PMCID
string | Sentences
string | ner
list |
|---|---|---|
PMC11224020
|
These experiments indicate that both CCR7 expression and cell motility respond to precise cell shape changes, suggesting that these events might be mechanistically coupled.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"These",
"experiments",
"indicate",
"that",
"both",
"CCR7",
"expression",
"and",
"cell",
"motility",
"respond",
"to",
"precise",
"cell",
"shape",
"changes",
",",
"suggesting",
"that",
"these",
"events",
"might",
"be",
"mechanistically",
"coupled",
"."
]
}
] |
PMC11656657
|
As detailed in the heat-map, in both in vitro and in vivo models, the 143B tumor showed a higher production of G-CSF (for in vitro model: 555.55 pg/ml ± 0.34 pg/ml; and in vivo model: 3917.96 pg/ml ± 992.19 pg/ml) and CXCL8 (for in vitro model: 2560.42 pg/ml ± 26.15 pg/ml; and in vivo model: 3633.04 pg/ml ± 1951.73 pg/ml), as compared the other sarcoma cell lines, this finding supporting the potential involvement of these cytokines in murine MDSCs expansion (Fig. 5D-E).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"B-CellLine",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"As",
"detailed",
"in",
"the",
"heat-map",
",",
"in",
"both",
"in",
"vitro",
"and",
"in",
"vivo",
"models",
",",
"the",
"143B",
"tumor",
"showed",
"a",
"higher",
"production",
"of",
"G-CSF",
"(",
"for",
"in",
"vitro",
"model",
":",
"555.55",
"pg/ml",
"±",
"0.34",
"pg/ml",
";",
"and",
"in",
"vivo",
"model",
":",
"3917.96",
"pg/ml",
"±",
"992.19",
"pg/ml",
")",
"and",
"CXCL8",
"(",
"for",
"in",
"vitro",
"model",
":",
"2560.42",
"pg/ml",
"±",
"26.15",
"pg/ml",
";",
"and",
"in",
"vivo",
"model",
":",
"3633.04",
"pg/ml",
"±",
"1951.73",
"pg/ml",
")",
",",
"as",
"compared",
"the",
"other",
"sarcoma",
"cell",
"lines",
",",
"this",
"finding",
"supporting",
"the",
"potential",
"involvement",
"of",
"these",
"cytokines",
"in",
"murine",
"MDSCs",
"expansion",
"(",
"Fig.",
"5D-E",
")",
"."
]
}
] |
PMC10165258
|
Photographs of droplets doing the steps shown in (c).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Photographs",
"of",
"droplets",
"doing",
"the",
"steps",
"shown",
"in",
"(",
"c",
")",
"."
]
}
] |
PMC9429973
|
Summary/Conclusion: Our research revealed the most important predictors of mortality in patients with blood diseases.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Summary/Conclusion",
":",
"Our",
"research",
"revealed",
"the",
"most",
"important",
"predictors",
"of",
"mortality",
"in",
"patients",
"with",
"blood",
"diseases",
"."
]
}
] |
PMC9429973
|
Interim PET (PET2) was performed at 15.5 ±3 days (range, 5-26) after the 2-3 cycle of treatment.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Interim",
"PET",
"(",
"PET2",
")",
"was",
"performed",
"at",
"15.5",
"±3",
"days",
"(",
"range",
",",
"5",
"-",
"26",
")",
"after",
"the",
"2",
"-",
"3",
"cycle",
"of",
"treatment",
"."
]
}
] |
PMC11411131
|
The specificity of the MeHg sensor, among other electrophiles, was then addressed.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"specificity",
"of",
"the",
"MeHg",
"sensor",
",",
"among",
"other",
"electrophiles",
",",
"was",
"then",
"addressed",
"."
]
}
] |
PMC7823217
|
Liver cancer has a poor prognosis owing to delayed diagnosis and thus limited treatment options.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Liver",
"cancer",
"has",
"a",
"poor",
"prognosis",
"owing",
"to",
"delayed",
"diagnosis",
"and",
"thus",
"limited",
"treatment",
"options",
"."
]
}
] |
PMC10452486
|
These diversified functions in normal cells and malignant cells merit extensive investigation, which may shed light on organ metastasis.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"These",
"diversified",
"functions",
"in",
"normal",
"cells",
"and",
"malignant",
"cells",
"merit",
"extensive",
"investigation",
",",
"which",
"may",
"shed",
"light",
"on",
"organ",
"metastasis",
"."
]
}
] |
PMC8708099
|
To each well, 50 µL of a serum-free medium and 50 µL of MTT Reagent were added, and the plates were incubated at 37 °C for 3 h. After that time, 150 µL of MTT solvent was added to each well, and plates were incubated on a shaker at 37 °C in the dark.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"To",
"each",
"well",
",",
"50",
"µL",
"of",
"a",
"serum-free",
"medium",
"and",
"50",
"µL",
"of",
"MTT",
"Reagent",
"were",
"added",
",",
"and",
"the",
"plates",
"were",
"incubated",
"at",
"37",
"°",
"C",
"for",
"3",
"h.",
"After",
"that",
"time",
",",
"150",
"µL",
"of",
"MTT",
"solvent",
"was",
"added",
"to",
"each",
"well",
",",
"and",
"plates",
"were",
"incubated",
"on",
"a",
"shaker",
"at",
"37",
"°",
"C",
"in",
"the",
"dark",
"."
]
}
] |
PMC11785489
|
pp65 56-mer: RLKAESTVAPEEDTDEDSDNEIHNPAVFTWPPWQAGILARNLVPMVATVQSGARA* MART-1 56-mer: MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRA All antibodies were purchased from BioLegend and were used at 1 μL per million cells.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"pp65",
"56-mer",
":",
"RLKAESTVAPEEDTDEDSDNEIHNPAVFTWPPWQAGILARNLVPMVATVQSGARA",
"*",
"MART-1",
"56-mer",
":",
"MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRA",
"All",
"antibodies",
"were",
"purchased",
"from",
"BioLegend",
"and",
"were",
"used",
"at",
"1",
"μL",
"per",
"million",
"cells",
"."
]
}
] |
PMC11763111
|
These findings underscore the potential of the Hu-PBL-SCID model as an effective platform for evaluating universal CAR-T-cell therapy in vivo.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"These",
"findings",
"underscore",
"the",
"potential",
"of",
"the",
"Hu-PBL-SCID",
"model",
"as",
"an",
"effective",
"platform",
"for",
"evaluating",
"universal",
"CAR-T-cell",
"therapy",
"in",
"vivo",
"."
]
}
] |
PMC5600151
|
In vitro assays showed that there was an increase in cytotoxicity in MCF7/ADR cells when DOX PAMAM-HA was used in combination with MVP-siRNA, indicating the chemosensitization from the downregulation of MVP protein and an enhanced effect of DOX when associated in the dendrimer system.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"B-CellLine",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"In",
"vitro",
"assays",
"showed",
"that",
"there",
"was",
"an",
"increase",
"in",
"cytotoxicity",
"in",
"MCF7/ADR",
"cells",
"when",
"DOX",
"PAMAM-HA",
"was",
"used",
"in",
"combination",
"with",
"MVP-siRNA",
",",
"indicating",
"the",
"chemosensitization",
"from",
"the",
"downregulation",
"of",
"MVP",
"protein",
"and",
"an",
"enhanced",
"effect",
"of",
"DOX",
"when",
"associated",
"in",
"the",
"dendrimer",
"system",
"."
]
}
] |
PMC9268620
|
This study reports the effect of damnacanthal and nordamnacanthal (Figure 1) treatment at a cellular level and the ultrastructural changes that happen in T-lymphoblastic leukemia (CEM-SS) cells.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"B-CellLine",
"O",
"O",
"O"
],
"tokens": [
"This",
"study",
"reports",
"the",
"effect",
"of",
"damnacanthal",
"and",
"nordamnacanthal",
"(",
"Figure",
"1",
")",
"treatment",
"at",
"a",
"cellular",
"level",
"and",
"the",
"ultrastructural",
"changes",
"that",
"happen",
"in",
"T-lymphoblastic",
"leukemia",
"(",
"CEM-SS",
")",
"cells",
"."
]
}
] |
PMC8984067
|
The flow cytometric analysis revealed that the EpCAM expression rate of this cell line was 51.5%, as shown in Figure 10.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"flow",
"cytometric",
"analysis",
"revealed",
"that",
"the",
"EpCAM",
"expression",
"rate",
"of",
"this",
"cell",
"line",
"was",
"51.5",
"%",
",",
"as",
"shown",
"in",
"Figure",
"10",
"."
]
}
] |
PMC11638288
|
Additionally, the study found that immature bone marrow-derived dendritic cells (imBM-DCs) and immature DCs from the skin express the NKp46/NCR1 ligand, which is downregulated upon imBM-DC maturation.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Additionally",
",",
"the",
"study",
"found",
"that",
"immature",
"bone",
"marrow-derived",
"dendritic",
"cells",
"(",
"imBM-DCs",
")",
"and",
"immature",
"DCs",
"from",
"the",
"skin",
"express",
"the",
"NKp46/NCR1",
"ligand",
",",
"which",
"is",
"downregulated",
"upon",
"imBM-DC",
"maturation",
"."
]
}
] |
PMC9250505
|
Concomitantly, CAOV2 cells treated with NPB and Olaparib marginally increased cell populations in the G1-phase along with reduced G2M-phase compared to cells treated with Ola (Supplementary Fig. 4C).
|
[
{
"tags": [
"O",
"O",
"B-CellLine",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Concomitantly",
",",
"CAOV2",
"cells",
"treated",
"with",
"NPB",
"and",
"Olaparib",
"marginally",
"increased",
"cell",
"populations",
"in",
"the",
"G1-phase",
"along",
"with",
"reduced",
"G2M-phase",
"compared",
"to",
"cells",
"treated",
"with",
"Ola",
"(",
"Supplementary",
"Fig.",
"4C",
")",
"."
]
}
] |
PMC11748335
|
L H3K27me3 modification near the IGF2BP1 gene in different Roadmap samples.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"L",
"H3K27me3",
"modification",
"near",
"the",
"IGF2BP1",
"gene",
"in",
"different",
"Roadmap",
"samples",
"."
]
}
] |
PMC9532503
|
Manganese is the key ingredient shown to influence antibody fucosylation.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Manganese",
"is",
"the",
"key",
"ingredient",
"shown",
"to",
"influence",
"antibody",
"fucosylation",
"."
]
}
] |
PMC11509224
|
The molecule monamphilectine A (138, Figure 13) is a diterpenoid β-lactam alkaloid generated by Hymeniacidon sp. .
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"molecule",
"monamphilectine",
"A",
"(",
"138",
",",
"Figure",
"13",
")",
"is",
"a",
"diterpenoid",
"β-lactam",
"alkaloid",
"generated",
"by",
"Hymeniacidon",
"sp.",
"."
]
}
] |
PMC8481254
|
Scale bars: 200 μm.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Scale",
"bars",
":",
"200",
"μm",
"."
]
}
] |
PMC11653533
|
VLC = Vacuum liquid chromatography; SGCC = Silica Gel Column chromatography; SGDCC = Silica Gel Dry Column Chromatography; PC = Paper Chromatography; TLC = Thin Layer Chromatography; HPLC = High-performance Liquid Chromatography; Sp-HPLC = Semi preparative High-performance Liquid Chromatography; HR-ESI-MS = High-resolution electrospray ionisation mass spectrometry; GC–MS = Gas Chromatography Mass Spectrometry; LC–MS = Liquid chromatography–mass spectrometry; GC-EIMS = Gas chromatography-electron ionization mass spectrometry; HR-FAB-MS = High resolution fast atom bombardment mass spectrometry; UV–Vis = Ultraviolet–visible spectroscopy; IR = Infrared spectroscopy; FTIR = Fourier-transform infrared spectroscopy; 1H–1H COSY = Correlation Spectroscopy; NOESY = Nuclear Overhauser enhancement exchange spectroscopy; HMBC = Heteronuclear Multiple Bond Correlation Spectroscopy; ROESY = Rotating Frame Overhauser Enhancement Spectroscopy; HSQC = Heteronuclear single quantum coherence spectroscopy; XRD = X-ray diffraction analysis; DEPT = Distortionless enhancement by polarization transfer; SPME = Solid Phase Microextraction; DAD = Diode Array Detector; PDA = Photodiode Array Absorbance; Various chemicals, especially flavonoids, terpenes, sterols, and organic acids, have been isolated from those species by different methods.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"VLC",
"=",
"Vacuum",
"liquid",
"chromatography",
";",
"SGCC",
"=",
"Silica",
"Gel",
"Column",
"chromatography",
";",
"SGDCC",
"=",
"Silica",
"Gel",
"Dry",
"Column",
"Chromatography",
";",
"PC",
"=",
"Paper",
"Chromatography",
";",
"TLC",
"=",
"Thin",
"Layer",
"Chromatography",
";",
"HPLC",
"=",
"High-performance",
"Liquid",
"Chromatography",
";",
"Sp-HPLC",
"=",
"Semi",
"preparative",
"High-performance",
"Liquid",
"Chromatography",
";",
"HR-ESI-MS",
"=",
"High-resolution",
"electrospray",
"ionisation",
"mass",
"spectrometry",
";",
"GC",
"–",
"MS",
"=",
"Gas",
"Chromatography",
"Mass",
"Spectrometry",
";",
"LC",
"–",
"MS",
"=",
"Liquid",
"chromatography",
"–",
"mass",
"spectrometry",
";",
"GC-EIMS",
"=",
"Gas",
"chromatography-electron",
"ionization",
"mass",
"spectrometry",
";",
"HR-FAB-MS",
"=",
"High",
"resolution",
"fast",
"atom",
"bombardment",
"mass",
"spectrometry",
";",
"UV",
"–",
"Vis",
"=",
"Ultraviolet",
"–",
"visible",
"spectroscopy",
";",
"IR",
"=",
"Infrared",
"spectroscopy",
";",
"FTIR",
"=",
"Fourier-transform",
"infrared",
"spectroscopy",
";",
"1H–1H",
"COSY",
"=",
"Correlation",
"Spectroscopy",
";",
"NOESY",
"=",
"Nuclear",
"Overhauser",
"enhancement",
"exchange",
"spectroscopy",
";",
"HMBC",
"=",
"Heteronuclear",
"Multiple",
"Bond",
"Correlation",
"Spectroscopy",
";",
"ROESY",
"=",
"Rotating",
"Frame",
"Overhauser",
"Enhancement",
"Spectroscopy",
";",
"HSQC",
"=",
"Heteronuclear",
"single",
"quantum",
"coherence",
"spectroscopy",
";",
"XRD",
"=",
"X-ray",
"diffraction",
"analysis",
";",
"DEPT",
"=",
"Distortionless",
"enhancement",
"by",
"polarization",
"transfer",
";",
"SPME",
"=",
"Solid",
"Phase",
"Microextraction",
";",
"DAD",
"=",
"Diode",
"Array",
"Detector",
";",
"PDA",
"=",
"Photodiode",
"Array",
"Absorbance",
";",
"Various",
"chemicals",
",",
"especially",
"flavonoids",
",",
"terpenes",
",",
"sterols",
",",
"and",
"organic",
"acids",
",",
"have",
"been",
"isolated",
"from",
"those",
"species",
"by",
"different",
"methods",
"."
]
}
] |
PMC11021472
|
The postulated functional mechanism of the ZDHHC11 transcripts in regulating growth of BL was to ensure high levels of MYB by binding to miR-150.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"postulated",
"functional",
"mechanism",
"of",
"the",
"ZDHHC11",
"transcripts",
"in",
"regulating",
"growth",
"of",
"BL",
"was",
"to",
"ensure",
"high",
"levels",
"of",
"MYB",
"by",
"binding",
"to",
"miR-150",
"."
]
}
] |
PMC11665555
|
The top 10 differentially regulated genes were validated by quantitative PCR (qPCR) (Supplemental Table 4).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"top",
"10",
"differentially",
"regulated",
"genes",
"were",
"validated",
"by",
"quantitative",
"PCR",
"(",
"qPCR",
")",
"(",
"Supplemental",
"Table",
"4",
")",
"."
]
}
] |
PMC11612626
|
Error bars in each figure represent the relative SEM.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Error",
"bars",
"in",
"each",
"figure",
"represent",
"the",
"relative",
"SEM",
"."
]
}
] |
PMC10747160
|
Griffithsin protein was serially diluted in at least 80 μL of PBS for the inhibition assay.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Griffithsin",
"protein",
"was",
"serially",
"diluted",
"in",
"at",
"least",
"80",
"μL",
"of",
"PBS",
"for",
"the",
"inhibition",
"assay",
"."
]
}
] |
PMC11658074
|
AdipoQ in AT-EVs may have anti-inflammatory and protective effects in response to UVB exposure.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"AdipoQ",
"in",
"AT-EVs",
"may",
"have",
"anti-inflammatory",
"and",
"protective",
"effects",
"in",
"response",
"to",
"UVB",
"exposure",
"."
]
}
] |
PMC11675244
|
With the later discoveries that underpinned Wnt, a stimulating link with the cell cycle had been established because, through β-catenin stabilization, it influences the transcription and expression of key regulatory genes like cyclin D1 and c-myc, essential for the G1/S transition in the cell cycle .
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"With",
"the",
"later",
"discoveries",
"that",
"underpinned",
"Wnt",
",",
"a",
"stimulating",
"link",
"with",
"the",
"cell",
"cycle",
"had",
"been",
"established",
"because",
",",
"through",
"β-catenin",
"stabilization",
",",
"it",
"influences",
"the",
"transcription",
"and",
"expression",
"of",
"key",
"regulatory",
"genes",
"like",
"cyclin",
"D1",
"and",
"c-myc",
",",
"essential",
"for",
"the",
"G1/S",
"transition",
"in",
"the",
"cell",
"cycle",
"."
]
}
] |
PMC10969097
|
They also created a nude mouse xenograft model (BALB/c) inoculating HepG2 and Bel-7404 cells to evaluate the effects in vivo.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"B-CellLine",
"O",
"O",
"B-CellLine",
"O",
"B-CellLine",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"They",
"also",
"created",
"a",
"nude",
"mouse",
"xenograft",
"model",
"(",
"BALB/c",
")",
"inoculating",
"HepG2",
"and",
"Bel-7404",
"cells",
"to",
"evaluate",
"the",
"effects",
"in",
"vivo",
"."
]
}
] |
PMC6190245
|
Cell viability was quantified by the MTT assay and the results revealed that F. gummosa exerts cytotoxicity activity in this cell line.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Cell",
"viability",
"was",
"quantified",
"by",
"the",
"MTT",
"assay",
"and",
"the",
"results",
"revealed",
"that",
"F.",
"gummosa",
"exerts",
"cytotoxicity",
"activity",
"in",
"this",
"cell",
"line",
"."
]
}
] |
PMC11628309
|
The graphs display the number of articles published up to the end of 2023.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"graphs",
"display",
"the",
"number",
"of",
"articles",
"published",
"up",
"to",
"the",
"end",
"of",
"2023",
"."
]
}
] |
PMC11746948
|
Then, the intraperitoneal injection of 2-BP or 2-BP plus Lip-1 was continued for one week.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Then",
",",
"the",
"intraperitoneal",
"injection",
"of",
"2-BP",
"or",
"2-BP",
"plus",
"Lip-1",
"was",
"continued",
"for",
"one",
"week",
"."
]
}
] |
PMC11476004
|
These cells have unlimited proliferative potential, are self-sufficient in terms of growth factors, and are not susceptible to either apoptotic or antiproliferative factors.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"These",
"cells",
"have",
"unlimited",
"proliferative",
"potential",
",",
"are",
"self-sufficient",
"in",
"terms",
"of",
"growth",
"factors",
",",
"and",
"are",
"not",
"susceptible",
"to",
"either",
"apoptotic",
"or",
"antiproliferative",
"factors",
"."
]
}
] |
PMC11733919
|
Representative dot plots and microphotographs are shown.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Representative",
"dot",
"plots",
"and",
"microphotographs",
"are",
"shown",
"."
]
}
] |
PMC11791478
|
In vitro coagulation assays confirmed that 25A3 does not interfere with the clotting cascade; even at a concentration of 100 nmol/L, it did not affect the activation of coagulation factor X or thrombin generation.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"In",
"vitro",
"coagulation",
"assays",
"confirmed",
"that",
"25A3",
"does",
"not",
"interfere",
"with",
"the",
"clotting",
"cascade",
";",
"even",
"at",
"a",
"concentration",
"of",
"100",
"nmol/L",
",",
"it",
"did",
"not",
"affect",
"the",
"activation",
"of",
"coagulation",
"factor",
"X",
"or",
"thrombin",
"generation",
"."
]
}
] |
PMC10529414
|
Finally, slide mounting was carried out with 7 µL of ProLong™ Gold Antifade Mountant mounting medium with DAPI (Invitrogen-USA, P36931).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Finally",
",",
"slide",
"mounting",
"was",
"carried",
"out",
"with",
"7",
"µL",
"of",
"ProLong",
"™",
"Gold",
"Antifade",
"Mountant",
"mounting",
"medium",
"with",
"DAPI",
"(",
"Invitrogen-USA",
",",
"P36931",
")",
"."
]
}
] |
PMC11078693
|
Alternatives: Other commercial kits are also available for antibody conjugation, and commercially available primary antibodies already conjugated to fluorophores can also be used.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Alternatives",
":",
"Other",
"commercial",
"kits",
"are",
"also",
"available",
"for",
"antibody",
"conjugation",
",",
"and",
"commercially",
"available",
"primary",
"antibodies",
"already",
"conjugated",
"to",
"fluorophores",
"can",
"also",
"be",
"used",
"."
]
}
] |
PMC11653552
|
Consistent with these results, elevated levels of miR-590-3p were found in various MM cell lines and transgenic mouse models (Vk*Che-1 and Vk*Myc) compared to control ones.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Consistent",
"with",
"these",
"results",
",",
"elevated",
"levels",
"of",
"miR-590",
"-",
"3p",
"were",
"found",
"in",
"various",
"MM",
"cell",
"lines",
"and",
"transgenic",
"mouse",
"models",
"(",
"Vk*Che-1",
"and",
"Vk*Myc",
")",
"compared",
"to",
"control",
"ones",
"."
]
}
] |
PMC9046263
|
Analysis of CpG island methylation frequency (via ANOVA with multiple comparisons correction) in each cell line demonstrated that A172 cells had significantly lower mean number of CpG islands relative to M059J cells (MD = − 0.2, p < 0.0001) and H4 cells (MD = − 0.3, p < 0.0001).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"B-CellLine",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"B-CellLine",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"B-CellLine",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Analysis",
"of",
"CpG",
"island",
"methylation",
"frequency",
"(",
"via",
"ANOVA",
"with",
"multiple",
"comparisons",
"correction",
")",
"in",
"each",
"cell",
"line",
"demonstrated",
"that",
"A172",
"cells",
"had",
"significantly",
"lower",
"mean",
"number",
"of",
"CpG",
"islands",
"relative",
"to",
"M059J",
"cells",
"(",
"MD",
"=",
"−",
"0.2",
",",
"p",
"<",
"0.0001",
")",
"and",
"H4",
"cells",
"(",
"MD",
"=",
"−",
"0.3",
",",
"p",
"<",
"0.0001",
")",
"."
]
}
] |
PMC11721096
|
To optimize the ligand fishing procedure utilizing CHO@hTYR, several parameters were evaluated, including the number of CHO cells, the incubation time, the incubation buffer, the desorption time, and the desorption solvent.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"B-CellLine",
"I-CellLine",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"To",
"optimize",
"the",
"ligand",
"fishing",
"procedure",
"utilizing",
"CHO@hTYR",
",",
"several",
"parameters",
"were",
"evaluated",
",",
"including",
"the",
"number",
"of",
"CHO",
"cells",
",",
"the",
"incubation",
"time",
",",
"the",
"incubation",
"buffer",
",",
"the",
"desorption",
"time",
",",
"and",
"the",
"desorption",
"solvent",
"."
]
}
] |
PMC11740508
|
Data analysis used FlowJo (BD Biosciences).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Data",
"analysis",
"used",
"FlowJo",
"(",
"BD",
"Biosciences",
")",
"."
]
}
] |
PMC9096373
|
Tumor metabolism (B,C) in the APA + RT group was significantly lower compared with the control, RT, and DDPs + RT groups (F=15.25, 15.11, and 7.73, respectively, P<0.05).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Tumor",
"metabolism",
"(",
"B",
",",
"C",
")",
"in",
"the",
"APA",
"+",
"RT",
"group",
"was",
"significantly",
"lower",
"compared",
"with",
"the",
"control",
",",
"RT",
",",
"and",
"DDPs",
"+",
"RT",
"groups",
"(",
"F=15.25",
",",
"15.11",
",",
"and",
"7.73",
",",
"respectively",
",",
"P<0.05",
")",
"."
]
}
] |
PMC9429973
|
Bariatric surgery was associated with inferior EFS (10-year: 31% vs 69%; P=0.009) and FFS (10-year: 16% vs 54%; P<0.0001) compared with control, with a trend for worse OS (10-year: 65% vs 85%; P=0.09) (Figure 1).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Bariatric",
"surgery",
"was",
"associated",
"with",
"inferior",
"EFS",
"(",
"10-year",
":",
"31",
"%",
"vs",
"69",
"%",
";",
"P=0.009",
")",
"and",
"FFS",
"(",
"10-year",
":",
"16",
"%",
"vs",
"54",
"%",
";",
"P<0.0001",
")",
"compared",
"with",
"control",
",",
"with",
"a",
"trend",
"for",
"worse",
"OS",
"(",
"10-year",
":",
"65",
"%",
"vs",
"85",
"%",
";",
"P=0.09",
")",
"(",
"Figure",
"1",
")",
"."
]
}
] |
PMC9429973
|
S. Rontauroli, E. Bianchi, L. Tavernari, M. Dall’Ora, G. Grisendi, M. Mirabile, S. Sartini, E. Genovese, C. Carretta, S. Mallia, S. Parenti, L. Fabbiani, N. Bartalucci, L. Losi, M. Dominici, A. M. Vannucchi, R. Manfredini Centre for Regenerative Medicine, Life Sciences Department, University of Modena and Reggio Emilia, Modena; Rigenerand S.R.L., Medolla (MO); Division of Oncology, Laboratory of Cellular Therapy, Department of Medical and Surgical Sciences of Children & Adults; Department of Medical and Surgical Sciences of Children & Adults, Pathology Unit, University of Modena and Reggio Emilia, Modena; Department of Experimental and Clinical Medicine, and Center Research and Innovation of Myeloproliferative Neoplasms (CRIMM), University of Florence, Careggi University Hospital, Florence; Department of Life Sciences, Pathology Unit, University of Modena and Reggio Emilia, Modena, Italy Background: Primary myelofibrosis (PMF) is a stem cell disorder belonging to Philadelphia-negative myeloproliferative neoplasms (MPNs).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"S.",
"Rontauroli",
",",
"E.",
"Bianchi",
",",
"L.",
"Tavernari",
",",
"M.",
"Dall’Ora",
",",
"G.",
"Grisendi",
",",
"M.",
"Mirabile",
",",
"S.",
"Sartini",
",",
"E.",
"Genovese",
",",
"C.",
"Carretta",
",",
"S.",
"Mallia",
",",
"S.",
"Parenti",
",",
"L.",
"Fabbiani",
",",
"N.",
"Bartalucci",
",",
"L.",
"Losi",
",",
"M.",
"Dominici",
",",
"A.",
"M.",
"Vannucchi",
",",
"R.",
"Manfredini",
"Centre",
"for",
"Regenerative",
"Medicine",
",",
"Life",
"Sciences",
"Department",
",",
"University",
"of",
"Modena",
"and",
"Reggio",
"Emilia",
",",
"Modena",
";",
"Rigenerand",
"S.R.L.",
",",
"Medolla",
"(",
"MO",
")",
";",
"Division",
"of",
"Oncology",
",",
"Laboratory",
"of",
"Cellular",
"Therapy",
",",
"Department",
"of",
"Medical",
"and",
"Surgical",
"Sciences",
"of",
"Children",
"&",
"Adults",
";",
"Department",
"of",
"Medical",
"and",
"Surgical",
"Sciences",
"of",
"Children",
"&",
"Adults",
",",
"Pathology",
"Unit",
",",
"University",
"of",
"Modena",
"and",
"Reggio",
"Emilia",
",",
"Modena",
";",
"Department",
"of",
"Experimental",
"and",
"Clinical",
"Medicine",
",",
"and",
"Center",
"Research",
"and",
"Innovation",
"of",
"Myeloproliferative",
"Neoplasms",
"(",
"CRIMM",
")",
",",
"University",
"of",
"Florence",
",",
"Careggi",
"University",
"Hospital",
",",
"Florence",
";",
"Department",
"of",
"Life",
"Sciences",
",",
"Pathology",
"Unit",
",",
"University",
"of",
"Modena",
"and",
"Reggio",
"Emilia",
",",
"Modena",
",",
"Italy",
"Background",
":",
"Primary",
"myelofibrosis",
"(",
"PMF",
")",
"is",
"a",
"stem",
"cell",
"disorder",
"belonging",
"to",
"Philadelphia-negative",
"myeloproliferative",
"neoplasms",
"(",
"MPNs",
")",
"."
]
}
] |
PMC9429973
|
exCMPs, which can be produced in large quantities in polyvinyl-alcohol (PVA)-based cultures (Wilkinson et al., Nature 2019), had lower CXCR4 expression, different integrin expression patterns, better cytokine responsiveness and mitogenic potential, as well as higher expression of platelet-related genes compared to fresh CMP.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"exCMPs",
",",
"which",
"can",
"be",
"produced",
"in",
"large",
"quantities",
"in",
"polyvinyl-alcohol",
"(PVA)-based",
"cultures",
"(",
"Wilkinson",
"et",
"al.",
",",
"Nature",
"2019",
")",
",",
"had",
"lower",
"CXCR4",
"expression",
",",
"different",
"integrin",
"expression",
"patterns",
",",
"better",
"cytokine",
"responsiveness",
"and",
"mitogenic",
"potential",
",",
"as",
"well",
"as",
"higher",
"expression",
"of",
"platelet-related",
"genes",
"compared",
"to",
"fresh",
"CMP",
"."
]
}
] |
PMC11641532
|
A non-targeting siRNA served as the control.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"A",
"non-targeting",
"siRNA",
"served",
"as",
"the",
"control",
"."
]
}
] |
PMC11489175
|
UCHL3 is the first structurally characterized DUB 20.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"UCHL3",
"is",
"the",
"first",
"structurally",
"characterized",
"DUB",
"20",
"."
]
}
] |
PMC11569208
|
Relative viability was measured by resazurin metabolic dye over mock transfected, uninfected controls at indicated timepoints (n = 3, mean ± SD; ****P < 0.0001 by two-way ANOVA).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Relative",
"viability",
"was",
"measured",
"by",
"resazurin",
"metabolic",
"dye",
"over",
"mock",
"transfected",
",",
"uninfected",
"controls",
"at",
"indicated",
"timepoints",
"(",
"n",
"=",
"3",
",",
"mean",
"±",
"SD",
";",
"*",
"*",
"*",
"*",
"P",
"<",
"0.0001",
"by",
"two-way",
"ANOVA",
")",
"."
]
}
] |
PMC11670407
|
Fig. 7OTULIN regulated the protein stability of GPX4 by preventing its proteasomal degradation.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Fig.",
"7OTULIN",
"regulated",
"the",
"protein",
"stability",
"of",
"GPX4",
"by",
"preventing",
"its",
"proteasomal",
"degradation",
"."
]
}
] |
PMC7081114
|
An overall score > 5 was considered as high expression.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"An",
"overall",
"score",
">",
"5",
"was",
"considered",
"as",
"high",
"expression",
"."
]
}
] |
PMC11543853
|
This indicates that endosome disruption can be triggered by a cellular mechanism without the direct involvement of virus components.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"This",
"indicates",
"that",
"endosome",
"disruption",
"can",
"be",
"triggered",
"by",
"a",
"cellular",
"mechanism",
"without",
"the",
"direct",
"involvement",
"of",
"virus",
"components",
"."
]
}
] |
PMC11756514
|
The influence of various wall teichoic acid (WTA) structures on the Langerin and MBL recognition of S. aureus. (
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"influence",
"of",
"various",
"wall",
"teichoic",
"acid",
"(",
"WTA",
")",
"structures",
"on",
"the",
"Langerin",
"and",
"MBL",
"recognition",
"of",
"S.",
"aureus",
".",
"("
]
}
] |
PMC6268318
|
= aqueous extract; MeOH ext.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"=",
"aqueous",
"extract",
";",
"MeOH",
"ext",
"."
]
}
] |
PMC11751675
|
Among these, xanthatin (47) demonstrated broad-spectrum antiviral activity against a range of viruses, including herpes simplex, vaccinia, and vesicular stomatitis in HEL cell cultures; feline coronavirus and feline herpesvirus in CRFK cell cultures; and vesicular stomatitis virus, coxsackievirus B4, and respiratory syncytial virus in HeLa cell cultures.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"B-CellLine",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"B-CellLine",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"B-CellLine",
"O",
"O",
"O"
],
"tokens": [
"Among",
"these",
",",
"xanthatin",
"(",
"47",
")",
"demonstrated",
"broad-spectrum",
"antiviral",
"activity",
"against",
"a",
"range",
"of",
"viruses",
",",
"including",
"herpes",
"simplex",
",",
"vaccinia",
",",
"and",
"vesicular",
"stomatitis",
"in",
"HEL",
"cell",
"cultures",
";",
"feline",
"coronavirus",
"and",
"feline",
"herpesvirus",
"in",
"CRFK",
"cell",
"cultures",
";",
"and",
"vesicular",
"stomatitis",
"virus",
",",
"coxsackievirus",
"B4",
",",
"and",
"respiratory",
"syncytial",
"virus",
"in",
"HeLa",
"cell",
"cultures",
"."
]
}
] |
PMC11583690
|
The impact of free MSN and BPMO on the cells was also evaluated.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"impact",
"of",
"free",
"MSN",
"and",
"BPMO",
"on",
"the",
"cells",
"was",
"also",
"evaluated",
"."
]
}
] |
PMC10748106
|
For this reason, an iso-surface of −10 kcal/mol value of MEP was obtained (Figure S4).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"For",
"this",
"reason",
",",
"an",
"iso-surface",
"of",
"−10",
"kcal/mol",
"value",
"of",
"MEP",
"was",
"obtained",
"(",
"Figure",
"S4",
")",
"."
]
}
] |
PMC11469524
|
The development of the new BCR network model allowed us to introduce so far not described links in BCR mediated intracellular signaling.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"development",
"of",
"the",
"new",
"BCR",
"network",
"model",
"allowed",
"us",
"to",
"introduce",
"so",
"far",
"not",
"described",
"links",
"in",
"BCR",
"mediated",
"intracellular",
"signaling",
"."
]
}
] |
PMC6114978
|
The effectiveness of TSA in the above experiments in promoting histone acetylation was validated in three cell lines, RD, Saos2, and sNF96.2 that demonstrated an increase in expression of MST1 and MST2.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"B-CellLine",
"O",
"B-CellLine",
"O",
"O",
"B-CellLine",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"effectiveness",
"of",
"TSA",
"in",
"the",
"above",
"experiments",
"in",
"promoting",
"histone",
"acetylation",
"was",
"validated",
"in",
"three",
"cell",
"lines",
",",
"RD",
",",
"Saos2",
",",
"and",
"sNF96.2",
"that",
"demonstrated",
"an",
"increase",
"in",
"expression",
"of",
"MST1",
"and",
"MST2",
"."
]
}
] |
PMC11792888
|
No changes were observed in the Bax/Bcl-2 or the cleaved-caspase 3/Total caspase 3 ratios in cells treated with venom.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"No",
"changes",
"were",
"observed",
"in",
"the",
"Bax/Bcl-2",
"or",
"the",
"cleaved-caspase",
"3/Total",
"caspase",
"3",
"ratios",
"in",
"cells",
"treated",
"with",
"venom",
"."
]
}
] |
PMC11482552
|
In cervical cancer screening molecular HPV testing, a “fixed” volume of resuspended cervical or self-sample is used to perform the analysis based on manufacturers indications, irrespective of the abundance of sample collection.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"In",
"cervical",
"cancer",
"screening",
"molecular",
"HPV",
"testing",
",",
"a",
"“",
"fixed",
"”",
"volume",
"of",
"resuspended",
"cervical",
"or",
"self-sample",
"is",
"used",
"to",
"perform",
"the",
"analysis",
"based",
"on",
"manufacturers",
"indications",
",",
"irrespective",
"of",
"the",
"abundance",
"of",
"sample",
"collection",
"."
]
}
] |
PMC11637276
|
Cells were imaged using a 60× Nikon A1 confocal microscope.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Cells",
"were",
"imaged",
"using",
"a",
"60",
"×",
"Nikon",
"A1",
"confocal",
"microscope",
"."
]
}
] |
PMC6102174
|
The whole plant is widely used by local people for the treatment of hepatitis, inflammation and digestive diseases.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"whole",
"plant",
"is",
"widely",
"used",
"by",
"local",
"people",
"for",
"the",
"treatment",
"of",
"hepatitis",
",",
"inflammation",
"and",
"digestive",
"diseases",
"."
]
}
] |
PMC11391695
|
The interaction between ACYP2 and TERT was subsequently confirmed using a Co-IP assay (Fig. 4B).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"interaction",
"between",
"ACYP2",
"and",
"TERT",
"was",
"subsequently",
"confirmed",
"using",
"a",
"Co-IP",
"assay",
"(",
"Fig.",
"4B",
")",
"."
]
}
] |
PMC10589262
|
Western blot analysis showed that strong ER stress rapidly and drastically reduced ATF6, cleaved-ATF6 (cATF6), and MT-KIT levels over time, whereas phospho-IRE1α, phospho-PERK, and CHOP levels drastically increased after 1 h of treatment with TG and continuously increased for 8 h (Fig. 4D).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Western",
"blot",
"analysis",
"showed",
"that",
"strong",
"ER",
"stress",
"rapidly",
"and",
"drastically",
"reduced",
"ATF6",
",",
"cleaved-ATF6",
"(",
"cATF6",
")",
",",
"and",
"MT-KIT",
"levels",
"over",
"time",
",",
"whereas",
"phospho-IRE1α",
",",
"phospho-PERK",
",",
"and",
"CHOP",
"levels",
"drastically",
"increased",
"after",
"1",
"h",
"of",
"treatment",
"with",
"TG",
"and",
"continuously",
"increased",
"for",
"8",
"h",
"(",
"Fig.",
"4D",
")",
"."
]
}
] |
PMC9429973
|
Assessing combinatorial treatment in a primary PDX sample using multi-dose matrix analyses of both inhibitors revealed a positive mean Bliss synergy score of +4.8 indicating synergistic activity.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Assessing",
"combinatorial",
"treatment",
"in",
"a",
"primary",
"PDX",
"sample",
"using",
"multi-dose",
"matrix",
"analyses",
"of",
"both",
"inhibitors",
"revealed",
"a",
"positive",
"mean",
"Bliss",
"synergy",
"score",
"of",
"+",
"4.8",
"indicating",
"synergistic",
"activity",
"."
]
}
] |
PMC11806106
|
The on-rate correlated with the respective affinity (Fig. 4G) and to some extent also with the respective efficacy of the agonist (Fig. 2B and Supplementary Fig. 4G).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"on-rate",
"correlated",
"with",
"the",
"respective",
"affinity",
"(",
"Fig.",
"4",
"G",
")",
"and",
"to",
"some",
"extent",
"also",
"with",
"the",
"respective",
"efficacy",
"of",
"the",
"agonist",
"(",
"Fig.",
"2B",
"and",
"Supplementary",
"Fig.",
"4",
"G",
")",
"."
]
}
] |
PMC11434983
|
The lipophilicity was determined using the shake flask method.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"lipophilicity",
"was",
"determined",
"using",
"the",
"shake",
"flask",
"method",
"."
]
}
] |
PMC11794568
|
On the one hand, it provides energy and metabolic intermediates to tumor cells to support their rapid growth and proliferation; on the other hand, the regulation of mitochondrial function can also be used as a therapeutic target to reduce the energy supply of tumor cells by inhibiting mitochondrial biogenesis, which in turn inhibits tumor progression.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"On",
"the",
"one",
"hand",
",",
"it",
"provides",
"energy",
"and",
"metabolic",
"intermediates",
"to",
"tumor",
"cells",
"to",
"support",
"their",
"rapid",
"growth",
"and",
"proliferation",
";",
"on",
"the",
"other",
"hand",
",",
"the",
"regulation",
"of",
"mitochondrial",
"function",
"can",
"also",
"be",
"used",
"as",
"a",
"therapeutic",
"target",
"to",
"reduce",
"the",
"energy",
"supply",
"of",
"tumor",
"cells",
"by",
"inhibiting",
"mitochondrial",
"biogenesis",
",",
"which",
"in",
"turn",
"inhibits",
"tumor",
"progression",
"."
]
}
] |
PMC8973085
|
calcd for C23H17FN4OS: C, 66.33; H, 4.11; N, 13.45.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"calcd",
"for",
"C23H17FN4OS",
":",
"C",
",",
"66.33",
";",
"H",
",",
"4.11",
";",
"N",
",",
"13.45",
"."
]
}
] |
PMC11763764
|
A two-way analysis of variance (ANOVA) test (Tukey’s multiple comparison test) was used to test hypotheses about effects in multiple groups with two variables. *
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"A",
"two-way",
"analysis",
"of",
"variance",
"(",
"ANOVA",
")",
"test",
"(",
"Tukey",
"’s",
"multiple",
"comparison",
"test",
")",
"was",
"used",
"to",
"test",
"hypotheses",
"about",
"effects",
"in",
"multiple",
"groups",
"with",
"two",
"variables",
".",
"*"
]
}
] |
PMC9318744
|
In this work, we show that ACE2pluC3 cells were susceptible to infection by multiple SARS-CoV-2 variants, allowing for studies with a broad range of viral strains.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"In",
"this",
"work",
",",
"we",
"show",
"that",
"ACE2pluC3",
"cells",
"were",
"susceptible",
"to",
"infection",
"by",
"multiple",
"SARS-CoV-2",
"variants",
",",
"allowing",
"for",
"studies",
"with",
"a",
"broad",
"range",
"of",
"viral",
"strains",
"."
]
}
] |
PMC8469018
|
The supernatant was transferred to another tube and centrifuged again at 15,000× g at 4 °C for 10 min, the obtained precipitate was a mitochondrial fraction.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"supernatant",
"was",
"transferred",
"to",
"another",
"tube",
"and",
"centrifuged",
"again",
"at",
"15,000",
"×",
"g",
"at",
"4",
"°",
"C",
"for",
"10",
"min",
",",
"the",
"obtained",
"precipitate",
"was",
"a",
"mitochondrial",
"fraction",
"."
]
}
] |
PMC11457557
|
In addition, the current review highlights the most recent data on genetic variations (related to RAS, glucose and lipid metabolism, and some cytoskeleton proteins) that confirm the importance of genetic factors in diabetic nephropathy.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"In",
"addition",
",",
"the",
"current",
"review",
"highlights",
"the",
"most",
"recent",
"data",
"on",
"genetic",
"variations",
"(",
"related",
"to",
"RAS",
",",
"glucose",
"and",
"lipid",
"metabolism",
",",
"and",
"some",
"cytoskeleton",
"proteins",
")",
"that",
"confirm",
"the",
"importance",
"of",
"genetic",
"factors",
"in",
"diabetic",
"nephropathy",
"."
]
}
] |
PMC9429973
|
Aims: We aimed to characterize real-world data regarding gilteritinib treatment in FLT3-mutated R/R AML and to compare outcomes with matched FLT3-mutated R/R AML patients treated with chemotherapy-based salvage regimens.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Aims",
":",
"We",
"aimed",
"to",
"characterize",
"real-world",
"data",
"regarding",
"gilteritinib",
"treatment",
"in",
"FLT3-mutated",
"R/R",
"AML",
"and",
"to",
"compare",
"outcomes",
"with",
"matched",
"FLT3-mutated",
"R/R",
"AML",
"patients",
"treated",
"with",
"chemotherapy-based",
"salvage",
"regimens",
"."
]
}
] |
PMC9429973
|
Conditioning regimens in CART group were either busulfan/fludarabine (n=12) or TBI/fludarabine (n=6).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Conditioning",
"regimens",
"in",
"CART",
"group",
"were",
"either",
"busulfan/fludarabine",
"(",
"n=12",
")",
"or",
"TBI/fludarabine",
"(",
"n=6",
")",
"."
]
}
] |
PMC9429973
|
Most of the patients 183 (60.6 %) were low probability, 108 (35.8%) intermediate and the rest 11(3.6%) were high probability.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Most",
"of",
"the",
"patients",
"183",
"(",
"60.6",
"%",
")",
"were",
"low",
"probability",
",",
"108",
"(",
"35.8",
"%",
")",
"intermediate",
"and",
"the",
"rest",
"11(3.6",
"%",
")",
"were",
"high",
"probability",
"."
]
}
] |
PMC5600151
|
As well as other positively charged polymers, the high charge and strong interaction with the negatively charged cell membranes can cause cell destabilization, with leakage of cytoplasmic proteins and subsequent lysis .
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"As",
"well",
"as",
"other",
"positively",
"charged",
"polymers",
",",
"the",
"high",
"charge",
"and",
"strong",
"interaction",
"with",
"the",
"negatively",
"charged",
"cell",
"membranes",
"can",
"cause",
"cell",
"destabilization",
",",
"with",
"leakage",
"of",
"cytoplasmic",
"proteins",
"and",
"subsequent",
"lysis",
"."
]
}
] |
PMC9429973
|
Main symptoms are fatigue (80%) and dyspnea (64%).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Main",
"symptoms",
"are",
"fatigue",
"(",
"80",
"%",
")",
"and",
"dyspnea",
"(",
"64",
"%",
")",
"."
]
}
] |
PMC11727000
|
A total of 146 proteins were enriched at least 3-fold comparing cells expressing the USP44-BioID fusion compared with those expressing the BioID fusion alone, 90 of which were recovered only from USP44-BioID-expressing—and not from BioID-expressing—cells (Table S1).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"A",
"total",
"of",
"146",
"proteins",
"were",
"enriched",
"at",
"least",
"3-fold",
"comparing",
"cells",
"expressing",
"the",
"USP44-BioID",
"fusion",
"compared",
"with",
"those",
"expressing",
"the",
"BioID",
"fusion",
"alone",
",",
"90",
"of",
"which",
"were",
"recovered",
"only",
"from",
"USP44-BioID-expressing",
"—",
"and",
"not",
"from",
"BioID-expressing",
"—",
"cells",
"(",
"Table",
"S1",
")",
"."
]
}
] |
PMC11655536
|
The expression levels of TFE3 in both compartments were increased with HA treatment compared with control (Fig. 4B).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"expression",
"levels",
"of",
"TFE3",
"in",
"both",
"compartments",
"were",
"increased",
"with",
"HA",
"treatment",
"compared",
"with",
"control",
"(",
"Fig.",
"4B",
")",
"."
]
}
] |
PMC9429973
|
Patients with rare or unknown translocations were subjected to long-distance inverse PCR (LDI-PCR), anchored multiplex PCR (ArcherDX, CO, USA) or custom targeted KMT2A enrichment panel (Illumina, CA, USA; Meyer et al., 2019).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Patients",
"with",
"rare",
"or",
"unknown",
"translocations",
"were",
"subjected",
"to",
"long-distance",
"inverse",
"PCR",
"(",
"LDI-PCR",
")",
",",
"anchored",
"multiplex",
"PCR",
"(",
"ArcherDX",
",",
"CO",
",",
"USA",
")",
"or",
"custom",
"targeted",
"KMT2A",
"enrichment",
"panel",
"(",
"Illumina",
",",
"CA",
",",
"USA",
";",
"Meyer",
"et",
"al.",
",",
"2019",
")",
"."
]
}
] |
PMC4005030
|
This study proves the utility of PCA in preventing damage by agents causing oxidative stress mediated nephrotoxicity.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"This",
"study",
"proves",
"the",
"utility",
"of",
"PCA",
"in",
"preventing",
"damage",
"by",
"agents",
"causing",
"oxidative",
"stress",
"mediated",
"nephrotoxicity",
"."
]
}
] |
PMC11679033
|
IC50 values were determined by a nonlinear fit equation predefined in Prism software 8 (GraphPad Software, San Diego, CA, USA).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"IC50",
"values",
"were",
"determined",
"by",
"a",
"nonlinear",
"fit",
"equation",
"predefined",
"in",
"Prism",
"software",
"8",
"(",
"GraphPad",
"Software",
",",
"San",
"Diego",
",",
"CA",
",",
"USA",
")",
"."
]
}
] |
PMC11684269
|
The splenic CD4 T cells undergo enhanced glycolysis and mitochondrial metabolism to meet the energy demand for aberrant autoimmune response.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"splenic",
"CD4",
"T",
"cells",
"undergo",
"enhanced",
"glycolysis",
"and",
"mitochondrial",
"metabolism",
"to",
"meet",
"the",
"energy",
"demand",
"for",
"aberrant",
"autoimmune",
"response",
"."
]
}
] |
PMC9596868
|
p ≤ 0.05; **p ≤ 0.01; ****p ≤ 0.0001 represent significant changes. (
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"p",
"≤",
"0.05",
";",
"*",
"*",
"p",
"≤",
"0.01",
";",
"*",
"*",
"*",
"*",
"p",
"≤",
"0.0001",
"represent",
"significant",
"changes",
".",
"("
]
}
] |
PMC11679326
|
Currently, the main pattern recognition receptors (PRRs) in mollusks are the following families of carbohydrate-binding proteins: lectins, fibrinogen-related proteins (FREPs), C1q domain-containing proteins (C1qDCs), Toll-like receptors (TLRs), and scavenger receptors (SRs) .
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Currently",
",",
"the",
"main",
"pattern",
"recognition",
"receptors",
"(",
"PRRs",
")",
"in",
"mollusks",
"are",
"the",
"following",
"families",
"of",
"carbohydrate-binding",
"proteins",
":",
"lectins",
",",
"fibrinogen-related",
"proteins",
"(",
"FREPs",
")",
",",
"C1q",
"domain-containing",
"proteins",
"(",
"C1qDCs",
")",
",",
"Toll-like",
"receptors",
"(",
"TLRs",
")",
",",
"and",
"scavenger",
"receptors",
"(",
"SRs",
")",
"."
]
}
] |
PMC11438317
|
Jurkat cells (A) or PBL (B) were plated on coverslips covered with antibody for CD3 for the indicated periods of time.
|
[
{
"tags": [
"B-CellLine",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Jurkat",
"cells",
"(",
"A",
")",
"or",
"PBL",
"(",
"B",
")",
"were",
"plated",
"on",
"coverslips",
"covered",
"with",
"antibody",
"for",
"CD3",
"for",
"the",
"indicated",
"periods",
"of",
"time",
"."
]
}
] |
PMC11507371
|
50 to 70 cells, were taken of each specimen.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"50",
"to",
"70",
"cells",
",",
"were",
"taken",
"of",
"each",
"specimen",
"."
]
}
] |
PMC11697703
|
See also Figure S3.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"See",
"also",
"Figure",
"S3",
"."
]
}
] |
PMC11626627
|
However, the mechanism by which ERβ regulates tumor EMT through the circATP2B1/miR-204–3p signaling pathway remains unclear.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"However",
",",
"the",
"mechanism",
"by",
"which",
"ERβ",
"regulates",
"tumor",
"EMT",
"through",
"the",
"circATP2B1/miR-204–3p",
"signaling",
"pathway",
"remains",
"unclear",
"."
]
}
] |
PMC11659734
|
A shared folder gathering the results was created and web meetings, involving the fellow, supervisors and other members of the two institutes participating to the study, were organised to monitor the progress of the experiments.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"A",
"shared",
"folder",
"gathering",
"the",
"results",
"was",
"created",
"and",
"web",
"meetings",
",",
"involving",
"the",
"fellow",
",",
"supervisors",
"and",
"other",
"members",
"of",
"the",
"two",
"institutes",
"participating",
"to",
"the",
"study",
",",
"were",
"organised",
"to",
"monitor",
"the",
"progress",
"of",
"the",
"experiments",
"."
]
}
] |
PMC11641532
|
Our goal was to identify biomarkers associated with tumor progression and prognosis in ccRCC by leveraging both single-cell and bulk transcriptomic data.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Our",
"goal",
"was",
"to",
"identify",
"biomarkers",
"associated",
"with",
"tumor",
"progression",
"and",
"prognosis",
"in",
"ccRCC",
"by",
"leveraging",
"both",
"single-cell",
"and",
"bulk",
"transcriptomic",
"data",
"."
]
}
] |
PMC9920575
|
Cells were incubated with the S. chinantlense extract at the IC50 value or cisplatin for 24 h. All adhering and floating cells were harvested, and 2 × 10 cells were resuspended in an ice-cold lysis buffer for 10 min.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Cells",
"were",
"incubated",
"with",
"the",
"S.",
"chinantlense",
"extract",
"at",
"the",
"IC50",
"value",
"or",
"cisplatin",
"for",
"24",
"h.",
"All",
"adhering",
"and",
"floating",
"cells",
"were",
"harvested",
",",
"and",
"2",
"×",
"10",
"cells",
"were",
"resuspended",
"in",
"an",
"ice-cold",
"lysis",
"buffer",
"for",
"10",
"min",
"."
]
}
] |
PMC9429973
|
Markers of FeO included hepcidin, iron, transferrin saturation (TSAT), ferritin, and liver iron concentration (LIC) by magnetic resonance imaging.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Markers",
"of",
"FeO",
"included",
"hepcidin",
",",
"iron",
",",
"transferrin",
"saturation",
"(",
"TSAT",
")",
",",
"ferritin",
",",
"and",
"liver",
"iron",
"concentration",
"(",
"LIC",
")",
"by",
"magnetic",
"resonance",
"imaging",
"."
]
}
] |
PMC9429973
|
Flow cytometry was performed with the anti-NKG2DL mAbs (MIC-A/B-PE, ULBP-1-APC, ULBP-2/5/6-PerCP).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"Flow",
"cytometry",
"was",
"performed",
"with",
"the",
"anti-NKG2DL",
"mAbs",
"(",
"MIC-A/B-PE",
",",
"ULBP-1-APC",
",",
"ULBP-2/5/6-PerCP",
")",
"."
]
}
] |
PMC11201245
|
The colonization of OC cells in the abdominal cavity does not occur via an endothelial barrier, as is the case with most other solid tumors.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"colonization",
"of",
"OC",
"cells",
"in",
"the",
"abdominal",
"cavity",
"does",
"not",
"occur",
"via",
"an",
"endothelial",
"barrier",
",",
"as",
"is",
"the",
"case",
"with",
"most",
"other",
"solid",
"tumors",
"."
]
}
] |
PMC10547921
|
The linker needs to balance stability and release efficiency.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"linker",
"needs",
"to",
"balance",
"stability",
"and",
"release",
"efficiency",
"."
]
}
] |
PMC9429973
|
The outpatient consultations are also covered in other parts of Estonia.
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"The",
"outpatient",
"consultations",
"are",
"also",
"covered",
"in",
"other",
"parts",
"of",
"Estonia",
"."
]
}
] |
PMC10758402
|
HSV titers were determined by a standard plaque assay on Vero cells according to a previously published protocol (14).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"B-CellLine",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"HSV",
"titers",
"were",
"determined",
"by",
"a",
"standard",
"plaque",
"assay",
"on",
"Vero",
"cells",
"according",
"to",
"a",
"previously",
"published",
"protocol",
"(",
"14",
")",
"."
]
}
] |
PMC11621493
|
8Pla2g4d-deficient keratinocytes show complex lipidomic changes. (
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"8Pla2g4d-deficient",
"keratinocytes",
"show",
"complex",
"lipidomic",
"changes",
".",
"("
]
}
] |
PMC11637276
|
We utilised Reactome to assess the enrichment for biological pathways in the positive and negative regulators identified by the screen, and enriched pathways included negative regulation of MAPK signalling pathway (p-value: 2.68E-05) and MAPK signalling cascades (p-value: 3.23E-04; S2 Table).
|
[
{
"tags": [
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O",
"O"
],
"tokens": [
"We",
"utilised",
"Reactome",
"to",
"assess",
"the",
"enrichment",
"for",
"biological",
"pathways",
"in",
"the",
"positive",
"and",
"negative",
"regulators",
"identified",
"by",
"the",
"screen",
",",
"and",
"enriched",
"pathways",
"included",
"negative",
"regulation",
"of",
"MAPK",
"signalling",
"pathway",
"(",
"p-value",
":",
"2.68E-05",
")",
"and",
"MAPK",
"signalling",
"cascades",
"(",
"p-value",
":",
"3.23E-04",
";",
"S2",
"Table",
")",
"."
]
}
] |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.