organization GPI anchor biosynthetic process
cytosol; endoplasmic reticulum; endoplasmic reticulum membrane; glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex
phosphatidylinositol N-acetylglucosaminyltransferase activity
Saccharomyces cerevisiae
Endoplasmic reticulum Glycosyltransferase GPI-anchor biosynthesis Membrane Reference proteome Transferase Transmembrane Transmembrane helix
MGFNIAMLCD
MGFNIAMLCDFFYPQLGGVEFHIYHLSQKLIDLGHSVVIITHAYKDRVGVRHLTNGLKVYHVPFFVIFRETTFPTVFSTFPIIRNILLREQIQIVHSHGSASTFAHEGILHANTMGLRTVFTDHSLYGFNNLTSIWVNKLLTFTLTNIDRVICVSNTCKENMIVRTELSPDIISVIPNAVVSEDFKPRDPTGGTKRKQSRDKIVIVVIGRLFPNKGSDLLTRIIPKVCSSHEDVEFIVAGDGPKFIDFQQMIESHRLQKRVQLLGSVPHEKVRDVLCQGDIYLHASLTEAFGTILVEAASCNLLIVTTQVGGIPEVLPNE...
fungal-type cell wall organization GPI anchor biosynthetic process cytosol; endoplasmic reticulum; endoplasmic reticulum membrane; glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex phosphatidylinositol N-acetylglucosaminyltransferase activity Saccharomyces cerevisiae Endoplasmic reticulum ...
cytoskeleton-dependent intracellular transport microtubule-based movement vesicle docking involved in exocytosis
cellular bud neck; cellular bud tip; cytoplasm; incipient cellular bud site; kinesin complex; mating projection tip; microtubule
ATP binding ATP hydrolysis activity cytoskeletal motor activity microtubule binding plus-end-directed microtubule motor activity
Saccharomyces cerevisiae
3D-structure ATP-binding Cytoplasm Cytoskeleton Microtubule Motor protein Nucleotide-binding Phosphoprotein Reference proteome
MHWNIISKEQ
MHWNIISKEQSSSSVSLPTLDSSEPCHIEVILRAIPEKGLQNNESTFKIDPYENTVLFRTNNPLHETTKETHSTFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFSGKSYSLIGSKESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYMEKTYDLLVPLPERKPLKLHRSSSKMDLEIKDICPAHVGSYEDLRSYIQAVQNVGNRMACGDKTERSRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEALKNTVRSLSMKERDSAYSAKGSHSSAYRE...
cytoskeleton-dependent intracellular transport microtubule-based movement vesicle docking involved in exocytosis cellular bud neck; cellular bud tip; cytoplasm; incipient cellular bud site; kinesin complex; mating projection tip; microtubule ATP binding ATP hydrolysis activity cytoskeletal motor activity microtubule bi...
endosomal lumen acidification Golgi lumen acidification proton transmembrane transport vacuolar acidification vacuolar transport
fungal-type vacuole membrane; Golgi membrane; proton-transporting V-type ATPase complex; vacuolar proton-transporting V-type ATPase complex; vacuolar proton-transporting V-type ATPase, V0 domain
proton-transporting ATPase activity, rotational mechanism
Saccharomyces cerevisiae
3D-structure Acetylation Direct protein sequencing Hydrogen ion transport Ion transport Membrane Reference proteome Transport Vacuole
MEGVYFNIDN
MEGVYFNIDNGFIEGVVRGYRNGLLSNNQYINLTQCDTLEDLKLQLSSTDYGNFLSSVSSESLTTSLIQEYASSKLYHEFNYIRDQSSGSTRKFMDYITYGYMIDNVALMITGTIHDRDKGEILQRCHPLGWFDTLPTLSVATDLESLYETVLVDTPLAPYFKNCFDTAEELDDMNIEIIRNKLYKAYLEDFYNFVTEEIPEPAKECMQTLLGFEADRRSINIALNSLQSSDIDPDLKSDLLPNIGKLYPLATFHLAQAQDFEGVRAALANVYEYRGFLETGNLEDHFYQLEMELCRDAFTQQFAISTVWAWMKSKEQEV...
endosomal lumen acidification Golgi lumen acidification proton transmembrane transport vacuolar acidification vacuolar transport fungal-type vacuole membrane; Golgi membrane; proton-transporting V-type ATPase complex; vacuolar proton-transporting V-type ATPase complex; vacuolar proton-transporting V-type ATPase, V0 dom...
5S class rRNA transcription by RNA polymerase III transcription by RNA polymerase III transcription initiation at RNA polymerase III promoter
nucleoplasm; nucleus; transcription factor TFIIIC complex
DNA binding
Saccharomyces cerevisiae
3D-structure Direct protein sequencing DNA-binding Nucleus Phosphoprotein Reference proteome Repeat Transcription Transcription regulation
MPVEEPLATL
MPVEEPLATLSSIPDSSADQAPPLIADEFTLDLPRIPSLELPLNVSTKHSSIQKAIKMCGGIEKVKEAFKEHGPIESQHGLQLYLNDDTDSDGSKSYFNEHPVIGKRVPFRDESVILKVTMPKGTLSKNNNSVKDSIKSLKDSNKLRVTPVSIVDNTIKFREMSDFQIKLDNVPSAREFKSSFGSLEWNNFKSFVNSVPDNDSQPQENIGNLILDRSVKIPSTDFQLPPPPKLSMVGFPLLYKYKANPFAKKKKNGVTEVKGTYIKNYQLFVHDLSDKTVIPSQAHEQVLYDFEVAKKTKVYPGTKSDSKFYESLEECLK...
5S class rRNA transcription by RNA polymerase III transcription by RNA polymerase III transcription initiation at RNA polymerase III promoter nucleoplasm; nucleus; transcription factor TFIIIC complex DNA binding Saccharomyces cerevisiae 3D-structure Direct protein sequencing DNA-binding Nucleus Phosphoprotein Referenc...
intracellular sphingolipid homeostasis phosphatidylinositol dephosphorylation
cortical endoplasmic reticulum; endoplasmic reticulum; endoplasmic reticulum membrane; Golgi medial cisterna; Golgi membrane; host cell viral assembly compartment; mitochondrial outer membrane; mitochondrion; SPOTS complex
phosphatidylinositol-3,5-bisphosphate 3-phosphatase activity phosphatidylinositol-3-phosphate phosphatase activity phosphatidylinositol-4-phosphate phosphatase activity
Saccharomyces cerevisiae
3D-structure Endoplasmic reticulum Golgi apparatus Hydrolase Isopeptide bond Membrane Reference proteome Transmembrane Transmembrane helix Ubl conjugation
MTGPIVYVQN
MTGPIVYVQNADGIFFKLAEGKGTNDAVIHLANQDQGVRVLGAEEFPVQGEVVKIASLMGFIKLKLNRYAIIANTVEETGRFNGHVFYRVLQHSIVSTKFNSRIDSEEAEYIKLLELHLKNSTFYFSYTYDLTNSLQRNEKVGPAASWKTADERFFWNHYLTEDLRNFAHQDPRIDSFIQPVIYGYAKTVDAVLNATPIVLGLITRRSIFRAGTRYFRRGVDKDGNVGNFNETEQILLAENPESEKIHVFSFLQTRGSVPIYWAEINNLKYKPNLVLGENSLDATKKHFDQQKELYGDNYLVNLVNQKGHELPVKEGYES...
intracellular sphingolipid homeostasis phosphatidylinositol dephosphorylation cortical endoplasmic reticulum; endoplasmic reticulum; endoplasmic reticulum membrane; Golgi medial cisterna; Golgi membrane; host cell viral assembly compartment; mitochondrial outer membrane; mitochondrion; SPOTS complex phosphatidylinosito...
bile acid catabolic process lipid catabolic process
cytoplasm
4 iron, 4 sulfur cluster binding FMN binding metal ion binding oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
Clostridium scindens
4Fe-4S Bile acid catabolism Direct protein sequencing FAD Flavoprotein FMN Iron Iron-sulfur Lipid degradation Lipid metabolism Metal-binding NAD Oxidoreductase Steroid metabolism
MDMKHSRLFS
MDMKHSRLFSPLQIGSLTLSNRVGMAPMSMDYEAADGTVPKRLADVFVRRAEGGTGYVMIDAVTIDSKYPYMGNTTALDRDELVPQFKEFADRVKEAGSTLVPQIIHPGPESVCGYRHIAPLGPSANTNANCHVSRSISIDEIHDIIKQFGQAARRAEEAGCGAISLHCAHAYMLPGSFLSPLRNKRMDEYGGSLDNRARFVIEMIEEARRNVSPDFPIFLRISGDERMVGGNSLEDMLYLAPKFEAAGVSMLEVSGGTQYEGLEHIIPCQNKSRGVNVYEASEIKKVVGIPVYAVGKINDIRYAAEIVERGLVDGVAMG...
bile acid catabolic process lipid catabolic process cytoplasm 4 iron, 4 sulfur cluster binding FMN binding metal ion binding oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor Clostridium scindens 4Fe-4S Bile acid catabolism Direct protein sequencing FAD Flavoprotein FMN Iro...
DNA replication initiation mitotic DNA damage checkpoint signaling mitotic DNA replication checkpoint signaling mitotic G2 DNA damage checkpoint signaling
chromatin; cytosol; DNA replication preinitiation complex; mitotic spindle; mitotic spindle pole body; nuclear replication fork; nucleus; site of double-strand break
signaling adaptor activity
Schizosaccharomyces pombe
3D-structure DNA replication Nucleus Phosphoprotein Reference proteome Repeat
MGSSKPLKGF
MGSSKPLKGFVICCTSIDLKQRTEISTKATKLGAAYRSDFTKDVTHLIAGDFDTPKYKFAAKSRPDIKIMSSEWIPVLYESWVQGEDLDDGLLVDKHFLPTLFKCRVCLTNIGQPERSRIENYVLKHGGTFCPDLTRDVTHLIAGTSSGRKYEYALKWKINVVCVEWLWQSIQRNAVLEPQYFQLDMPAEKIGLGAYVRLDPNTTEAKSYSENQKISKNKEKSGQSLAALAEEADLEPVIMKRGKKRDRSILWEELNNGKFEFSSRSEENSVLLDDFTPETVQPLEENELDTELNIENEAKLFKNLTFYLYEFPNTKVSR...
DNA replication initiation mitotic DNA damage checkpoint signaling mitotic DNA replication checkpoint signaling mitotic G2 DNA damage checkpoint signaling chromatin; cytosol; DNA replication preinitiation complex; mitotic spindle; mitotic spindle pole body; nuclear replication fork; nucleus; site of double-strand break...
ergosterol biosynthetic process isopentenyl diphosphate biosynthetic process, mevalonate pathway sterol biosynthetic process
cytoplasm; cytosol; vacuole
ATP binding diphosphomevalonate decarboxylase activity
Saccharomyces cerevisiae
3D-structure ATP-binding Lipid biosynthesis Lipid metabolism Lyase Nucleotide-binding Reference proteome Steroid biosynthesis Steroid metabolism Sterol biosynthesis Sterol metabolism
MTVYTASVTA
MTVYTASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLWLNGEPHSIDNERTQNCLRDLRQLRKEMESKDASLPTLSQWKLHIVSENNFPTAAGLASSAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAEDGHDSMAVQIADSSDWPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKERIEHVVPKRFEVMRKAIVEKDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYGETIVAYTFDAGPNAVLYYLAENESKLF...
ergosterol biosynthetic process isopentenyl diphosphate biosynthetic process, mevalonate pathway sterol biosynthetic process cytoplasm; cytosol; vacuole ATP binding diphosphomevalonate decarboxylase activity Saccharomyces cerevisiae 3D-structure ATP-binding Lipid biosynthesis Lipid metabolism Lyase Nucleotide-binding ...
gamma-tubulin complex localization to nuclear side of mitotic spindle pole body karyogamy involved in conjugation with cellular fusion mitotic spindle elongation positive regulation of microtubule nucleation protein localization to mitotic spindle pole body protein-containing complex assembly regulation of microtubule ...
central plaque of spindle pole body; cytoplasm; inner plaque of spindle pole body; nucleus
calmodulin binding protein-containing complex binding structural constituent of cytoskeleton
Saccharomyces cerevisiae
3D-structure Coiled coil Cytoplasm Cytoskeleton Nucleus Phosphoprotein Reference proteome
MDEASHLPNG
MDEASHLPNGSLKNMEFTPVGFIKSKRNTTQTQVVSPTKVPNANNGDENEGPVKKRQRRSIDDTIDSTRLFSEASQFDDSFPEIKANIPPSPRSGNVDKSRKRNLIDDLKKDVPMSQPLKEQEVREHQMKKERFDRALESKLLGKRHITYANSDISNKELYINEIKSLKHEIKELRKEKNDTLNNYDTLEEETDDLKNRLQALEKELDAKNKIVNSRKVDDHSGCIEEREQMERKLAELERKLKTVKDQVLELENNSDVQSLKLRSKEDELKNLMNELNELKSNAEEKDTQLEFKKNELRKRTNELNELKIKSDEMDLQL...
gamma-tubulin complex localization to nuclear side of mitotic spindle pole body karyogamy involved in conjugation with cellular fusion mitotic spindle elongation positive regulation of microtubule nucleation protein localization to mitotic spindle pole body protein-containing complex assembly regulation of microtubule ...
actin cortical patch organization actin nucleation Arp2/3 complex-mediated actin nucleation ascospore wall assembly cytoplasm to vacuole transport by the Cvt pathway establishment of mitochondrion localization mitochondrion inheritance
actin cortical patch; actin cytoskeleton; Arp2/3 protein complex
actin binding ATP binding ATP hydrolysis activity
Saccharomyces cerevisiae
Acetylation Actin-binding ATP-binding Cytoplasm Cytoskeleton Nucleotide-binding Reference proteome
MDPHNPIVLD
MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKEL...
actin cortical patch organization actin nucleation Arp2/3 complex-mediated actin nucleation ascospore wall assembly cytoplasm to vacuole transport by the Cvt pathway establishment of mitochondrion localization mitochondrion inheritance actin cortical patch; actin cytoskeleton; Arp2/3 protein complex actin binding ATP b...
inositol phosphate biosynthetic process phosphatidylinositol-mediated signaling phospholipid catabolic process protein localization to kinetochore release of sequestered calcium ion into cytosol signal transduction involved in filamentous growth
chromosome, centromeric region; kinetochore
calcium ion binding phosphatidylinositol phospholipase C activity
Saccharomyces cerevisiae
Calcium Hydrolase Lipid degradation Lipid metabolism Metal-binding Reference proteome Transducer
MTESAIDDQR
MTESAIDDQRFNLTKELQRHSCRDQGKITQKDDALDFISYSSFQSSFNTDQKSANNGSTVRRSIRSIFRRAAELPRVHMGPLTYSHGINELVNKKLRKDCDLSTLCRVLQRGIRMIRMTRRRRKFYEFKLINNNGQIIWKDGSKYLELDSVKDIRIGDTASTYQEEVDPKRLRSDSKLWIAIIYKVSNKLKALHVVALNELDFNTFLSCICGLVKLRRELMESILLPDNSQFARIHWQITVSEKEEDEKKDTLSFADVKKLCDKFHIYVSTGQLLEFFQLADINHNGLLNYFEFEKFIKILKNRKEVNMIWSKFTKPPHS...
inositol phosphate biosynthetic process phosphatidylinositol-mediated signaling phospholipid catabolic process protein localization to kinetochore release of sequestered calcium ion into cytosol signal transduction involved in filamentous growth chromosome, centromeric region; kinetochore calcium ion binding phosphatid...
cysteine biosynthetic process methionine biosynthetic process positive regulation of transcription by RNA polymerase II regulation of sulfur metabolic process regulation of transcription by RNA polymerase II response to arsenic-containing substance response to cadmium ion sulfur amino acid metabolic process
Cbf1-Met4-Met28 complex; nucleus; transcription regulator complex
DNA-binding transcription activator activity, RNA polymerase II-specific identical protein binding RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription coactivator activity
Saccharomyces cerevisiae
Activator Amino-acid biosynthesis Coiled coil Cysteine biosynthesis DNA-binding Methionine biosynthesis Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation
MKQEQSHEGD
MKQEQSHEGDSYSTEFINLFGKDTATHPSSNNGANNNGMGSTNSLDQFVATASSSSSLVTSSENRRPLIGDVTNRGNTNLYDHAVTPEILLEQLAYVDNFIPSLDNEFSNVDWNVNTTHNNANNNGADTFSSINANPFDLDEQLAIELSAFADDSFIFPDEDKPSNNNNNSNNGNDDHSNHDVLHEDPSTNNRQRNPHFLTQRRNTFLTSQYDQSKSRFSSKNKRNGNNGETNNFGDNMQNNHPFEPNFMGSPSQFPADATNMTSIDHGGFTNVDITSTENNTTGDNGVDALSNLLHRTTHTPNRSSPLSNVTSAQNSSS...
cysteine biosynthetic process methionine biosynthetic process positive regulation of transcription by RNA polymerase II regulation of sulfur metabolic process regulation of transcription by RNA polymerase II response to arsenic-containing substance response to cadmium ion sulfur amino acid metabolic process Cbf1-Met4-M...
actin cortical patch organization actin filament polymerization Arp2/3 complex-mediated actin nucleation endocytosis mitotic cytokinesis
actin cortical patch; Arp2/3 protein complex; cell cortex of cell tip; cell division site; cytoplasm; cytosol
actin filament binding ATP binding
Schizosaccharomyces pombe
3D-structure Actin-binding ATP-binding Cytoplasm Cytoskeleton Nucleotide-binding Reference proteome
MASFNVPIIM
MASFNVPIIMDNGTGYSKLGYAGNDAPSYVFPTVIATRSAGASSGPAVSSKPSYMASKGSGHLSSKRATEDLDFFIGNDALKKASAGYSLDYPIRHGQIENWDHMERFWQQSLFKYLRCEPEDHYFLLTEPPLNPPENRENTAEIMFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVVDSGDGVTHIIPVAEGYVIGSSIKTMPLAGRDVTYFVQSLLRDRNEPDSSLKTAERIKEECCYVCPDIVKEFSRFDREPDRYLKYASESITGHSTTIDVGFERFLAPEIFFNPEIASSDFLTPLPELVDNVVQSSPI...
actin cortical patch organization actin filament polymerization Arp2/3 complex-mediated actin nucleation endocytosis mitotic cytokinesis actin cortical patch; Arp2/3 protein complex; cell cortex of cell tip; cell division site; cytoplasm; cytosol actin filament binding ATP binding Schizosaccharomyces pombe 3D-structur...
actin cytoskeleton organization Arp2/3 complex-mediated actin nucleation axonal fasciculation cell morphogenesis chaeta development intracellular protein transport myoblast fusion nuclear envelope budding plasma membrane tubulation positive regulation of filopodium assembly positive regulation of lamellipodium assembly...
Arp2/3 protein complex; cytosol; lamellipodium; nuclear lamina
actin binding ATP binding structural constituent of cytoskeleton
Drosophila melanogaster
Actin-binding ATP-binding Cytoplasm Cytoskeleton Nucleotide-binding Reference proteome
MAGRLPACVI
MAGRLPACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAFDATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIV...
actin cytoskeleton organization Arp2/3 complex-mediated actin nucleation axonal fasciculation cell morphogenesis chaeta development intracellular protein transport myoblast fusion nuclear envelope budding plasma membrane tubulation positive regulation of filopodium assembly positive regulation of lamellipodium assembly...
apoptotic process cellular response to arsenic-containing substance cellular response to cadmium ion erythrocyte homeostasis heme catabolic process heme metabolic process heme oxidation intracellular iron ion homeostasis negative regulation by host of viral transcription negative regulation of extrinsic apoptotic signa...
endoplasmic reticulum; endoplasmic reticulum membrane; nucleus; perinuclear region of cytoplasm
heme binding heme oxygenase (decyclizing) activity identical protein binding metal ion binding protein homodimerization activity
Sus scrofa
Apoptosis Endoplasmic reticulum Heme Iron Membrane Metal-binding Oxidoreductase Phosphoprotein Reference proteome Transmembrane Transmembrane helix
MEHSQPNSMP
MEHSQPNSMPQDLSEALKEATKEVHVQAENAEFMKNFQKGEVTREGFKLVMASLYHIYDALEEEIEHNKENPVYTPLYFPEELHRRAALEQDMAFWYGPRWQEAIPYTQATKRYVRRLQQVGRFEPELLVAHAYTRYMGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNVANATKFKQLYRSRMNTLEMTPEVKQRVLEEAKTAFLLNIQLFEEVQELLTQDTKDQRPSQASDIRKRAGSRVQDSTPVTTPRGKPQLSVLSQVPLIRWVLTLSFLVATVAMGLYAM
apoptotic process cellular response to arsenic-containing substance cellular response to cadmium ion erythrocyte homeostasis heme catabolic process heme metabolic process heme oxidation intracellular iron ion homeostasis negative regulation by host of viral transcription negative regulation of extrinsic apoptotic signa...
heme biosynthetic process
cytoplasm
ferrochelatase activity metal ion binding
Bacillus subtilis
3D-structure Cytoplasm Heme biosynthesis Iron Lyase Magnesium Metal-binding Porphyrin biosynthesis Reference proteome
MSRKKMGLLV
MSRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
heme biosynthetic process cytoplasm ferrochelatase activity metal ion binding Bacillus subtilis 3D-structure Cytoplasm Heme biosynthesis Iron Lyase Magnesium Metal-binding Porphyrin biosynthesis Reference proteome MSRKKMGLLV MSRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIED...
heme biosynthetic process
cytoplasm; plasma membrane
oxidoreductase activity oxygen-dependent protoporphyrinogen oxidase activity
Bacillus subtilis
3D-structure Cell membrane Cytoplasm Direct protein sequencing FAD Flavoprotein Heme biosynthesis Membrane Oxidoreductase Reference proteome
MSDGKKHVVI
MSDGKKHVVIIGGGITGLAAAFYMEKEIKEKNLPLELTLVEASPRVGGKIQTVKKDGYIIERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNRTLHPMPKGAVMGIPTKIAPFVSTGLFSLSGKARAAMDFILPASKTKDDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGDIDKLSLMSTFPQFYQTEQKHRSLILGMKKTRPQGSGQQLTAKKQGQFQTLSTGLQTLVEEIEKQLKLTKVYKGTKVTKLSHSGSCYSLELDNGVTLDADSVIVTAPHKAAAGMLSELPAISHLKNMHSTSVANVALGFPE...
heme biosynthetic process cytoplasm; plasma membrane oxidoreductase activity oxygen-dependent protoporphyrinogen oxidase activity Bacillus subtilis 3D-structure Cell membrane Cytoplasm Direct protein sequencing FAD Flavoprotein Heme biosynthesis Membrane Oxidoreductase Reference proteome MSDGKKHVVI MSDGKKHVVIIGGGITGLAA...
taurine biosynthetic process
endoplasmic reticulum membrane
albendazole monooxygenase activity flavin adenine dinucleotide binding hypotaurine dehydrogenase activity N,N-dimethylaniline monooxygenase activity NADP binding trimethylamine monooxygenase activity
Oryctolagus cuniculus
Direct protein sequencing Endoplasmic reticulum FAD Flavoprotein Membrane Microsome Monooxygenase NADP Oxidoreductase Reference proteome Transmembrane Transmembrane helix
MGKKVAIIGA
MGKKVAIIGAGISGLASIRSCLEEGLEPTCFEMSDDIGGLWKFSDHAEEGRASIYQSVFTNSSKEMMCFPDFPFPDDFPNFMHNSKLQEYITTFAREKNLLKYIQFKTLVSSIKKHPDFSVTGQWYVSTERNGKKETAVFDAVMICSGHHVYPNLPKDSFPGLKHFKGKSFHSREYKEPGIFKGKRVLVIGLGNSGCDIATELSHTAEQVVISSRSGSWVMSRVWDDGYPWDMLYVTRFQTFLKNNLPTAISDWWYVKQMNAKFKHENYSLMPLNGTLRKEPVFNDDLPARILCGTVSIKPNVKEFTETSAIFEDGTVFE...
taurine biosynthetic process endoplasmic reticulum membrane albendazole monooxygenase activity flavin adenine dinucleotide binding hypotaurine dehydrogenase activity N,N-dimethylaniline monooxygenase activity NADP binding trimethylamine monooxygenase activity Oryctolagus cuniculus Direct protein sequencing Endoplasmic ...
fatty acid beta-oxidation glyoxylate cycle malate metabolic process NADH regeneration tricarboxylic acid cycle
cytoplasm; mitochondrion; peroxisomal matrix; peroxisome
L-malate dehydrogenase activity mRNA binding
Saccharomyces cerevisiae
3D-structure Direct protein sequencing Glyoxylate bypass NAD Oxidoreductase Peroxisome Reference proteome Tricarboxylic acid cycle
MVKVAILGAS
MVKVAILGASGGVGQPLSLLLKLSPYVSELALYDIRAAEGIGKDLSHINTNSSCVGYDKDSIENTLSNAQVVLIPAGVPRKPGLTRDDLFKMNAGIVKSLVTAVGKFAPNARILVISNPVNSLVPIAVETLKKMGKFKPGNVMGVTNLDLVRAETFLVDYLMLKNPKIGQEQDKTTMHRKVTVIGGHSGETIIPIITDKSLVFQLDKQYEHFIHRVQFGGDEIVKAKQGAGSATLSMAFAGAKFAEEVLRSFHNEKPETESLSAFVYLPGLKNGKKAQQLVGDNSIEYFSLPIVLRNGSVVSIDTSVLEKLSPREEQLVN...
fatty acid beta-oxidation glyoxylate cycle malate metabolic process NADH regeneration tricarboxylic acid cycle cytoplasm; mitochondrion; peroxisomal matrix; peroxisome L-malate dehydrogenase activity mRNA binding Saccharomyces cerevisiae 3D-structure Direct protein sequencing Glyoxylate bypass NAD Oxidoreductase Perox...
photosynthetic electron transport in photosystem I
photosystem I; plasma membrane-derived thylakoid membrane
4 iron, 4 sulfur cluster binding electron transfer activity metal ion binding
Synechocystis sp.
3D-structure 4Fe-4S Direct protein sequencing Electron transport Iron Iron-sulfur Membrane Metal-binding Oxidoreductase Photosynthesis Photosystem I Reference proteome Repeat Thylakoid Transport
MSHSVKIYDT
MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY
photosynthetic electron transport in photosystem I photosystem I; plasma membrane-derived thylakoid membrane 4 iron, 4 sulfur cluster binding electron transfer activity metal ion binding Synechocystis sp. 3D-structure 4Fe-4S Direct protein sequencing Electron transport Iron Iron-sulfur Membrane Metal-binding Oxidoreduc...
positive regulation of ribosomal protein gene transcription by RNA polymerase II positive regulation of transcription by RNA polymerase II regulation of cell size
cytoplasm; nucleus
DNA binding metal ion binding
Saccharomyces cerevisiae
Amyloid Cytoplasm DNA-binding Metal-binding Nucleus Phosphoprotein Prion Reference proteome Repeat Stress response Transcription Transcription regulation Zinc Zinc-finger
MDFTTMTMAS
MDFTTMTMASNMATSTTTTATSAHASINSSSNFNIDIDSNQNTPSILINNNSDSSNGKNTDFNGVNNIHQKNIMNNTNNVHLYSPNIMDQTLLTPQDIAKLRRESIAHSQGMGGVSWGSISVGSWLRDEIISRRNSIVPASANGAASAAASATTTATNTLQIQQPTKRPSVSNPPYHRGYSISPQIAYTAYLPNLEKQYCKDYSCCGLSLPGLHDLLRHYEEAHISTSPNTTNMSQIPMNSAGNTSSSVRMTNNTSSANYNLQNNMAANTKNAGHKTNTMQAHSSNATNNTSINNMHANLQSNMDSNSTIRQSQHPHHQQ...
positive regulation of ribosomal protein gene transcription by RNA polymerase II positive regulation of transcription by RNA polymerase II regulation of cell size cytoplasm; nucleus DNA binding metal ion binding Saccharomyces cerevisiae Amyloid Cytoplasm DNA-binding Metal-binding Nucleus Phosphoprotein Prion Reference...
hematopoietic stem cell differentiation positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II sclerotome development somite development somite specification
cytoplasm; nucleus
chromatin binding DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific HMG box domain binding RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific DNA bi...
Mus musculus
Activator Cytoplasm Developmental protein DNA-binding Homeobox Nucleus Reference proteome Repressor Transcription Transcription regulation
MDPVANSCVR
MDPVANSCVRNPQPPAPVWGCLRNPHSEDSSASGLSHYPPTPFSFHQKSDFPATAAYPDFSASCLAATPHSLPRTERIFNEQHPAFPQTPDWHFPISEAGQRLNLGPAGSAREMGAGSPGLVDGTAGLGEDCMVLGTIANETEKKSSRRKKERSDNQENGGGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPVSPQEQDREDGDSAASPSSE
hematopoietic stem cell differentiation positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II sclerotome development somite development somite specification cytoplasm; nucleus chromatin binding DNA-binding transcription activator activity, RNA polymerase II-specific ...
angiogenesis fibroblast proliferation limb development negative regulation of cell migration involved in sprouting angiogenesis positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II roof of mouth development skeletal muscle tissue development somite development somit...
cytoplasm; nuclear speck; nucleus
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific DNA binding sequence-specific double-stranded D...
Mus musculus
Activator Developmental protein DNA-binding Homeobox Nucleus Reference proteome Transcription Transcription regulation
MEHPLFGCLR
MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQHHRGHHHHHHHHHHHHQQQQHQALQSNWHLPQMSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPADVEKRSGSKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSLANEDSRDSDHSSEHAHL
angiogenesis fibroblast proliferation limb development negative regulation of cell migration involved in sprouting angiogenesis positive regulation of transcription by RNA polymerase II regulation of transcription by RNA polymerase II roof of mouth development skeletal muscle tissue development somite development somit...
chromatin organization DNA replication-dependent chromatin assembly histone H3-K56 acetylation negative regulation of DNA damage checkpoint nucleosome assembly nucleosome disassembly positive regulation of histone acetylation positive regulation of transcription elongation by RNA polymerase II regulation of DNA repair ...
chromosome, telomeric region; cytosol; H3 histone acetyltransferase complex; nucleus
acetyltransferase activator activity histone binding
Saccharomyces cerevisiae
3D-structure Chaperone Chromatin regulator Coiled coil Nucleus Reference proteome Transcription Transcription regulation
MSIVSLLGIK
MSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNENEGDLYPPEQPGVDDEEEEDDEEEDDDEDDEDDEDDDQEDGEGEAEEAAEEEEEEEEKTEDNETNLEEEEEDIENSDGDEEEGEEEVGSVDKNEDGNDKKRRKIEGGSTDIESTPKDAARSTN
chromatin organization DNA replication-dependent chromatin assembly histone H3-K56 acetylation negative regulation of DNA damage checkpoint nucleosome assembly nucleosome disassembly positive regulation of histone acetylation positive regulation of transcription elongation by RNA polymerase II regulation of DNA repair ...
peptide catabolic process proteolysis
cell wall-bounded periplasmic space; cytoplasm; extracellular region; mitochondrion; nucleus
metalloaminopeptidase activity peptide binding zinc ion binding
Saccharomyces cerevisiae
Aminopeptidase Cytoplasm Glycoprotein Hydrolase Metal-binding Metalloprotease Mitochondrion Periplasm Protease Reference proteome Transit peptide Zinc
MPIVRWLLLK
MPIVRWLLLKSAVRGSSLIGKAHPCLRSIAAHPRYLSNVYSPPAGVSRSLRINVMWKQSKLTPPRFVKIMNRRPLFTETSHACAKCQKTSQLLNKTPNREILPDNVVPLHYDLTVEPDFKTFKFEGSVKIELKINNPAIDTVTLNTVDTDIHSAKIGDVTSSEIISEEEQQVTTFAFPKGTMSSFKGNAFLDIKFTGILNDNMAGFYRAKYEDKLTGETKYMATTQMEPTDARRAFPCFDEPNLKASFAITLVSDPSLTHLSNMDVKNEYVKDGKKVTLFNTTPKMSTYLVAFIVAELKYVESKNFRIPVRVYATPGNEK...
peptide catabolic process proteolysis cell wall-bounded periplasmic space; cytoplasm; extracellular region; mitochondrion; nucleus metalloaminopeptidase activity peptide binding zinc ion binding Saccharomyces cerevisiae Aminopeptidase Cytoplasm Glycoprotein Hydrolase Metal-binding Metalloprotease Mitochondrion Peripla...
cellular response to interleukin-1 cellular response to tumor necrosis factor cellular response to type II interferon cytolysis in another organism defense response to bacterium defense response to protozoan defense response to virus innate immune response negative regulation of ERK1 and ERK2 cascade negative regulatio...
actin cytoskeleton; cytoplasm; cytoplasmic vesicle; cytoplasmic vesicle membrane; cytosol; extracellular region; Golgi apparatus; Golgi membrane; plasma membrane; symbiont cell surface; vesicle membrane
actin binding cytokine binding enzyme binding G protein activity GDP binding GDP phosphatase activity GTP binding GTPase activity Hsp90 protein binding identical protein binding lipopolysaccharide binding protein homodimerization activity spectrin binding
Homo sapiens
3D-structure Antiviral defense Cell membrane Cytoplasm Cytoplasmic vesicle Golgi apparatus GTP-binding Hydrolase Immunity Innate immunity Isopeptide bond Lipoprotein Membrane Methylation Nucleotide-binding Prenylation Reference proteome Secreted Ubl conjugation
MASEIHMTGP
MASEIHMTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLTYVNAISSGDLPCMENAVLALA...
cellular response to interleukin-1 cellular response to tumor necrosis factor cellular response to type II interferon cytolysis in another organism defense response to bacterium defense response to protozoan defense response to virus innate immune response negative regulation of ERK1 and ERK2 cascade negative regulatio...
activation of innate immune response cellular response to interleukin-1 cellular response to lipopolysaccharide cellular response to tumor necrosis factor cellular response to type II interferon cytolysis in another organism defense response to bacterium defense response to Gram-positive bacterium defense response to p...
cytoplasm; cytoplasmic vesicle; cytoplasmic vesicle membrane; cytosol; Golgi apparatus; Golgi membrane; nucleoplasm; nucleus; perinuclear region of cytoplasm
endopeptidase inhibitor activity GTP binding GTPase activity identical protein binding molecular function inhibitor activity protein homodimerization activity
Homo sapiens
3D-structure Antimicrobial Cytoplasm Cytoplasmic vesicle Golgi apparatus GTP-binding Hydrolase Immunity Innate immunity Lipoprotein Membrane Methylation Nucleotide-binding Prenylation Reference proteome Ubl conjugation
MAPEINLPGP
MAPEINLPGPMSLIDNTKGQLVVNPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKKNGFSLGSTVKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAILLSSTFVYNSMGTINQQAMDQLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGEPITADDYLELSLKLRKGTDKKSKSFNDPRLCIRKFFPKRKCFVFDWPAPKKYLAHLEQLKEEELNPDFIEQVAEFCSYILSHSNVKTLSGGIPVNGPRLESLVLTYVNAISSGDLPCMENAVLALAQI...
activation of innate immune response cellular response to interleukin-1 cellular response to lipopolysaccharide cellular response to tumor necrosis factor cellular response to type II interferon cytolysis in another organism defense response to bacterium defense response to Gram-positive bacterium defense response to p...
cellular bud neck septin ring organization cytoskeleton-dependent cytokinesis mitotic cytokinesis septin ring assembly septin ring disassembly septum digestion after cytokinesis
ascospore wall; cell division site; cellular bud neck; cellular bud neck septin ring; Gin4 complex; mating projection base; microtubule cytoskeleton; prospore membrane; septin complex; septin filament array; septin ring
GTP binding GTPase activity molecular adaptor activity phosphatidylinositol-4-phosphate binding phosphatidylinositol-5-phosphate binding structural constituent of cytoskeleton
Saccharomyces cerevisiae
3D-structure Acetylation Cell cycle Cell division Coiled coil GTP-binding Isopeptide bond Membrane Nucleotide-binding Phosphoprotein Reference proteome Ubl conjugation
MSLKEEQVSI
MSLKEEQVSIKQDPEQEERQHDQFNDVQIKQESQDHDGVDSQYTNGTQNDDSERFEAAESDVKVEPGLGMGITSSQSEKGQVLPDQPEIKFIRRQINGYVGFANLPKQWHRRSIKNGFSFNLLCVGPDGIGKTTLMKTLFNNDDIEANLVKDYEEELANDQEEEEGQGEGHENQSQEQRHKVKIKSYESVIEENGVKLNLNVIDTEGFGDFLNNDQKSWDPIIKEIDSRFDQYLDAENKINRHSINDKRIHACLYFIEPTGHYLKPLDLKFMQSVYEKCNLIPVIAKSDILTDEEILSFKKTIMNQLIQSNIELFKPPIY...
cellular bud neck septin ring organization cytoskeleton-dependent cytokinesis mitotic cytokinesis septin ring assembly septin ring disassembly septum digestion after cytokinesis ascospore wall; cell division site; cellular bud neck; cellular bud neck septin ring; Gin4 complex; mating projection base; microtubule cytosk...
actomyosin contractile ring assembly cellular bud neck septin ring organization cytoskeleton-dependent cytokinesis division septum assembly mitotic cytokinesis positive regulation of protein phosphorylation protein localization to bud neck septin ring assembly septum digestion after cytokinesis
ascospore wall; cell division site; cellular bud neck; cellular bud neck septin ring; cytoplasmic microtubule; cytosol; Gin4 complex; mating projection base; mating projection tip; meiotic spindle; microtubule cytoskeleton; prospore membrane; septin complex; septin filament array; septin ring; spindle microtubule
GTP binding GTPase activity identical protein binding molecular adaptor activity phosphatidylinositol-4-phosphate binding phosphatidylinositol-5-phosphate binding structural constituent of cytoskeleton
Saccharomyces cerevisiae
3D-structure Acetylation Cell cycle Cell division Coiled coil GTP-binding Isopeptide bond Membrane Nucleotide-binding Phosphoprotein Reference proteome Ubl conjugation
MSGIIDASSA
MSGIIDASSALRKRKHLKRGITFTVMIVGQSGSGRSTFINTLCGQQVVDTSTTILLPTDTSTEIDLQLREETVELEDDEGVKIQLNIIDTPGFGDSLDNSPSFEIISDYIRHQYDEILLEESRVRRNPRFKDGRVHCCLYLINPTGHGLKEIDVEFIRQLGSLVNIIPVISKSDSLTRDELKLNKKLIMEDIDRWNLPIYNFPFDEDEISDEDYETNMYLRTLLPFAIIGSNEVYEMGGDVGTIRGRKYPWGILDVEDSSISDFVILRNALLISHLHDLKNYTHEILYERYRTEALSGESVAAESIRPNLTKLNGSSSSS...
actomyosin contractile ring assembly cellular bud neck septin ring organization cytoskeleton-dependent cytokinesis division septum assembly mitotic cytokinesis positive regulation of protein phosphorylation protein localization to bud neck septin ring assembly septum digestion after cytokinesis ascospore wall; cell div...
protein histidyl modification to diphthamide
cytoplasm; protein-containing complex
2-(3-amino-3-carboxypropyl)histidine synthase activity 4 iron, 4 sulfur cluster binding metal ion binding
Saccharomyces cerevisiae
Cytoplasm Iron Iron-sulfur Metal-binding Reference proteome
MEVAPALSTT
MEVAPALSTTQSDVAFQKVETHEIDRSSYLGPCYNSDELMQLISAYYNVEPLVGYLEQHPEYQNVTLQFPDDLIKDSSLIVRLLQSKFPHGKIKFWVLADTAYSACCVDEVAAEHVHAEVVVHFGDACLNAIQNLPVVYSFGTPFLDLALVVENFQRAFPDLSSKICLMANAPFSKHLSQLYNILKGDLHYTNIIYSQVNTSAVEEKFVTILDTFHVPEDVDQVGVFEKNSVLFGQHDKADNISPEDYHLFHLTTPQDPRLLYLSTVFQSVHIFDPALPGMVTGPFPSLMRRYKYMHVARTAGCIGILVNTLSLRNTRET...
protein histidyl modification to diphthamide cytoplasm; protein-containing complex 2-(3-amino-3-carboxypropyl)histidine synthase activity 4 iron, 4 sulfur cluster binding metal ion binding Saccharomyces cerevisiae Cytoplasm Iron Iron-sulfur Metal-binding Reference proteome MEVAPALSTT MEVAPALSTTQSDVAFQKVETHEIDRSSYLGPCY...
ergosterol biosynthetic process
endoplasmic reticulum; membrane
delta14-sterol reductase activity NADP binding
Saccharomyces cerevisiae
Lipid biosynthesis Lipid metabolism Membrane NADP Oxidoreductase Reference proteome Steroid biosynthesis Steroid metabolism Sterol biosynthesis Sterol metabolism Transmembrane Transmembrane helix
MVSALNPRTT
MVSALNPRTTEFEFGGLIGALGISIGLPVFTIILNQMIRPDYFIKGFFQNFDIVELWNGIKPLRYYLGNRELWTVYCLWYGILAVLDVILPGRVMKGVQLRDGSKLSYKINGIAMSTTLVLVLAIRWKLTDGQLPELQYLYENHVSLCIISILFSFFLATYCYVASFIPLIFKKNGNGKREKILALGGNSGNIIYDWFIGRELNPRLGPLDIKMFSELRPGMLLWLLINLSCLHHHYLKTGKINDALVLVNFLQGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLSLVPFTYSLQARYLSVSPVELGWVKVVGILAI...
ergosterol biosynthetic process endoplasmic reticulum; membrane delta14-sterol reductase activity NADP binding Saccharomyces cerevisiae Lipid biosynthesis Lipid metabolism Membrane NADP Oxidoreductase Reference proteome Steroid biosynthesis Steroid metabolism Sterol biosynthesis Sterol metabolism Transmembrane Transme...
carbohydrate transport glucose transmembrane transport mannose transmembrane transport
cell periphery; plasma membrane
carbohydrate:proton symporter activity fructose transmembrane transporter activity galactose transmembrane transporter activity glucose transmembrane transporter activity mannose transmembrane transporter activity pentose transmembrane transporter activity
Saccharomyces cerevisiae
Glycoprotein Membrane Phosphoprotein Reference proteome Repeat Sugar transport Transmembrane Transmembrane helix Transport
MNSTPDLISP
MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQPAVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFGMKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVVVIYTIGIIIQIASINKWYQYFIGRIISGLGVGGITVLSPMLISEVAPSEMRGTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIGGMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASVEEMRAAGTASWGELFTGKPA...
carbohydrate transport glucose transmembrane transport mannose transmembrane transport cell periphery; plasma membrane carbohydrate:proton symporter activity fructose transmembrane transporter activity galactose transmembrane transporter activity glucose transmembrane transporter activity mannose transmembrane transpor...
carbohydrate transport glucose transmembrane transport hexose transmembrane transport transmembrane transport
cell periphery; plasma membrane
carbohydrate:proton symporter activity fructose transmembrane transporter activity glucose transmembrane transporter activity mannose transmembrane transporter activity
Saccharomyces cerevisiae
Glycoprotein Membrane Phosphoprotein Reference proteome Repeat Sugar transport Transmembrane Transmembrane helix Transport
MNSTPDLISP
MNSTPDLISPQKSSENSNADLPSNSSQVMNMPEEKGVQDDFQAEADQVLTNPNTGKGAYVTVSICCVMVAFGGFVFGWDTGTISGFVAQTDFLRRFGMKHKDGSYYLSKVRTGLIVSIFNIGCAIGGIILAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLISEVAPKEMRGTLVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLVEAGQIDEARASLSKVNKVAPDHPFIQQELEVIEASVEEARAAGSASWGELFTGKPAMFK...
carbohydrate transport glucose transmembrane transport hexose transmembrane transport transmembrane transport cell periphery; plasma membrane carbohydrate:proton symporter activity fructose transmembrane transporter activity glucose transmembrane transporter activity mannose transmembrane transporter activity Saccharom...
carbohydrate transport hexose transmembrane transport
cell periphery; plasma membrane
carbohydrate:proton symporter activity fructose transmembrane transporter activity glucose transmembrane transporter activity mannose transmembrane transporter activity pentose transmembrane transporter activity
Saccharomyces cerevisiae
Cell membrane Glycoprotein Isopeptide bond Membrane Reference proteome Repeat Sugar transport Transmembrane Transmembrane helix Transport Ubl conjugation
MSEEAAYQED
MSEEAAYQEDTAVQNTPADALSPVESDSNSALSTPSNKAERDDMKDFDENHEESNNYVEIPKKPASAYVTVSICCLMVAFGGFVFGWDTGTISGFVAQTDFIRRFGMKHHDGTYYLSKVRTGLIVSIFNIGCAIGGIILAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHIRGTLVSCYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGLGFAWALFMIGGMTFVPESPRYLVEVGKIEEAKRSIALSNKVSADDPAVMAEVEVVQATVEAEKLAGNASWGEI...
carbohydrate transport hexose transmembrane transport cell periphery; plasma membrane carbohydrate:proton symporter activity fructose transmembrane transporter activity glucose transmembrane transporter activity mannose transmembrane transporter activity pentose transmembrane transporter activity Saccharomyces cerevisi...
cellular bud neck septin ring organization cytoskeleton-dependent cytokinesis maintenance of cell polarity mitotic actomyosin contractile ring assembly mitotic cytokinesis positive regulation of protein phosphorylation septin ring assembly septum digestion after cytokinesis
ascospore wall; cell division site; cellular bud neck; cellular bud neck septin ring; cellular bud scar; cytoplasm; Gin4 complex; mating projection; microtubule cytoskeleton; prospore membrane; septin complex; septin filament array; septin ring
GTP binding GTPase activity molecular adaptor activity phosphatidylinositol-4-phosphate binding phosphatidylinositol-5-phosphate binding structural constituent of cytoskeleton
Saccharomyces cerevisiae
Acetylation Cell cycle Cell division Coiled coil GTP-binding Membrane Nucleotide-binding Reference proteome
MSAATATAAP
MSAATATAAPVPPPVGISNLPNQRYKIVNEEGGTFTVMLCGESGLGKTTFINTLFQTVLKRADGQQHRQEPIRKTVEIDITRALLEEKHFELRVNVIDTPGFGDNVNNNKAWQPLVDFIDDQHDSYMRQEQQPYRTKKFDLRVHAVLYFIRPTGHGLKPIDIETMKRLSTRANLIPVIAKADTLTAQELQQFKSRIRQVIEAQEIRIFTPPLDADSKEDAKSGSNPDSAAVEHARQLIEAMPFAIVGSEKKFDNGQGTQVVARKYPWGLVEIENDSHCDFRKLRALLLRTYLLDLISTTQEMHYETYRRLRLEGHENTGE...
cellular bud neck septin ring organization cytoskeleton-dependent cytokinesis maintenance of cell polarity mitotic actomyosin contractile ring assembly mitotic cytokinesis positive regulation of protein phosphorylation septin ring assembly septum digestion after cytokinesis ascospore wall; cell division site; cellular ...
maintenance of translational fidelity negative regulation of actin filament bundle assembly regulation of translational termination translational elongation
cytosol; eukaryotic translation elongation factor 1 complex; ribosome
guanyl-nucleotide exchange factor activity translation elongation factor activity
Saccharomyces cerevisiae
3D-structure Acetylation Direct protein sequencing Elongation factor Isopeptide bond Phosphoprotein Protein biosynthesis Reference proteome Ubl conjugation
MASTDFSKIE
MASTDFSKIETLKQLNASLADKSYIEGTAVSQADVTVFKAFQSAYPEFSRWFNHIASKADEFDSFPAASAAAAEEEEDDDVDLFGSDDEEADAEAEKLKAERIAAYNAKKAAKPAKPAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQSIEEDEDHVQSTDIAAMQKL
maintenance of translational fidelity negative regulation of actin filament bundle assembly regulation of translational termination translational elongation cytosol; eukaryotic translation elongation factor 1 complex; ribosome guanyl-nucleotide exchange factor activity translation elongation factor activity Saccharomyc...
chaperone-mediated protein folding
cytoplasm; endoplasmic reticulum; endoplasmic reticulum membrane; fungal-type vacuole; membrane; nucleus
FK506 binding peptidyl-prolyl cis-trans isomerase activity
Saccharomyces cerevisiae
Direct protein sequencing Endoplasmic reticulum Isomerase Membrane Reference proteome Rotamase Signal
MMFNIYLFVT
MMFNIYLFVTFFSTILAGSLSDLEIGIIKRIPVEDCLIKAMPGDKVKVHYTGSLLESGTVFDSSYSRGSPIAFELGVGRVIKGWDQGVAGMCVGEKRKLQIPSSLAYGERGVPGVIPPSADLVFDVELVDVKSAA
chaperone-mediated protein folding cytoplasm; endoplasmic reticulum; endoplasmic reticulum membrane; fungal-type vacuole; membrane; nucleus FK506 binding peptidyl-prolyl cis-trans isomerase activity Saccharomyces cerevisiae Direct protein sequencing Endoplasmic reticulum Isomerase Membrane Reference proteome Rotamase ...
acetyl-CoA biosynthetic process from pyruvate glycolytic process
mitochondrial nucleoid; mitochondrial pyruvate dehydrogenase complex; mitochondrion
pyruvate dehydrogenase (acetyl-transferring) activity
Saccharomyces cerevisiae
Direct protein sequencing Glycolysis Mitochondrion Oxidoreductase Pyruvate Reference proteome Thiamine pyrophosphate Transit peptide
MFSRLPTSLA
MFSRLPTSLARNVARRAPTSFVRPSAAAAALRFSSTKTMTVREALNSAMAEELDRDDDVFLIGEEVAQYNGAYKVSKGLLDRFGERRVVDTPITEYGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDHVVNSAAKTHYMSGGTQKCQMVFRGPNGAAVGVGAQHSQDFSPWYGSIPGLKVLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEISEEALSPEFTLPYKAKIEREGTDISIVTYTRNVQFSLEAAEILQKKYGVSAEVINLRSIRPLDTEAIIKTVKKTNHLITVESTFPSFGVGAEIVAQVMESEA...
acetyl-CoA biosynthetic process from pyruvate glycolytic process mitochondrial nucleoid; mitochondrial pyruvate dehydrogenase complex; mitochondrion pyruvate dehydrogenase (acetyl-transferring) activity Saccharomyces cerevisiae Direct protein sequencing Glycolysis Mitochondrion Oxidoreductase Pyruvate Reference proteo...
protein folding response to endoplasmic reticulum stress
endoplasmic reticulum; endoplasmic reticulum lumen
protein disulfide isomerase activity protein-disulfide reductase (glutathione) activity protein-disulfide reductase activity unfolded protein binding
Saccharomyces cerevisiae
Endoplasmic reticulum Glycoprotein Isomerase Redox-active center Reference proteome Repeat Signal
MQVTTRFISA
MQVTTRFISAIVSFCLFASFTLAENSARATPGSDLLVLTEKKFKSFIESHPLVLVEFFAPWCLHSQILRPHLEEAASILKEHNVPVVQIDCEANSMVCLQQTINTYPTLKIFKNGRIFDGQVYRGVKITDEITQYMIQLYEASVIYLNSEDEIQPYLENATLPVVINRGLTGLNETYQEVALDLAEDYVFLSLLDSEDKSLSIHLPNTTEPILFDGNVDSLVGNSVALTQWLKVVILPYFTDIEPDLFPKYISSNLPLAYFFYTSEEELEDYTDLFTQLGKENRGQINFIALNSTMFPHHVRFLNMREQFPLFAIHNMIN...
protein folding response to endoplasmic reticulum stress endoplasmic reticulum; endoplasmic reticulum lumen protein disulfide isomerase activity protein-disulfide reductase (glutathione) activity protein-disulfide reductase activity unfolded protein binding Saccharomyces cerevisiae Endoplasmic reticulum Glycoprotein I...
ergosterol biosynthetic process
endoplasmic reticulum; endoplasmic reticulum membrane; lipid droplet
flavin adenine dinucleotide binding squalene monooxygenase activity
Saccharomyces cerevisiae
Direct protein sequencing Endoplasmic reticulum FAD Flavoprotein Isopeptide bond Lipid biosynthesis Lipid droplet Lipid metabolism Membrane Microsome Oxidoreductase Reference proteome Steroid biosynthesis Steroid metabolism Sterol biosynthesis Sterol metabolism Transmembrane Transmembrane helix Ubl conjugation
MSAVNVAPEL
MSAVNVAPELINADNTITYDAIVIGAGVIGPCVATGLARKGKKVLIVERDWAMPDRIVGELMQPGGVRALRSLGMIQSINNIEAYPVTGYTVFFNGEQVDIPYPYKADIPKVEKLKDLVKDGNDKVLEDSTIHIKDYEDDERERGVAFVHGRFLNNLRNITAQEPNVTRVQGNCIEILKDEKNEVVGAKVDIDGRGKVEFKAHLTFICDGIFSRFRKELHPDHVPTVGSSFVGMSLFNAKNPAPMHGHVILGSDHMPILVYQISPEETRILCAYNSPKVPADIKSWMIKDVQPFIPKSLRPSFDEAVSQGKFRAMPNSYL...
ergosterol biosynthetic process endoplasmic reticulum; endoplasmic reticulum membrane; lipid droplet flavin adenine dinucleotide binding squalene monooxygenase activity Saccharomyces cerevisiae Direct protein sequencing Endoplasmic reticulum FAD Flavoprotein Isopeptide bond Lipid biosynthesis Lipid droplet Lipid metab...
fungal-type cell wall organization
cellular bud scar; cytosol; extracellular region; fungal-type cell wall
ATP hydrolysis activity structural constituent of cell wall
Saccharomyces cerevisiae
Cell wall Cell wall biogenesis/degradation Cleavage on pair of basic residues Direct protein sequencing Glycoprotein Reference proteome Repeat Secreted Signal Stress response
MQYKKTLVAS
MQYKKTLVASALAATTLAAYAPSEPWSTLTPTATYSGGVTDYASTFGIAVQPISTTSSASSAATTASSKAKRAASQIGDGQVQAATTTASVSTKSTAAAVSQIGDGQIQATTKTTAAAVSQIGDGQIQATTKTTSAKTTAAAVSQISDGQIQATTTTLAPKSTAAAVSQIGDGQVQATTTTLAPKSTAAAVSQIGDGQVQATTKTTAAAVSQIGDGQVQATTKTTAAAVSQIGDGQVQATTKTTAAAVSQIGDGQVQATTKTTAAAVSQITDGQVQATTKTTQAASQVSDGQVQATTATSASAAATSTDPVDAVSCKTSG...
fungal-type cell wall organization cellular bud scar; cytosol; extracellular region; fungal-type cell wall ATP hydrolysis activity structural constituent of cell wall Saccharomyces cerevisiae Cell wall Cell wall biogenesis/degradation Cleavage on pair of basic residues Direct protein sequencing Glycoprotein Reference ...
chromatin organization chromatin remodeling negative regulation of chromatin organization negative regulation of transcription by RNA polymerase II negative regulation of transcription by RNA polymerase III nucleosome assembly transcription elongation by RNA polymerase II
chromosome, centromeric region; HIR complex; nucleus
identical protein binding transcription corepressor activity
Saccharomyces cerevisiae
Centromere Chromatin regulator Chromosome Nucleus Phosphoprotein Reference proteome Repeat Repressor Transcription Transcription regulation WD repeat
MKVVKFPWLA
MKVVKFPWLAHREESRKYEIYTVDVSHDGKRLATGGLDGKIRIWSIDSILRCMELESLTPEIPLPQDLQMPLCSMSRHTGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGSTFEKLKRFDVHQSLVKGVVFDPANKYFATTSDDRTMKIFRYHKTGDISFTIEHIITEPFKESPLTTYFRRPSWSPDGQHIAVPNATNGPVSSVAIVNRGTWDTNVSLIGHDAPTEVARFNPRLFERNAGVKQKKDDDPENALVGQNDDKVHHF...
chromatin organization chromatin remodeling negative regulation of chromatin organization negative regulation of transcription by RNA polymerase II negative regulation of transcription by RNA polymerase III nucleosome assembly transcription elongation by RNA polymerase II chromosome, centromeric region; HIR complex; nu...
chromatin organization chromatin remodeling negative regulation of chromatin organization negative regulation of transcription by RNA polymerase II negative regulation of transcription by RNA polymerase III nucleosome assembly transcription elongation-coupled chromatin remodeling
chromosome; cytosol; HIR complex; nucleus
transcription corepressor activity
Saccharomyces cerevisiae
Chromatin regulator Chromosome Nucleus Phosphoprotein Reference proteome Repeat Repressor Transcription Transcription regulation WD repeat
MRLLKYPLDI
MRLLKYPLDIHNEQVNALAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEVSFQVDQDTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKLLFECKSPSTITDVKYDINLGILFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGIIDPTGQTFTVMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKGVPNNATSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYNLIATSGSTDGTILVWNTKRMKPLFNALQV...
chromatin organization chromatin remodeling negative regulation of chromatin organization negative regulation of transcription by RNA polymerase II negative regulation of transcription by RNA polymerase III nucleosome assembly transcription elongation-coupled chromatin remodeling chromosome; cytosol; HIR complex; nucle...
formation of translation preinitiation complex positive regulation of translational fidelity translational initiation
cytosol; eukaryotic 43S preinitiation complex; eukaryotic 48S preinitiation complex; eukaryotic translation initiation factor 2 complex; multi-eIF complex; ribosome
GTP binding GTPase activity methionyl-initiator methionine tRNA binding translation initiation factor activity translation initiation factor binding
Saccharomyces cerevisiae
3D-structure Cytoplasm GTP-binding Hydrolase Initiation factor Nucleotide-binding Phosphoprotein Protein biosynthesis Reference proteome
MSDLQDQEPS
MSDLQDQEPSIIINGNLEPVGEPDIVEETEVVAQETQETQDADKPKKKVAFTGLEEDGETEEEKRKREFEEGGGLPEQPLNPDFSKLNPLSAEIINRQATINIGTIGHVAHGKSTVVRAISGVQTVRFKDELERNITIKLGYANAKIYKCQEPTCPEPDCYRSFKSDKEISPKCQRPGCPGRYKLVRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHVIILQNKVDLMREESALEHQKSILKFIRGTIADGAPIVPISAQLKYNIDAVNEFIVKTIPVPPRDFMISPRLIVIRS...
formation of translation preinitiation complex positive regulation of translational fidelity translational initiation cytosol; eukaryotic 43S preinitiation complex; eukaryotic 48S preinitiation complex; eukaryotic translation initiation factor 2 complex; multi-eIF complex; ribosome GTP binding GTPase activity methionyl...
cellular response to oxidative stress hyperosmotic response negative regulation of exit from mitosis osmosensory signaling pathway phosphorylation positive regulation of transcription by RNA polymerase II regulation of macroautophagy regulation of nuclear cell cycle DNA replication regulation of transcription by RNA po...
cytoplasm; nucleus
ATP binding calmodulin binding chromatin binding MAP kinase activity protein serine kinase activity protein serine/threonine kinase activity
Saccharomyces cerevisiae
Acetylation Activator ATP-binding Cytoplasm Kinase Nucleotide-binding Nucleus Phosphoprotein Reference proteome Serine/threonine-protein kinase Transcription Transcription regulation Transferase
MTTNEEFIRT
MTTNEEFIRTQIFGTVFEITNRYNDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLKFVTSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHPYSAPYHDPTDEPVADAKFDW...
cellular response to oxidative stress hyperosmotic response negative regulation of exit from mitosis osmosensory signaling pathway phosphorylation positive regulation of transcription by RNA polymerase II regulation of macroautophagy regulation of nuclear cell cycle DNA replication regulation of transcription by RNA po...
(1->6)-beta-D-glucan biosynthetic process fungal-type cell wall organization
cellular bud neck; endoplasmic reticulum membrane; Golgi membrane; membrane; plasma membrane; site of polarized growth; transport vesicle
glucosidase activity
Saccharomyces cerevisiae
Cell wall biogenesis/degradation Glycoprotein Golgi apparatus Membrane Phosphoprotein Reference proteome Signal-anchor Transmembrane Transmembrane helix
MPLRNLTETH
MPLRNLTETHNFSSTNLDTDGTGDDHDGAPLSSSPSFGQQNDNSTNDNAGLTNPFMGSDEESNARDGESLSSSVHYQPQGSDSSLLHDNSRLDLSQNKGVSDYKGYYSRNNSRAVSTANDNSFLQPPHRAIASSPSLNSNLSKNDILSPPEFDRYPLVGSRVTSMTQLNHHGRSPTSSPGNESSASFSSNPFLGEQDFSPFGGYPASSFPLMIDEKEEDDYLHNPDPEEEARLDRRRFIDDFKYMDKRSASGLAGVLLLFLAAIFIFIVLPALTFTGAIDHESNTEEVTYLTQYQYPQLSAIRTSLVDPDTPDTAKTREA...
(1->6)-beta-D-glucan biosynthetic process fungal-type cell wall organization cellular bud neck; endoplasmic reticulum membrane; Golgi membrane; membrane; plasma membrane; site of polarized growth; transport vesicle glucosidase activity Saccharomyces cerevisiae Cell wall biogenesis/degradation Glycoprotein Golgi appara...
cell wall integrity MAPK cascade pexophagy phosphorylation regulation of fungal-type cell wall organization signal transduction
cellular bud neck; cellular bud tip; cytoplasm; mating projection tip
ATP binding MAP kinase kinase activity protein kinase activity protein serine kinase activity protein serine/threonine kinase activity protein tyrosine kinase activity
Saccharomyces cerevisiae
ATP-binding Kinase Nucleotide-binding Phosphoprotein Reference proteome Serine/threonine-protein kinase Transferase
MASLFRPPES
MASLFRPPESAKCNPNSPRLKLPLLRNNQVDENNIYLTSNGSSTTAYSSHTPEPLTSSTSTLFSQTRLHPSDSSMTLNTMKKRPAPPSLPSLSINSQSKCKTLPELVPIADVSDGKHDLGLKQRVIAENELSGNSDLTPSSMASPFSHTNTSSPYLRNDLSNSVGSDFSNLISAYEQSSSPIKSSSQPKSSSESYIDLNSVRDVDQLDENGWKYANLKDRIETLGILGEGAGGSVSKCKLKNGSKIFALKVINTLNTDPEYQKQIFRELQFNRSFQSEYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLERGGR...
cell wall integrity MAPK cascade pexophagy phosphorylation regulation of fungal-type cell wall organization signal transduction cellular bud neck; cellular bud tip; cytoplasm; mating projection tip ATP binding MAP kinase kinase activity protein kinase activity protein serine kinase activity protein serine/threonine kin...
cell wall integrity MAPK cascade pexophagy phosphorylation regulation of fungal-type cell wall organization signal transduction
cellular bud neck; cellular bud tip; cytoplasm; cytosol; mating projection tip
ATP binding MAP kinase kinase activity protein serine kinase activity protein serine/threonine kinase activity protein tyrosine kinase activity
Saccharomyces cerevisiae
ATP-binding Kinase Nucleotide-binding Reference proteome Serine/threonine-protein kinase Transferase Tyrosine-protein kinase
MASMFRPPES
MASMFRPPESNRSHQKTPKLTLPVNLVQNAKSTNDGQHLNRSPYSSVNESPYSNNSTSATSTTSSMASNSTLLYNRSSTTTIKNRPVPPPLPPLVLTQKKDGIEYRVAGDSQLSERFSNLHVDITYKELLSSAPISTKLSNIDTTFIKKDLDTPEGEDSYPSTLLSAYDFSSSGSNSAPLSANNIISCSNLIQGKDVDQLEEEAWRFGHLKDEITTLGILGEGAGGSVAKCRLKNGKKVFALKTINTMNTDPEYQKQIFRELQFNKSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIG...
cell wall integrity MAPK cascade pexophagy phosphorylation regulation of fungal-type cell wall organization signal transduction cellular bud neck; cellular bud tip; cytoplasm; cytosol; mating projection tip ATP binding MAP kinase kinase activity protein serine kinase activity protein serine/threonine kinase activity pr...
chromatin organization chromatin remodeling regulation of transcription by RNA polymerase II
ADA complex; nucleus; SAGA complex; SLIK (SAGA-like) complex
transcription coactivator activity
Saccharomyces cerevisiae
Chromatin regulator Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation
MPRHGRRGKL
MPRHGRRGKLPKGEKLPKKEGGDNTPSKLLSSMLKTLDLTFERDIGMLNGKSVRSIPNKKTLLELQSQLDSLNEILGTIARGDQETIEALRKIRDSKNEKQANDEKQETSNADGQHESSTATEETNIIDKGVQSPPKPPPSNEISGTIENDVESIKQAADNMAKEEINEDKDLQVHRDQPREKRPFDSETENRATENENTQRPDNKKQKIDVDKMENDPTVKNPKSEFVVSQTLPRAAAALGLFNEEGLESTGEDFLKKKYNVASYPTNDLKDLLPGELPDMDFSHPKPTNQIQFNTFLAFVENFFKDLSDDNLKFLKMK...
chromatin organization chromatin remodeling regulation of transcription by RNA polymerase II ADA complex; nucleus; SAGA complex; SLIK (SAGA-like) complex transcription coactivator activity Saccharomyces cerevisiae Chromatin regulator Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation MPRH...
box H/ACA snoRNP assembly maturation of LSU-rRNA rRNA processing rRNA pseudouridine synthesis snoRNA guided rRNA pseudouridine synthesis snRNA pseudouridine synthesis
box H/ACA snoRNP complex; cytosolic large ribosomal subunit; nucleolus; sno(s)RNA-containing ribonucleoprotein complex
box H/ACA snoRNA binding
Saccharomyces cerevisiae
3D-structure Direct protein sequencing Nucleus Reference proteome Ribonucleoprotein Ribosome biogenesis RNA-binding rRNA processing
MGKDNKEHKE
MGKDNKEHKESKESKTVDNYEARMPAVLPFAKPLASKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDGKNKEEEYKESFNEVVKEVQAL
box H/ACA snoRNP assembly maturation of LSU-rRNA rRNA processing rRNA pseudouridine synthesis snoRNA guided rRNA pseudouridine synthesis snRNA pseudouridine synthesis box H/ACA snoRNP complex; cytosolic large ribosomal subunit; nucleolus; sno(s)RNA-containing ribonucleoprotein complex box H/ACA snoRNA binding Saccharom...
formation of cytoplasmic translation initiation complex translational initiation
cytoplasm; cytoplasmic stress granule; eukaryotic 43S preinitiation complex; eukaryotic 48S preinitiation complex; eukaryotic translation initiation factor 3 complex; multi-eIF complex
mRNA binding translation initiation factor activity translation initiation factor binding
Saccharomyces cerevisiae
3D-structure Cytoplasm Initiation factor Phosphoprotein Protein biosynthesis Reference proteome
MSRFFSSNYE
MSRFFSSNYEYDVASSSSEEDLLSSSEEDLLSSSSSESELDQESDDSFFNESESESEADVDSDDSDAKPYGPDWFKKSEFRKQGGGSNKFLKSSNYDSSDEESDEEDGKKVVKSAKEKLLDEMQDVYNKISQAENSDDWLTISNEFDLISRLLVRAQQQNWGTPNIFIKVVAQVEDAVNNTQQADLKNKAVARAYNTTKQRVKKVSRENEDSMAKFRNDPESFDKEPTADLDISANGFTISSSQGNDQAVQEDFFTRLQTIIDSRGKKTVNQQSLISTLEELLTVAEKPYEFIMAYLTLIPSRFDASANLSYQPIDQWKS...
formation of cytoplasmic translation initiation complex translational initiation cytoplasm; cytoplasmic stress granule; eukaryotic 43S preinitiation complex; eukaryotic 48S preinitiation complex; eukaryotic translation initiation factor 3 complex; multi-eIF complex mRNA binding translation initiation factor activity tr...
mRNA export from nucleus in response to heat stress NLS-bearing protein import into nucleus nucleocytoplasmic transport poly(A)+ mRNA export from nucleus post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery protein export from nucleus protein localization to nuclear inner membrane silent ma...
chromosome, telomeric region; cytoplasm; mitochondrion; NLS-dependent protein nuclear import complex; nuclear envelope; nuclear membrane; nuclear pore; nuclear pore cytoplasmic filaments; nuclear pore nuclear basket
importin-alpha family protein binding small GTPase binding structural constituent of nuclear pore
Saccharomyces cerevisiae
3D-structure Membrane mRNA transport Nuclear pore complex Nucleus Phosphoprotein Protein transport Reference proteome Repeat Translocation Transport
MAKRVADAQI
MAKRVADAQIQRETYDSNESDDDVTPSTKVASSAVMNRRKIAMPKRRMAFKPFGSAKSDETKQASSFSFLNRADGTGEAQVDNSPTTESNSRLKALNLQFKAKVDDLVLGKPLADLRPLFTRYELYIKNILEAPVKSIENPTQTKGNDAKPAKVEDVQKSSDSSSEDEVKVEGPKFTIDAKPPISDSVFSFGPKKENRKKDESDSENDIEIKGPEFKFSGTVSSDVFKLNPSTDKNEKKTETNAKPFSFSSATSTTEQTKSKNPLSLTEATKTNVDNNSKAEASFTFGTKHAADSQNNKPSFVFGQAAAKPSLEKSSFTF...
mRNA export from nucleus in response to heat stress NLS-bearing protein import into nucleus nucleocytoplasmic transport poly(A)+ mRNA export from nucleus post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery protein export from nucleus protein localization to nuclear inner membrane silent ma...
mRNA transport nuclear pore organization nucleocytoplasmic transport protein transport spindle pole body duplication spindle pole body localization
cytoplasm; nuclear envelope; nuclear membrane; nuclear pore; nuclear pore transmembrane ring; spindle pole body
spindle pole body-nuclear membrane anchor activity structural constituent of nuclear pore
Saccharomyces cerevisiae
Cytoplasm Cytoskeleton Membrane mRNA transport Nuclear pore complex Nucleus Phosphoprotein Protein transport Reference proteome Translocation Transmembrane Transmembrane helix Transport
MIQTPRELLN
MIQTPRELLNPRYTYHTIFSDVCKTRFNHLVTRLFFICSIIQTVVISLLALPHSPLWELALAFIPNILALNLVSLLIIVTRKNYMHVKNFGFANSLTFILGQLLSVKFLVYQGVYSMGSILLSFVLGVVFGRGGSGWKPYYKLFIWLVVPTIYNLQHHVTDADKLSFNCENFFQAPQDYVLERVKRIMEKSVILSVISMFVLPIFTTVFFSRQKSGLFDSFTNGVLAVTNLLIISCIIFITFEFINIAFDAHMSIGCLHKGKLISNLSSTPMETLLSGLSADKPFTRLTAYQELAYRATSLDPSLRAPIYHSKFRSSSGN...
mRNA transport nuclear pore organization nucleocytoplasmic transport protein transport spindle pole body duplication spindle pole body localization cytoplasm; nuclear envelope; nuclear membrane; nuclear pore; nuclear pore transmembrane ring; spindle pole body spindle pole body-nuclear membrane anchor activity structura...
cytoplasmic translational initiation regulation of translational initiation
cytoplasm; cytosol; eukaryotic translation initiation factor 2B complex; guanyl-nucleotide exchange factor complex
guanyl-nucleotide exchange factor activity translation initiation factor activity translation initiation factor binding
Saccharomyces cerevisiae
3D-structure Cytoplasm Initiation factor Phosphoprotein Protein biosynthesis Reference proteome Translation regulation
MAGKKGQKKS
MAGKKGQKKSGLGNHGKNSDMDVEDRLQAVVLTDSYETRFMPLTAVKPRCLLPLANVPLIEYTLEFLAKAGVHEVFLICSSHANQINDYIENSKWNLPWSPFKITTIMSPEARCTGDVMRDLDNRGIITGDFILVSGDVLTNIDFSKMLEFHKKMHLQDKDHISTMCLSKASTYPKTRTIEPAAFVLDKSTSRCIYYQDLPLPSSREKTSIQIDPELLDNVDEFVIRNDLIDCRIDICTSHVPLIFQENFDYQSLRTDFVKGVISSDILGKHIYAYLTDEYAVRVESWQTYDTISQDFLGRWCYPLVLDSNIQDDQTYSY...
cytoplasmic translational initiation regulation of translational initiation cytoplasm; cytosol; eukaryotic translation initiation factor 2B complex; guanyl-nucleotide exchange factor complex guanyl-nucleotide exchange factor activity translation initiation factor activity translation initiation factor binding Saccharom...
cytoplasmic translational initiation regulation of translational initiation translational initiation
cytosol; eukaryotic translation initiation factor 2B complex; guanyl-nucleotide exchange factor complex; mitochondrion
enzyme regulator activity translation initiation factor activity
Saccharomyces cerevisiae
3D-structure Cytoplasm Initiation factor Protein biosynthesis Reference proteome Translation regulation
MSSQAFTSVH
MSSQAFTSVHPNAATSDVNVTIDTFVAKLKRRQVQGSYAIALETLQLLMRFISAARWNHVNDLIEQIRDLGNSLEKAHPTAFSCGNVIRRILAVLRDEVEEDTMSTTVTSTSVAEPLISSMFNLLQKPEQPHQNRKNSSGSSSMKTKTDYRQVAIQGIKDLIDEIKNIDEGIQQIAIDLIHDHEILLTPTPDSKTVLKFLITARERSNRTFTVLVTEGFPNNTKNAHEFAKKLAQHNIETLVVPDSAVFALMSRVGKVIIGTKAVFVNGGTISSNSGVSSVCECAREFRTPVFAVAGLYKLSPLYPFDVEKFVEFGGSQR...
cytoplasmic translational initiation regulation of translational initiation translational initiation cytosol; eukaryotic translation initiation factor 2B complex; guanyl-nucleotide exchange factor complex; mitochondrion enzyme regulator activity translation initiation factor activity Saccharomyces cerevisiae 3D-struct...
chromosome segregation kinetochore assembly mitotic spindle elongation septin ring assembly
CBF3 complex; condensed chromosome, centromeric region; cytoplasm; kinetochore; nucleus; spindle; spindle midzone; spindle pole body
centromeric DNA binding DNA binding DNA binding, bending
Saccharomyces cerevisiae
3D-structure Centromere Chromosome Cytoplasm Cytoskeleton Direct protein sequencing DNA-binding Nucleus Phosphoprotein Reference proteome
MRSSILFLLK
MRSSILFLLKLMKIMDVQQQQEAMSSEDRFQELVDSLKPRTAHQYKTYYTKYIQWCQLNQIIPTPEDNSVNSVPYKDLPISAELIHWFLLDTLITDDKPGEKREETEDLDEEEENSFKIATLKKIIGSLNFLSKLCKVHENPNANIDTKYLESVTKLHTHWIDSQKAITTNETNNTNTQVLCPPLLKVSLNLWNPETNHLSEKFFKTCSEKLRFLVDFQLRSYLNLSFEERSKIRFGSLKLGKRDRDAIIYHKVTHSAEKKDTPGHHQLLALLPQDCPFICPQTTLAAYLYLRFYGIPSVSKGDGFPNLNADENGSLLQD...
chromosome segregation kinetochore assembly mitotic spindle elongation septin ring assembly CBF3 complex; condensed chromosome, centromeric region; cytoplasm; kinetochore; nucleus; spindle; spindle midzone; spindle pole body centromeric DNA binding DNA binding DNA binding, bending Saccharomyces cerevisiae 3D-structure...
negative regulation of mRNA polyadenylation negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay poly(A)+ mRNA export from nucleus positive regulation of transcription by RNA polymerase III regulation of mRNA stability
cytoplasm; nucleus
5S rRNA binding 7S RNA binding mRNA binding poly(A) binding ribonuclease P RNA binding tRNA binding zinc ion binding
Saccharomyces cerevisiae
3D-structure Cytoplasm Metal-binding Methylation Nucleus Phosphoprotein Reference proteome Repeat RNA-binding Zinc Zinc-finger
MSQEQYTENL
MSQEQYTENLKVIVAEKLAGIPNFNEDIKYVAEYIVLLIVNGGTVESVVDELASLFDSVSRDTLANVVQTAFFALEALQQGESAENIVSKIRMMNAQSLGQSDIAQQQQQQQQQQQPDIAQQQPQQQPQQQPQQQPQQQPQQQPQQQPQQQPQQQPQLQPLQPQLGTQNAMQTDAPATPSPISAFSGVVNAAAPPQFAPVDNSQRFTQRGGGAVGKNRRGGRGGNRGGRNNNSTRFNPLAKALGMAGESNMNFTPTKKEGRCRLFPHCPLGRSCPHAHPTKVCNEYPNCPKPPGTCEFLHPNEDEELMKEMERTREEFQK...
negative regulation of mRNA polyadenylation negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay poly(A)+ mRNA export from nucleus positive regulation of transcription by RNA polymerase III regulation of mRNA stability cytoplasm; nucleus 5S rRNA binding 7S RNA binding mRNA bi...
acrosome assembly adhesion of symbiont to host cellular anatomical entity morphogenesis cilium organization coreceptor-mediated virion attachment to host cell cytoskeleton organization establishment of localization in cell establishment of mitochondrion localization fertilization fusion of virus membrane with host plas...
apical junction complex; cell surface; cell-cell contact zone; cell-cell junction; membrane; plasma membrane; zonula adherens
cell adhesion molecule binding identical protein binding protein homodimerization activity
Mus musculus
3D-structure Alternative splicing Cell adhesion Cell membrane Disulfide bond Glycoprotein Immunoglobulin domain Membrane Phosphoprotein Receptor Reference proteome Repeat Signal Transmembrane Transmembrane helix
MARAAVLPPS
MARAAVLPPSRLSPTLPLLPLLLLLLQETGAQDVRVRVLPEVRGRLGGTVELPCHLLPPTTERVSQVTWQRLDGTVVAAFHPSFGVDFPNSQFSKDRLSFVRARPETNADLRDATLAFRGLRVEDEGNYTCEFATFPNGTRRGVTWLRVIAQPENHAEAQEVTIGPQSVAVARCVSTGGRPPARITWISSLGGEAKDTQEPGIQAGTVTIISRYSLVPVGRADGVKVTCRVEHESFEEPILLPVTLSVRYPPEVSISGYDDNWYLGRSEAILTCDVRSNPEPTDYDWSTTSGVFPASAVAQGSQLLVHSVDRMVNTTFIC...
acrosome assembly adhesion of symbiont to host cellular anatomical entity morphogenesis cilium organization coreceptor-mediated virion attachment to host cell cytoskeleton organization establishment of localization in cell establishment of mitochondrion localization fertilization fusion of virus membrane with host plas...
negative regulation of T cell receptor signaling pathway positive regulation of DNA-templated transcription positive regulation of transcription by RNA polymerase II regulation of cytokine production regulation of transcription by RNA polymerase II
chromatin; nucleoplasm; nucleus
DNA-binding transcription activator activity, RNA polymerase II-specific DNA-binding transcription factor activity DNA-binding transcription factor activity, RNA polymerase II-specific RNA polymerase II cis-regulatory region sequence-specific DNA binding sequence-specific double-stranded DNA binding
Homo sapiens
Activator Alternative splicing DNA-binding Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation
MAAVVQQNDL
MAAVVQQNDLVFEFASNVMEDERQLGDPAIFPAVIVEHVPGADILNSYAGLACVEEPNDMITESSLDVAEEEIIDDDDDDITLTVEASCHDGDETIETIEAAEALLNMDSPGPMLDEKRINNNIFSSPEDDMVVAPVTHVSVTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATTPNISVKKKNKDGKGNTIYLWEFLLALLQDKATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMPKDLIYINDEDPSSSIESSDPSLSSSAT...
negative regulation of T cell receptor signaling pathway positive regulation of DNA-templated transcription positive regulation of transcription by RNA polymerase II regulation of cytokine production regulation of transcription by RNA polymerase II chromatin; nucleoplasm; nucleus DNA-binding transcription activator act...
DNA repair generation of catalytic spliceosome for first transesterification step mRNA splicing, via spliceosome protein K63-linked ubiquitination
cytoplasm; cytosol; mitochondrion; nucleus; Prp19 complex; U2-type catalytic step 1 spliceosome
identical protein binding ubiquitin protein ligase activity ubiquitin-protein transferase activity
Saccharomyces cerevisiae
3D-structure DNA damage DNA repair mRNA processing mRNA splicing Nucleus Reference proteome Repeat Spliceosome Transferase Ubl conjugation pathway WD repeat
MLCAISGKVP
MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPSAQQASLTESTNSATLKANYSIPNLLTSLQNEWDAIMLENFKLRSTLDSLTKKLSTVMYERDAAKLVAAQLLMEKNEDSKDLPKSSQQAVAITREEFLQGLLQSSRDFVARGKLKAPKWPILKNLELLQAQNYSRNIKTFPYKELNKSMYYDKWVCMCRCEDGALHFTQLKDSKTITTITTPNPRTGGEHPAIISRGPCNRLLLLYPGNQITILDSKTNKVLREIEVDSANEIIYMYGHNEVNTEYFIWADNRGTIGFQSYEDDS...
DNA repair generation of catalytic spliceosome for first transesterification step mRNA splicing, via spliceosome protein K63-linked ubiquitination cytoplasm; cytosol; mitochondrion; nucleus; Prp19 complex; U2-type catalytic step 1 spliceosome identical protein binding ubiquitin protein ligase activity ubiquitin-protein...
mRNA cis splicing, via spliceosome mRNA splicing, via spliceosome U2-type prespliceosome assembly
catalytic step 2 spliceosome; nucleus; spliceosomal complex; U2 snRNP; U2-type prespliceosome
RNA binding
Saccharomyces cerevisiae
3D-structure mRNA processing mRNA splicing Nucleus Reference proteome Repeat Spliceosome
MEPEDTQLKE
MEPEDTQLKEDIKTTVNYIKQHGVEFENKLLEDERFSFIKKDDPLHEYYTKLMNEPTDTVSGEDNDRKSEREIARPPDFLFSQYDTGISRRDMEVIKLTARYYAKDKSIVEQMISKDGEARLNFMNSSHPLHKTFTDFVAQYKRVYSFTGQEIKKSKRTILDNCFERTQYWEFEKDKDREHDKLVELCKIQFAAIPWDKFTQVAKFSIPEDTEIFEGSLDLEQMRLRRVQTGIKLFDSIKPTNEEEKIVSDQGKQKGGDSKGKKRKIRAVGETRLKKSKK
mRNA cis splicing, via spliceosome mRNA splicing, via spliceosome U2-type prespliceosome assembly catalytic step 2 spliceosome; nucleus; spliceosomal complex; U2 snRNP; U2-type prespliceosome RNA binding Saccharomyces cerevisiae 3D-structure mRNA processing mRNA splicing Nucleus Reference proteome Repeat Spliceosome M...
de novo' cotranslational protein folding intracellular signal transduction protein folding regulation of translational fidelity ribosomal subunit export from nucleus rRNA processing translational frameshifting
cytoplasm; cytosol; mitochondrion; nucleolus; protein folding chaperone complex; ribosome
DNA binding Hsp70 protein binding ribosome binding transcription coactivator activity
Saccharomyces cerevisiae
3D-structure Chaperone Cytoplasm Direct protein sequencing DNA-binding Phosphoprotein Reference proteome
MFSLPTLTSD
MFSLPTLTSDITVEVNSSATKTPFVRRPVEPVGKFFLQHAQRTLRNHTWSEFERIEAEKNVKTVDESNVDPDELLFDTELADEDLLTHDARDWKTADLYAAMGLSKLRFRATESQIIKAHRKQVVKYHPDKQSAAGGSLDQDGFFKIIQKAFETLTDSNKRAQYDSCDFVADVPPPKKGTDYDFYEAWGPVFEAEARFSKKTPIPSLGNKDSSKKEVEQFYAFWHRFDSWRTFEFLDEDVPDDSSNRDHKRYIERKNKAARDKKKTADNARLVKLVERAVSEDPRIKMFKEEEKKEKERRKWEREAGARAEAEAKAKAEA...
de novo' cotranslational protein folding intracellular signal transduction protein folding regulation of translational fidelity ribosomal subunit export from nucleus rRNA processing translational frameshifting cytoplasm; cytosol; mitochondrion; nucleolus; protein folding chaperone complex; ribosome DNA binding Hsp70 pr...
negative regulation of transcription by RNA polymerase II nucleolar large rRNA transcription by RNA polymerase I ribosome biogenesis termination of RNA polymerase I transcription transcription by RNA polymerase I transcription elongation by RNA polymerase I transcription initiation at RNA polymerase I promoter
nucleus; RNA polymerase I complex
nucleic acid binding RNA polymerase I activity RNA polymerase II-specific DNA-binding transcription factor binding zinc ion binding
Saccharomyces cerevisiae
3D-structure Direct protein sequencing DNA-directed RNA polymerase Metal-binding Nucleus Reference proteome Ribosome biogenesis Transcription Zinc Zinc-finger
MSVVGSLIFC
MSVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSLRAKKSVVKTSLKKNELKDGATIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTNN
negative regulation of transcription by RNA polymerase II nucleolar large rRNA transcription by RNA polymerase I ribosome biogenesis termination of RNA polymerase I transcription transcription by RNA polymerase I transcription elongation by RNA polymerase I transcription initiation at RNA polymerase I promoter nucleus;...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane suppression by virus of host tetherin activity suppression by virus of host type I interferon-mediated signaling pathway virion attachment to host cell
host cell endosome membrane; host cell plasma membrane; membrane; viral envelope; virion membrane
structural molecule activity
Human immunodeficiency virus type 2 subtype A
AIDS Apoptosis Clathrin-mediated endocytosis of virus by host Cleavage on pair of basic residues Coiled coil Disulfide bond Fusion of virus membrane with host endosomal membrane Fusion of virus membrane with host membrane Glycoprotein Host cell membrane Host endosome Host membrane Host-virus interaction Inhibition of h...
MCGRNQLFVA
MCGRNQLFVASLLASACLIYCVQYVTVFYGVPVWRNASIPLFCATKNRDTWGTIQCLPDNDDYQEIALNVTEAFDAWNNTVTEQAVEDVWSLFETSIKPCVKLTPLCVAMRCNSTTAKNTTSTPTTTTTANTTIGENSSCIRTDNCTGLGEEEMVDCQFNMTGLERDKKKLYNETWYSKDVVCESKDTKKEKTCYMNHCNTSVITESCDKHYWDTMRFRYCAPPGFALLRCNDTNYSGFEPNCSKVVAATCTRMMETQTSTWFGFNGTRAENRTYIYWHGRDNRTIISLNKFYNLTILCKRPGNKTVVPITLMSGLVFHS...
clathrin-dependent endocytosis of virus by host cell fusion of virus membrane with host endosome membrane suppression by virus of host tetherin activity suppression by virus of host type I interferon-mediated signaling pathway virion attachment to host cell host cell endosome membrane; host cell plasma membrane; membra...
negative regulation of rDNA heterochromatin formation negative regulation of reciprocal meiotic recombination negative regulation of silent mating-type cassette heterochromatin formation negative regulation of transcription by RNA polymerase I negative regulation of transcription by RNA polymerase II nucleophagy nucleo...
cytoplasm; histone deacetylase complex; nuclear periphery; nucleus; Rpd3L complex; Rpd3L-Expanded complex; Rpd3S complex; Sin3-type complex; Snt2C complex
histone deacetylase activity transcription coactivator activity transcription corepressor activity
Saccharomyces cerevisiae
3D-structure Chromatin regulator Cytoplasm Hydrolase Nucleus Phosphoprotein Reference proteome Repressor Transcription Transcription regulation
MVYEATPFDP
MVYEATPFDPITVKPSDKRRVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDIGVGAGKNYAVNVPLRDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNYVKSFGIPMMVVGGGGYTMRNVAR...
negative regulation of rDNA heterochromatin formation negative regulation of reciprocal meiotic recombination negative regulation of silent mating-type cassette heterochromatin formation negative regulation of transcription by RNA polymerase I negative regulation of transcription by RNA polymerase II nucleophagy nucleo...
cell division exit from mitosis meiotic spindle assembly mitotic spindle organization negative regulation of protein localization to nucleolus phosphorylation positive regulation of mitotic spindle pole body separation positive regulation of protein localization to cell division site involved in mitotic actomyosin cont...
cellular bud neck; cytoplasm; kinetochore; nucleus; spindle pole; spindle pole body
ATP binding centromeric DNA binding phosphoprotein binding protein kinase activity protein serine kinase activity protein serine/threonine kinase activity protein-containing complex binding
Saccharomyces cerevisiae
3D-structure ATP-binding Cell cycle Cell division Kinase Mitosis Nucleotide-binding Phosphoprotein Reference proteome Repeat Serine/threonine-protein kinase Transferase
MSLGPLKAIN
MSLGPLKAINDKQLNTRSKLVHTPIKGNTADLVGKENHFKQTKRLDPNNDHHHQPAQKKKREKLSALCKTPPSLIKTRGKDYHRGHFLGEGGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSL...
cell division exit from mitosis meiotic spindle assembly mitotic spindle organization negative regulation of protein localization to nucleolus phosphorylation positive regulation of mitotic spindle pole body separation positive regulation of protein localization to cell division site involved in mitotic actomyosin cont...
cellular hyperosmotic response cellular response to alkaline pH polyphosphate metabolic process protein-containing complex assembly proton transmembrane transport vacuolar acidification
fungal-type vacuole; fungal-type vacuole membrane; vacuolar proton-transporting V-type ATPase complex; vacuolar proton-transporting V-type ATPase, V0 domain
ATPase binding phosphatidylinositol-3,5-bisphosphate binding proton-transporting ATPase activity, rotational mechanism
Saccharomyces cerevisiae
3D-structure Acetylation Coiled coil Direct protein sequencing Glycoprotein Hydrogen ion transport Ion transport Membrane Reference proteome Transmembrane Transmembrane helix Transport Vacuole
MAEKEEAIFR
MAEKEEAIFRSAEMALVQFYIPQEISRDSAYTLGQLGLVQFRDLNSKVRAFQRTFVNEIRRLDNVERQYRYFYSLLKKHDIKLYEGDTDKYLDGSGELYVPPSGSVIDDYVRNASYLEERLIQMEDATDQIEVQKNDLEQYRFILQSGDEFFLKGDNTDSTSYMDEDMIDANGENIAAAIGASVNYVTGVIARDKVATLEQILWRVLRGNLFFKTVEIEQPVYDVKTREYKHKNAFIVFSHGDLIIKRIRKIAESLDANLYDVDSSNEGRSQQLAKVNKNLSDLYTVLKTTSTTLESELYAIAKELDSWFQDVTREKAIF...
cellular hyperosmotic response cellular response to alkaline pH polyphosphate metabolic process protein-containing complex assembly proton transmembrane transport vacuolar acidification fungal-type vacuole; fungal-type vacuole membrane; vacuolar proton-transporting V-type ATPase complex; vacuolar proton-transporting V-...
proteasome assembly proteasome-mediated ubiquitin-dependent protein catabolic process regulation of protein catabolic process ubiquitin-dependent protein catabolic process
nucleus; proteasome complex; proteasome regulatory particle, base subcomplex; proteasome storage granule
enzyme regulator activity ubiquitin protein ligase binding
Saccharomyces cerevisiae
3D-structure Acetylation Direct protein sequencing Phosphoprotein Proteasome Reference proteome Repeat
MSLTTAAPLL
MSLTTAAPLLALLRENQDSVKTYALESINNVVDQLWSEISNELPDIEALYDDDTFSDREMAALIASKVYYNLGEYESAVKYALAAKDRFDIDEKSQFVETIVSKSIEMYVQEASKQYTKDEQFYTKDIIDPKLTSIFERMIEKCLKASELKLALGIALEGYRLDIIESALKSKLDQDSTSENVKIINYLLTLAITTVTNSKFRSSILRKSFDFLMNMPNCDYLTLNKVVVNLNDAGLALQLFKKLKEENDEGLSAQIAFDLVSSASQQLLEILVTELTAQGYDPALLNILSGLPTCDYYNTFLLNNKNIDIGLLNKSKSS...
proteasome assembly proteasome-mediated ubiquitin-dependent protein catabolic process regulation of protein catabolic process ubiquitin-dependent protein catabolic process nucleus; proteasome complex; proteasome regulatory particle, base subcomplex; proteasome storage granule enzyme regulator activity ubiquitin protein...
cell wall organization fungal-type cell wall beta-glucan biosynthetic process regulation of fungal-type cell wall biogenesis regulation of mitotic cell cycle
cellular bud neck; incipient cellular bud site; mating projection tip; nucleus
DNA binding
Saccharomyces cerevisiae
3D-structure Cell wall biogenesis/degradation DNA-binding Isopeptide bond Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation Ubl conjugation
MDLFKRKVKE
MDLFKRKVKEWVYSLSTDDHYAEYNPDETPTFNMGKRLNSNNGQVNPSQMHLNSVDEEMSMGFQNGVPSNEDINIDEFTSTESNDGVSETLLAWRHIDFWTSEHNPDLNATLSDPCTQNDITHAEEDLEVSFPNPVKASFKIHDGQEDLESMTGTSGLFYGFQLMTLDQVVAMTQAWRNVAKNLNKRSQQGLSHVTSTGSSSSMERLNGNKFKLPNIPDQKSIPPNAVQPVYAHPAWIPLITDNAGNHIGVDLAPGPNGKYAQIITFGRDFDTKFVIAENWGEFLLSFANDLEAGNWYLVDDNDDYFSGDGELVFRDKKS...
cell wall organization fungal-type cell wall beta-glucan biosynthetic process regulation of fungal-type cell wall biogenesis regulation of mitotic cell cycle cellular bud neck; incipient cellular bud site; mating projection tip; nucleus DNA binding Saccharomyces cerevisiae 3D-structure Cell wall biogenesis/degradation...
aerobic respiration fatty acid catabolic process lipid droplet organization phospholipid biosynthetic process plasmid maintenance triglyceride biosynthetic process vacuole fusion, non-autophagic
cytoplasm; cytosol; endoplasmic reticulum membrane; lipid droplet; nuclear membrane; nucleus; vacuole
phosphatidate phosphatase activity transcription cis-regulatory region binding
Saccharomyces cerevisiae
Acetylation Cytoplasm Endoplasmic reticulum Hydrolase Lipid biosynthesis Lipid metabolism Membrane Nucleus Phosphoprotein Reference proteome Transcription Transcription regulation
MQYVGRALGS
MQYVGRALGSVSKTWSSINPATLSGAIDVIVVEHPDGRLSCSPFHVRFGKFQILKPSQKKVQVFINEKLSNMPMKLSDSGEAYFVFEMGDQVTDVPDELLVSPVMSATSSPPQSPETSILEGGTEGEGEGENENKKKEKKVLEEPDFLDINDTGDSGSKNSETTGSLSPTESSTTTPPDSVEERKLVEQRTKNFQQKLNKKLTEIHIPSKLDNNGDLLLDTEGYKPNKNMMHDTDIQLKQLLKDEFGNDSDISSFIKEDKNGNIKIVNPYEHLTDLSPPGTPPTMATSGSVLGLDAMESGSTLNSLSSSPSGSDTEDETS...
aerobic respiration fatty acid catabolic process lipid droplet organization phospholipid biosynthetic process plasmid maintenance triglyceride biosynthetic process vacuole fusion, non-autophagic cytoplasm; cytosol; endoplasmic reticulum membrane; lipid droplet; nuclear membrane; nucleus; vacuole phosphatidate phosphata...
positive regulation of transcription by RNA polymerase II positive regulation of transcription elongation by RNA polymerase II positive regulation of transcription initiation by RNA polymerase II regulation of transcription by RNA polymerase II RNA polymerase II preinitiation complex assembly transcription initiation a...
core mediator complex; mediator complex; nucleus
DNA-binding transcription factor binding RNA polymerase II complex recruiting activity RNA polymerase II core promoter sequence-specific DNA binding transcription coregulator activity
Saccharomyces cerevisiae
3D-structure Activator Nucleus Reference proteome Transcription Transcription regulation
MTTEDPDSNH
MTTEDPDSNHLSSETGIKLALDPNLITLALSSNPNSSLHSPTSDEPVPESAGKADTSIRLEGDELENKTKKDNDKNLKFLKNKDSLVSNPHEIYGSMPLEQLIPIILRQRGPGFKFVDLNEKELQNEIKQLGSDSSDGHNSEKKDTDGADENVQIGEDFMEVDYEDKDNPVDSRNETDHKTNENGETDDNIETVMTQEQFVKRRRDMLEHINLAMNESSLALEFVSLLLSSVKESTGMSSMSPFLRKVVKPSSLNSDKIPYVAPTKKEYIELDILNKGWKLQSLNESKDLLRASFNKLSSILQNEHDYWNKIMQSISNKD...
positive regulation of transcription by RNA polymerase II positive regulation of transcription elongation by RNA polymerase II positive regulation of transcription initiation by RNA polymerase II regulation of transcription by RNA polymerase II RNA polymerase II preinitiation complex assembly transcription initiation a...
positive regulation of transcription by RNA polymerase II positive regulation of transcription elongation by RNA polymerase II positive regulation of transcription initiation by RNA polymerase II RNA polymerase II preinitiation complex assembly
core mediator complex; mediator complex; nucleus
transcription coregulator activity
Saccharomyces cerevisiae
3D-structure Acetylation Activator Nucleus Reference proteome Transcription Transcription regulation
MSNQALYEKL
MSNQALYEKLEQTRTILSVKLAELINMTTIADRNDDDEGSFAQENSELAVATTSVMMVNNQTMQLIKNVQDLLILTRSIKEKWLLNQIPVTEHSKVTRFDEKQIEELLDNCIETFVAEKTT
positive regulation of transcription by RNA polymerase II positive regulation of transcription elongation by RNA polymerase II positive regulation of transcription initiation by RNA polymerase II RNA polymerase II preinitiation complex assembly core mediator complex; mediator complex; nucleus transcription coregulator ...
ATP export endocytosis free ubiquitin chain depolymerization intralumenal vesicle formation regulation of DNA replication ubiquitin recycling ubiquitin-dependent protein catabolic process ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
cytosol; endosome; late endosome membrane; mitochondrion; proteasome complex
cysteine-type deubiquitinase activity
Saccharomyces cerevisiae
Cytoplasm Endosome Hydrolase Membrane Phosphoprotein Protease Reference proteome Thiol protease Ubl conjugation pathway
MEQNIISTIR
MEQNIISTIRDECIRHRSKYLTIAQLTAIAEAKINEFIITGKAKDQDLSSLLDKCIDILSIYKKNSKDIKNIISCKNKGAMISSNSVMIIQLNYVYYKVIHIIVTTNIPHLSEFAKIKLHKSTSDEGNGNNNNNEFQLMNIYNTLLETLLKDENIAKIKSFIKSSIKQTKLNHEQEECNLMRTGSYITSNQLNSLISSSANSASSQMEILLIDIRSRLEFNKSHIDTKNIICLEPISFKMSYSDHDLEKKSLITSPNSEIKMFQSRNLFKFIILYTDANEYNVKQQSVLLDILVNHSFEKPISDDFTKIFILESGFPGWL...
ATP export endocytosis free ubiquitin chain depolymerization intralumenal vesicle formation regulation of DNA replication ubiquitin recycling ubiquitin-dependent protein catabolic process ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway cytosol; endosome; late endosome membrane;...
ascospore formation fatty acid catabolic process fatty acid metabolic process
peroxisomal matrix; peroxisome
2,4-dienoyl-CoA reductase (NADPH) activity
Saccharomyces cerevisiae
Direct protein sequencing Isopeptide bond NADP Oxidoreductase Peroxisome Reference proteome Sporulation Ubl conjugation
MNTANTLDGK
MNTANTLDGKFVTEGSWRPDLFKGKVAFVTGGAGTICRVQTEALVLLGCKAAIVGRDQERTEQAAKGISQLAKDKDAVLAIANVDVRNFEQVENAVKKTVEKFGKIDFVIAGAAGNFVCDFANLSPNAFKSVVDIDLLGSFNTAKACLKELKKSKGSILFVSATFHYYGVPFQGHVGAAKAGIDALAKNLAVELGPLGIRSNCIAPGAIDNTEGLKRLAGKKYKEKALAKIPLQRLGSTRDIAESTVYIFSPAASYVTGTVLVVDGGMWHLGTYFGHELYPEALIKSMTSKL
ascospore formation fatty acid catabolic process fatty acid metabolic process peroxisomal matrix; peroxisome 2,4-dienoyl-CoA reductase (NADPH) activity Saccharomyces cerevisiae Direct protein sequencing Isopeptide bond NADP Oxidoreductase Peroxisome Reference proteome Sporulation Ubl conjugation MNTANTLDGK MNTANTLDGKF...
adaptive immune response adherens junction organization cellular response to peptide hormone stimulus negative regulation of bone resorption negative regulation of cell population proliferation negative regulation of ERK1 and ERK2 cascade negative regulation of Golgi to plasma membrane protein transport negative regula...
cell-cell junction; cytoplasm; plasma membrane
ATP binding identical protein binding metal ion binding non-membrane spanning protein tyrosine kinase activity proline-rich region binding protein kinase A catalytic subunit binding protein phosphatase binding protein tyrosine kinase activity protein tyrosine kinase binding
Rattus norvegicus
3D-structure Acetylation Adaptive immunity ATP-binding Cell membrane Cytoplasm Direct protein sequencing Immunity Kinase Magnesium Manganese Membrane Metal-binding Nucleotide-binding Phosphoprotein Reference proteome SH2 domain SH3 domain Transferase Tyrosine-protein kinase
MSAIQASWPS
MSAIQASWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTTDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNV...
adaptive immune response adherens junction organization cellular response to peptide hormone stimulus negative regulation of bone resorption negative regulation of cell population proliferation negative regulation of ERK1 and ERK2 cascade negative regulation of Golgi to plasma membrane protein transport negative regula...
regulation of cellular response to glucose starvation regulation of protein-containing complex assembly signal transduction
cytoplasm; cytosol; fungal-type vacuole; nucleotide-activated protein kinase complex; nucleus; vacuolar membrane
enzyme-substrate adaptor activity protein kinase binding
Saccharomyces cerevisiae
Cytoplasm Lipoprotein Membrane Myristate Phosphoprotein Reference proteome Vacuole
MGNSPSTQDP
MGNSPSTQDPSHSTKKEHGHHFHDAFNKDRQGSITSQLFNNRKSTHKRRASHTSEHNGAIPPRMQLLASHDPSTDCDGRMSSDTTIDKGPSHLFKKDYSLSSAADVNDTTLANLTLSDDHDVGAPEEQVKSPSFLSPGPSMATVKRTKSDLDDLSTLNYTMVDETTENERNDKPHHERHRSSIIALKKNLLESSATASPSPTRSSSVHSASLPALTKTDSIDIPVRQPYSKKPSIHAYQYQYLNNDETFSENSQMDKEGNSDSVDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRVNSSNSMYTAERISHANNNGNIEN...
regulation of cellular response to glucose starvation regulation of protein-containing complex assembly signal transduction cytoplasm; cytosol; fungal-type vacuole; nucleotide-activated protein kinase complex; nucleus; vacuolar membrane enzyme-substrate adaptor activity protein kinase binding Saccharomyces cerevisiae ...
regulation of translation regulation of translational fidelity telomere maintenance tRNA threonylcarbamoyladenosine metabolic process tRNA threonylcarbamoyladenosine modification
chromosome, telomeric region; cytoplasm; cytosol; mitochondrion; nucleus
ATP binding double-stranded RNA binding L-threonylcarbamoyladenylate synthase nucleotidyltransferase activity single-stranded telomeric DNA binding tRNA binding
Saccharomyces cerevisiae
ATP-binding Chromosome Cytoplasm DNA-binding Nucleotide-binding Nucleotidyltransferase Nucleus Reference proteome Telomere Transferase Translation regulation tRNA processing
MYLGRHFLAM
MYLGRHFLAMTSKALFDTKILKVNPLSIIFSPDAHIDGSLPTITDPETEAALVEAARIIRDTDETVAFPTETVYGLGGSALNDNSVLSIYRAKNRPSDNPLITHVSSIDQLNRKVFNQPHLSGTSLFDNIPSIYRPLISSLWPGPLTILLPVPSSEHSALSKLTTADQPTFAVRIPANPVARALIALSDTPIAAPSANASTRPSPTLASHVYHDLKDKIPIILDGGACKVGVESTVVDGLCNPPTLLRPGGFTYEEIVKLGGEAWSLCKVENKKTVEKGEKVRTPGMKYRHYSPSAKVVLLVPHCEGDGILKGVDRMERL...
regulation of translation regulation of translational fidelity telomere maintenance tRNA threonylcarbamoyladenosine metabolic process tRNA threonylcarbamoyladenosine modification chromosome, telomeric region; cytoplasm; cytosol; mitochondrion; nucleus ATP binding double-stranded RNA binding L-threonylcarbamoyladenylate...
Group I intron splicing mitochondrial DNA replication mitochondrial RNA 3'-end processing mitochondrial RNA catabolic process RNA catabolic process
mitochondrial degradosome; mitochondrial matrix; mitochondrion
ATP binding ATP hydrolysis activity RNA binding RNA helicase activity
Saccharomyces cerevisiae
ATP-binding Helicase Hydrolase Mitochondrion Nucleotide-binding Reference proteome RNA-binding Transit peptide
MALVKYSTVF
MALVKYSTVFFPLRSLRLFVSIKKAYYHSEPHSIDLFHDKDWIVKRPKFLNLPKNEHSKLDIFQFNFNKSESNNVYLQDSSFKDNLDKAMQFIYNDKLSSLDAKQVPIKNLAWLKLRDYIYQQLKDPKLQAKTYVPSVSEIIHPSSPGNLISLLINCNKISNLVWKSVLKYSLSNNITTLDKFIHVLQQTFDHVYEQEILPMMTNTDDTDGAHNVDITNPAEWFPEARKIRRHIIMHIGPTNSGKTYRALQKLKSVDRGYYAGPLRLLAREVYDRFHAEKIRCNLLTGEEVIRDLDDRGNSAGLTSGTVEMVPINQKFDV...
Group I intron splicing mitochondrial DNA replication mitochondrial RNA 3'-end processing mitochondrial RNA catabolic process RNA catabolic process mitochondrial degradosome; mitochondrial matrix; mitochondrion ATP binding ATP hydrolysis activity RNA binding RNA helicase activity Saccharomyces cerevisiae ATP-binding H...
intracellular signal transduction meiotic cell cycle negative regulation of DNA replication origin binding phosphorylation regulation of meiotic nuclear division sporulation resulting in formation of a cellular spore
cytoplasm; nucleus
ATP binding protein kinase activity protein serine kinase activity protein serine/threonine kinase activity
Saccharomyces cerevisiae
ATP-binding Kinase Meiosis Nucleotide-binding Reference proteome Serine/threonine-protein kinase Sporulation Transferase
MVEKRSRQSS
MVEKRSRQSSSSGSEFSVPPDVDNPPLSIPLKTLSDRYQLIEKLGAGSFGCVTLAKAQFPLSNILGKQHDIRGTLMDQPKNGHQNYITKTQGVVAIKTMMTKLHTLQDYTRVREIKFILAIPANDHLIQIFEVFIDSENYQLHIVMECMEQNLYQMMKHRRRRVFSIPSLKSILSQILAGLKHIHEHNFFHRDLKPENILITPSTQYFEKEYMNQIGYQDNYVIKLADFGLARHVENKNPYTAYVSTRWYRSPEILLRSGYYSKPLDIWAFGCVAVEVTVFRALFPGANEIDQIWKILEVLGTPIKRSDFVNTNHITAPP...
intracellular signal transduction meiotic cell cycle negative regulation of DNA replication origin binding phosphorylation regulation of meiotic nuclear division sporulation resulting in formation of a cellular spore cytoplasm; nucleus ATP binding protein kinase activity protein serine kinase activity protein serine/th...
cysteine biosynthetic process from serine cysteine biosynthetic process via cystathionine hydrogen sulfide biosynthetic process transsulfuration traversing start control point of mitotic cell cycle
cytoplasm; cytoplasmic stress granule; mitochondrion
cystathionine beta-synthase activity mRNA binding
Saccharomyces cerevisiae
3D-structure Amino-acid biosynthesis CBS domain Cysteine biosynthesis Lyase Phosphoprotein Pyridoxal phosphate Reference proteome
MTKSEQQADS
MTKSEQQADSRHNVIDLVGNTPLIALKKLPKALGIKPQIYAKLELYNPGGSIKDRIAKSMVEEAEASGRIHPSRSTLIEPTSGNTGIGLALIGAIKGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTAAAWDSPESHIGVAKKLEKEIPGAVILDQYNNMMNPEAHYFGTGREIQRQLEDLNLFDNLRAVVAGAGTGGTISGISKYLKEQNDKIQIVGADPFGSILAQPENLNKTDITDYKVEGIGYDFVPQVLDRKLIDVWYKTDDKPSFKYARQLISNEGVLVGGSSGSAFTAVVKYCEDHPELTEDDVIVAIFPDS...
cysteine biosynthetic process from serine cysteine biosynthetic process via cystathionine hydrogen sulfide biosynthetic process transsulfuration traversing start control point of mitotic cell cycle cytoplasm; cytoplasmic stress granule; mitochondrion cystathionine beta-synthase activity mRNA binding Saccharomyces cerev...
C-terminal protein methylation peptide pheromone maturation response to pheromone
endoplasmic reticulum; endoplasmic reticulum membrane; nuclear inner membrane
protein C-terminal S-isoprenylcysteine carboxyl O-methyltransferase activity
Saccharomyces cerevisiae
Endoplasmic reticulum Membrane Methyltransferase Pheromone response Reference proteome S-adenosyl-L-methionine Transferase Transmembrane Transmembrane helix
MHQDFQEDEH
MHQDFQEDEHEYPDIRRNPLHEVTMTSYILGILLGIFVGLFPQIRFKNFNLFIIALSLFHFLEYYITAKYNPLKVHSESFLLNNGKSYMAAHSFAILECLVESFLFPDLKIFSYSLATKLCTVLGCLLVILGQYTRTIAMHTAGHSFSHIVKTKKESDHVLVKTGVYSWSRHPSYLGFFWWAIGTQLLLLNPLSLVIFIFVLWKFFSDRIRVEEKYLIEFFSAEYIEYKNKVGVGIPFI
C-terminal protein methylation peptide pheromone maturation response to pheromone endoplasmic reticulum; endoplasmic reticulum membrane; nuclear inner membrane protein C-terminal S-isoprenylcysteine carboxyl O-methyltransferase activity Saccharomyces cerevisiae Endoplasmic reticulum Membrane Methyltransferase Pheromon...
positive regulation of transcription by RNA polymerase II positive regulation of transcription elongation by RNA polymerase II positive regulation of transcription initiation by RNA polymerase II regulation of transcription by RNA polymerase II RNA polymerase II preinitiation complex assembly termination of RNA polymer...
core mediator complex; mediator complex; nucleus
RNA polymerase II core promoter sequence-specific DNA binding transcription coactivator activity transcription coregulator activity
Saccharomyces cerevisiae
3D-structure Activator Nucleus Reference proteome Transcription Transcription regulation
MVQQLSLFGS
MVQQLSLFGSIGDDGYDLLISTLTTISGNPPLLYNSLCTVWKPNPSYDVENVNSRNQLVEPNRIKLSKEVPFSYLIDETMMDKPLNFRILKSFTNDKIPLNYAMTRNILHNTVPQVTNFNSTNEDQNNSKHTEDTVNESRNSDDIIDVDMDASPAPSNESCSPWSLQISDIPAAGNNRSVSMQTIAETIILSSAGKNSSVSSLMNGLGYVFEFQYLTIGVKFFMKHGLILELQKIWQIEEAGNSQITSGGFLLKAYINVSRGTDIDRINYTETALMNLKKELQGYIELSVPDRQSMDSRVAHGNILI
positive regulation of transcription by RNA polymerase II positive regulation of transcription elongation by RNA polymerase II positive regulation of transcription initiation by RNA polymerase II regulation of transcription by RNA polymerase II RNA polymerase II preinitiation complex assembly termination of RNA polymer...
cell cycle cell division dephosphorylation negative regulation of p38MAPK cascade
cytoplasm; cytosol; mitochondrion; nucleus
MAP kinase tyrosine phosphatase activity protein tyrosine phosphatase activity
Schizosaccharomyces pombe
Cell cycle Cell division Cytoplasm Hydrolase Mitosis Protein phosphatase Reference proteome
MLHLLSKDEF
MLHLLSKDEFNSTLKSFEEQTESVSWIIDLRLHSKYAVSHIKNAINVSLPTALLRRPSFDIGKVFACIKCNVKVSLDEINAIFLYDSSMAGMNRIYDLVQKFRRGGYSKKIYLLSNGFEAFASSHPDAIVSTEMVKESVPYKIDINENCKLDILHLSDPSAVSTPISPDYSFPLRVPINIPPPLCTPSVVSDTFSEFASHAEYPGFSGLTPFSIHSPTASSVRSCQSIYGSPLSPPNSAFQAEMPYFPISPAISCASSCPSTPDEQKNFFIVGNAPQQTPARPSLRSVPSYPSSNNQRRPSASRVRSFSNYVKSSNVVNP...
cell cycle cell division dephosphorylation negative regulation of p38MAPK cascade cytoplasm; cytosol; mitochondrion; nucleus MAP kinase tyrosine phosphatase activity protein tyrosine phosphatase activity Schizosaccharomyces pombe Cell cycle Cell division Cytoplasm Hydrolase Mitosis Protein phosphatase Reference proteo...
nuclear-transcribed mRNA catabolic process, nonsense-mediated decay regulation of mRNA stability stress granule assembly
cytoplasm; cytoplasmic stress granule; nucleus; P-body
mRNA binding poly(U) RNA binding
Saccharomyces cerevisiae
3D-structure Acetylation Cytoplasm Direct protein sequencing Methylation Nucleus Reference proteome Repeat RNA-binding
MSENNEEQHQ
MSENNEEQHQQQQQQQPVAVETPSAVEAPASADPSSEQSVAVEGNSEQAEDNQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAKRDNNNNNNYQQRRNYGNNNRGGFRQYNSNNNNNMNMGMNMNMNMNMNNSRGMPPSSMGMPIGAMPLPSQGQPQQSQTIGL...
nuclear-transcribed mRNA catabolic process, nonsense-mediated decay regulation of mRNA stability stress granule assembly cytoplasm; cytoplasmic stress granule; nucleus; P-body mRNA binding poly(U) RNA binding Saccharomyces cerevisiae 3D-structure Acetylation Cytoplasm Direct protein sequencing Methylation Nucleus Refe...