contestId
int64
0
1.01k
index
stringclasses
40 values
name
stringlengths
2
54
type
stringclasses
2 values
rating
int64
0
3.4k
tags
listlengths
0
7
title
stringclasses
393 values
time-limit
stringclasses
7 values
memory-limit
stringclasses
6 values
problem-description
stringlengths
0
2.97k
input-specification
stringlengths
4
1.87k
output-specification
stringlengths
4
1.12k
demo-input
listlengths
0
7
demo-output
listlengths
0
7
note
stringlengths
0
5.24k
points
float64
0
3.5k
test_cases
listlengths
0
402
creationTimeSeconds
int64
1.37B
1.7B
relativeTimeSeconds
int64
8
2.15B
programmingLanguage
stringclasses
3 values
verdict
stringclasses
1 value
testset
stringclasses
9 values
passedTestCount
int64
1
402
timeConsumedMillis
int64
15
8.06k
memoryConsumedBytes
int64
0
514M
code
stringlengths
11
61.4k
prompt
stringlengths
297
7.35k
response
stringlengths
25
61.4k
score
float64
2.82
3.99
16
A
Flag
PROGRAMMING
800
[ "implementation" ]
A. Flag
2
64
According to a new ISO standard, a flag of every country should have a chequered field *n*<=×<=*m*, each square should be of one of 10 colours, and the flag should be «striped»: each horizontal row of the flag should contain squares of the same colour, and the colours of adjacent horizontal rows should be different. Berland's government asked you to find out whether their flag meets the new ISO standard.
The first line of the input contains numbers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), *n* — the amount of rows, *m* — the amount of columns on the flag of Berland. Then there follows the description of the flag: each of the following *n* lines contain *m* characters. Each character is a digit between 0 and 9, and stands for the colour of the corresponding square.
Output YES, if the flag meets the new ISO standard, and NO otherwise.
[ "3 3\n000\n111\n222\n", "3 3\n000\n000\n111\n", "3 3\n000\n111\n002\n" ]
[ "YES\n", "NO\n", "NO\n" ]
none
0
[ { "input": "3 3\n000\n111\n222", "output": "YES" }, { "input": "3 3\n000\n000\n111", "output": "NO" }, { "input": "3 3\n000\n111\n002", "output": "NO" }, { "input": "10 10\n2222222222\n5555555555\n0000000000\n4444444444\n1111111111\n3333333393\n3333333333\n5555555555\n0000000000\n8888888888", "output": "NO" }, { "input": "10 13\n4442444444444\n8888888888888\n6666666666666\n0000000000000\n3333333333333\n4444444444444\n7777777777777\n8388888888888\n1111111111111\n5555555555555", "output": "NO" }, { "input": "10 8\n33333333\n44444444\n11111115\n81888888\n44444444\n11111111\n66666666\n33330333\n33333333\n33333333", "output": "NO" }, { "input": "5 5\n88888\n44444\n66666\n55555\n88888", "output": "YES" }, { "input": "20 19\n1111111111111111111\n5555555555555555555\n0000000000000000000\n3333333333333333333\n1111111111111111111\n2222222222222222222\n4444444444444444444\n5555555555555555555\n0000000000000000000\n4444444444444444444\n0000000000000000000\n5555555555555555555\n7777777777777777777\n9999999999999999999\n2222222222222222222\n4444444444444444444\n1111111111111111111\n6666666666666666666\n7777777777777777777\n2222222222222222222", "output": "YES" }, { "input": "1 100\n8888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888", "output": "YES" }, { "input": "100 1\n5\n7\n9\n4\n7\n2\n5\n1\n6\n7\n2\n7\n6\n8\n7\n4\n0\n2\n9\n8\n9\n1\n6\n4\n3\n4\n7\n1\n9\n3\n0\n8\n3\n1\n7\n5\n3\n9\n5\n1\n3\n5\n8\n1\n9\n3\n9\n0\n6\n0\n7\n6\n5\n2\n8\n3\n7\n6\n5\n1\n8\n3\n6\n9\n6\n0\n5\n8\n5\n2\n9\n1\n0\n1\n8\n3\n2\n1\n0\n3\n9\n0\n5\n1\n0\n4\n9\n3\n0\n4\n8\n4\n8\n6\n3\n0\n4\n6\n8\n4", "output": "YES" }, { "input": "1 1\n2", "output": "YES" }, { "input": "1 100\n1111111111111111111111111111111111111111111111111111111111111111111111111111181111111111111111111111", "output": "NO" }, { "input": "100 1\n3\n6\n4\n3\n0\n2\n8\n7\n3\n2\n1\n7\n1\n3\n2\n3\n6\n9\n0\n8\n5\n9\n7\n9\n2\n1\n4\n5\n1\n9\n2\n5\n1\n4\n6\n4\n9\n1\n0\n2\n1\n4\n7\n1\n4\n8\n0\n9\n2\n1\n6\n2\n8\n6\n9\n5\n8\n6\n4\n5\n9\n2\n7\n4\n1\n5\n8\n0\n9\n5\n4\n6\n5\n0\n6\n3\n6\n9\n7\n2\n0\n9\n7\n3\n2\n4\n9\n4\n7\n1\n2\n3\n1\n7\n9\n1\n9\n0\n4\n0", "output": "YES" } ]
1,676,631,743
2,147,483,647
PyPy 3
OK
TESTS
35
154
1,331,200
# https://codeforces.com/problemset/problem/16/A def func_sol(raw_data): data = raw_data.split('\n')[:-1] n, m = map(int, data[0].split(' ')) lines = data[1:] for line in lines: for c in line: if c != line[0]: return "NO\n" for i in range(len(lines) - 1): if lines[i][0] == lines[i + 1][0]: return "NO\n" return "YES\n" def main(): try: from codeforces.utilities import run_tests run_tests(func_sol) except ImportError: from sys import stdin print(func_sol(stdin.read())) main()
Title: Flag Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: According to a new ISO standard, a flag of every country should have a chequered field *n*<=×<=*m*, each square should be of one of 10 colours, and the flag should be «striped»: each horizontal row of the flag should contain squares of the same colour, and the colours of adjacent horizontal rows should be different. Berland's government asked you to find out whether their flag meets the new ISO standard. Input Specification: The first line of the input contains numbers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), *n* — the amount of rows, *m* — the amount of columns on the flag of Berland. Then there follows the description of the flag: each of the following *n* lines contain *m* characters. Each character is a digit between 0 and 9, and stands for the colour of the corresponding square. Output Specification: Output YES, if the flag meets the new ISO standard, and NO otherwise. Demo Input: ['3 3\n000\n111\n222\n', '3 3\n000\n000\n111\n', '3 3\n000\n111\n002\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none
```python # https://codeforces.com/problemset/problem/16/A def func_sol(raw_data): data = raw_data.split('\n')[:-1] n, m = map(int, data[0].split(' ')) lines = data[1:] for line in lines: for c in line: if c != line[0]: return "NO\n" for i in range(len(lines) - 1): if lines[i][0] == lines[i + 1][0]: return "NO\n" return "YES\n" def main(): try: from codeforces.utilities import run_tests run_tests(func_sol) except ImportError: from sys import stdin print(func_sol(stdin.read())) main() ```
3.951582
716
A
Crazy Computer
PROGRAMMING
800
[ "implementation" ]
null
null
ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear! More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=&gt;<=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen. For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen. You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything.
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively. The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=&lt;<=*t*2<=&lt;<=...<=&lt;<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word.
Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*.
[ "6 5\n1 3 8 14 19 20\n", "6 1\n1 3 5 7 9 10\n" ]
[ "3", "2" ]
The first sample is already explained in the problem statement. For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 &gt; 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1.
500
[ { "input": "6 5\n1 3 8 14 19 20", "output": "3" }, { "input": "6 1\n1 3 5 7 9 10", "output": "2" }, { "input": "1 1\n1000000000", "output": "1" }, { "input": "5 5\n1 7 12 13 14", "output": "4" }, { "input": "2 1000000000\n1 1000000000", "output": "2" }, { "input": "3 5\n1 10 20", "output": "1" }, { "input": "3 10\n1 2 3", "output": "3" }, { "input": "2 1\n1 100", "output": "1" }, { "input": "3 1\n1 2 10", "output": "1" }, { "input": "2 1\n1 2", "output": "2" } ]
1,644,891,996
2,147,483,647
Python 3
OK
TESTS
81
124
7,884,800
n,c = map(int,input().split()) a = list(map(int, input().split())) s = 0 for i in range(1,n): if (a[i]-a[i-1])>c: s = 0 else: s = s + 1 print(s+1)
Title: Crazy Computer Time Limit: None seconds Memory Limit: None megabytes Problem Description: ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear! More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=&gt;<=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen. For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen. You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything. Input Specification: The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively. The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=&lt;<=*t*2<=&lt;<=...<=&lt;<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word. Output Specification: Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*. Demo Input: ['6 5\n1 3 8 14 19 20\n', '6 1\n1 3 5 7 9 10\n'] Demo Output: ['3', '2'] Note: The first sample is already explained in the problem statement. For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 &gt; 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1.
```python n,c = map(int,input().split()) a = list(map(int, input().split())) s = 0 for i in range(1,n): if (a[i]-a[i-1])>c: s = 0 else: s = s + 1 print(s+1) ```
3
453
A
Little Pony and Expected Maximum
PROGRAMMING
1,600
[ "probabilities" ]
null
null
Twilight Sparkle was playing Ludo with her friends Rainbow Dash, Apple Jack and Flutter Shy. But she kept losing. Having returned to the castle, Twilight Sparkle became interested in the dice that were used in the game. The dice has *m* faces: the first face of the dice contains a dot, the second one contains two dots, and so on, the *m*-th face contains *m* dots. Twilight Sparkle is sure that when the dice is tossed, each face appears with probability . Also she knows that each toss is independent from others. Help her to calculate the expected maximum number of dots she could get after tossing the dice *n* times.
A single line contains two integers *m* and *n* (1<=≤<=*m*,<=*n*<=≤<=105).
Output a single real number corresponding to the expected maximum. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=<=-<=4.
[ "6 1\n", "6 3\n", "2 2\n" ]
[ "3.500000000000\n", "4.958333333333\n", "1.750000000000\n" ]
Consider the third test example. If you've made two tosses: 1. You can get 1 in the first toss, and 2 in the second. Maximum equals to 2. 1. You can get 1 in the first toss, and 1 in the second. Maximum equals to 1. 1. You can get 2 in the first toss, and 1 in the second. Maximum equals to 2. 1. You can get 2 in the first toss, and 2 in the second. Maximum equals to 2. The probability of each outcome is 0.25, that is expectation equals to: You can read about expectation using the following link: http://en.wikipedia.org/wiki/Expected_value
500
[ { "input": "6 1", "output": "3.500000000000" }, { "input": "6 3", "output": "4.958333333333" }, { "input": "2 2", "output": "1.750000000000" }, { "input": "5 4", "output": "4.433600000000" }, { "input": "5 8", "output": "4.814773760000" }, { "input": "3 10", "output": "2.982641534996" }, { "input": "3 6", "output": "2.910836762689" }, { "input": "1 8", "output": "1.000000000000" }, { "input": "24438 9", "output": "21994.699969310015" }, { "input": "94444 9", "output": "85000.099992058866" }, { "input": "8 66716", "output": "8.000000000000" }, { "input": "4 25132", "output": "4.000000000000" }, { "input": "51520 73331", "output": "51519.682650242677" }, { "input": "54230 31747", "output": "54228.743352775018" }, { "input": "24236 90163", "output": "24235.975171545670" }, { "input": "26946 99523", "output": "26945.974480086279" }, { "input": "50323 7", "output": "44033.124988408454" }, { "input": "53033 3", "output": "39775.249995286234" }, { "input": "55743 5", "output": "46452.999992525307" }, { "input": "59964 79", "output": "59214.949890211828" }, { "input": "1 1", "output": "1.000000000000" }, { "input": "1 1", "output": "1.000000000000" }, { "input": "3 1", "output": "2.000000000000" }, { "input": "1 2", "output": "1.000000000000" }, { "input": "53513 34040", "output": "53511.875329020870" }, { "input": "100000 100000", "output": "99999.418033254507" }, { "input": "1 100000", "output": "1.000000000000" }, { "input": "100000 1", "output": "50000.499999999935" }, { "input": "2 100000", "output": "2.000000000000" }, { "input": "100000 2", "output": "66667.166665000332" }, { "input": "50000 100000", "output": "49999.843487110789" }, { "input": "99999 1111", "output": "99909.571915885972" }, { "input": "99999 99999", "output": "99998.418033254609" }, { "input": "1000 1000", "output": "999.419018443269" }, { "input": "50000 50000", "output": "49999.418043215679" }, { "input": "88888 88888", "output": "88887.418034499773" }, { "input": "99999 100000", "output": "99998.418042461126" }, { "input": "100000 555", "output": "99820.643422392372" }, { "input": "10000 10000", "output": "9999.418122897887" }, { "input": "100000 5001", "output": "99980.503829474910" }, { "input": "100000 1000", "output": "99900.599066768002" } ]
1,638,275,101
2,147,483,647
Python 3
OK
TESTS
41
93
0
m,n=list(map(int,input().split())) q=0 for i in range(1,m): q+=(i/m)**n print(m-q)
Title: Little Pony and Expected Maximum Time Limit: None seconds Memory Limit: None megabytes Problem Description: Twilight Sparkle was playing Ludo with her friends Rainbow Dash, Apple Jack and Flutter Shy. But she kept losing. Having returned to the castle, Twilight Sparkle became interested in the dice that were used in the game. The dice has *m* faces: the first face of the dice contains a dot, the second one contains two dots, and so on, the *m*-th face contains *m* dots. Twilight Sparkle is sure that when the dice is tossed, each face appears with probability . Also she knows that each toss is independent from others. Help her to calculate the expected maximum number of dots she could get after tossing the dice *n* times. Input Specification: A single line contains two integers *m* and *n* (1<=≤<=*m*,<=*n*<=≤<=105). Output Specification: Output a single real number corresponding to the expected maximum. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=<=-<=4. Demo Input: ['6 1\n', '6 3\n', '2 2\n'] Demo Output: ['3.500000000000\n', '4.958333333333\n', '1.750000000000\n'] Note: Consider the third test example. If you've made two tosses: 1. You can get 1 in the first toss, and 2 in the second. Maximum equals to 2. 1. You can get 1 in the first toss, and 1 in the second. Maximum equals to 1. 1. You can get 2 in the first toss, and 1 in the second. Maximum equals to 2. 1. You can get 2 in the first toss, and 2 in the second. Maximum equals to 2. The probability of each outcome is 0.25, that is expectation equals to: You can read about expectation using the following link: http://en.wikipedia.org/wiki/Expected_value
```python m,n=list(map(int,input().split())) q=0 for i in range(1,m): q+=(i/m)**n print(m-q) ```
3
165
A
Supercentral Point
PROGRAMMING
1,000
[ "implementation" ]
null
null
One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*): - point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=&gt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=&lt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=&lt;<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=&gt;<=*y* We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points. Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set.
The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different.
Print the only number — the number of supercentral points of the given set.
[ "8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n", "5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n" ]
[ "2\n", "1\n" ]
In the first sample the supercentral points are only points (1, 1) and (1, 2). In the second sample there is one supercental point — point (0, 0).
500
[ { "input": "8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3", "output": "2" }, { "input": "5\n0 0\n0 1\n1 0\n0 -1\n-1 0", "output": "1" }, { "input": "9\n-565 -752\n-184 723\n-184 -752\n-184 1\n950 723\n-565 723\n950 -752\n950 1\n-565 1", "output": "1" }, { "input": "25\n-651 897\n916 897\n-651 -808\n-748 301\n-734 414\n-651 -973\n-734 897\n916 -550\n-758 414\n916 180\n-758 -808\n-758 -973\n125 -550\n125 -973\n125 301\n916 414\n-748 -808\n-651 301\n-734 301\n-307 897\n-651 -550\n-651 414\n125 -808\n-748 -550\n916 -808", "output": "7" }, { "input": "1\n487 550", "output": "0" }, { "input": "10\n990 -396\n990 736\n990 646\n990 -102\n990 -570\n990 155\n990 528\n990 489\n990 268\n990 676", "output": "0" }, { "input": "30\n507 836\n525 836\n-779 196\n507 -814\n525 -814\n525 42\n525 196\n525 -136\n-779 311\n507 -360\n525 300\n507 578\n507 311\n-779 836\n507 300\n525 -360\n525 311\n-779 -360\n-779 578\n-779 300\n507 42\n525 578\n-779 379\n507 196\n525 379\n507 379\n-779 -814\n-779 42\n-779 -136\n507 -136", "output": "8" }, { "input": "25\n890 -756\n890 -188\n-37 -756\n-37 853\n523 998\n-261 853\n-351 853\n-351 -188\n523 -756\n-261 -188\n-37 998\n523 -212\n-351 998\n-37 -188\n-351 -756\n-37 -212\n890 998\n890 -212\n523 853\n-351 -212\n-261 -212\n-261 998\n-261 -756\n890 853\n523 -188", "output": "9" }, { "input": "21\n-813 -11\n486 254\n685 254\n-708 254\n-55 -11\n-671 -191\n486 -11\n-671 -11\n685 -11\n685 -191\n486 -191\n-55 254\n-708 -11\n-813 254\n-708 -191\n41 -11\n-671 254\n-813 -191\n41 254\n-55 -191\n41 -191", "output": "5" }, { "input": "4\n1 0\n2 0\n1 1\n1 -1", "output": "0" } ]
1,684,229,259
2,147,483,647
Python 3
OK
TESTS
26
92
0
#Keshika Patwari #Indian Institute Of Technology, Jodhpur # 2022 import sys input=sys.stdin.readline def exe(): lx=[] ly=[] for i in al: dx[i]=[] for i in range(len(al)): dx[al[i]]+=[bl[i]] for i in dx: if(len(dx[i])>=3): a=dx[i] a.sort() #print(a) for j in range(len(a)): if(j!=0 and j!=len(a)-1): lx.append([i,a[j]]) #print(dx,lx) for i in bl: dy[i]=[] for i in range(len(bl)): dy[bl[i]]+=[al[i]] for i in dy: if(len(dy[i])>=3): a=dy[i] a.sort() for j in range(len(a)): if(j!=0 and j!=len(a)-1): ly.append([a[j],i]) result = [i for i in lx if i in ly] #print(lx,ly) return len(result) # a_set = set(lx) # b_set = set(ly) # return a_set & b_set dx={} dy={} al=[] bl=[] for i in range(int(input())): a,b=map(int,input().split()) al.append(a) bl.append(b) print(exe())
Title: Supercentral Point Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*): - point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=&gt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=&lt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=&lt;<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=&gt;<=*y* We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points. Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set. Input Specification: The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different. Output Specification: Print the only number — the number of supercentral points of the given set. Demo Input: ['8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n', '5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n'] Demo Output: ['2\n', '1\n'] Note: In the first sample the supercentral points are only points (1, 1) and (1, 2). In the second sample there is one supercental point — point (0, 0).
```python #Keshika Patwari #Indian Institute Of Technology, Jodhpur # 2022 import sys input=sys.stdin.readline def exe(): lx=[] ly=[] for i in al: dx[i]=[] for i in range(len(al)): dx[al[i]]+=[bl[i]] for i in dx: if(len(dx[i])>=3): a=dx[i] a.sort() #print(a) for j in range(len(a)): if(j!=0 and j!=len(a)-1): lx.append([i,a[j]]) #print(dx,lx) for i in bl: dy[i]=[] for i in range(len(bl)): dy[bl[i]]+=[al[i]] for i in dy: if(len(dy[i])>=3): a=dy[i] a.sort() for j in range(len(a)): if(j!=0 and j!=len(a)-1): ly.append([a[j],i]) result = [i for i in lx if i in ly] #print(lx,ly) return len(result) # a_set = set(lx) # b_set = set(ly) # return a_set & b_set dx={} dy={} al=[] bl=[] for i in range(int(input())): a,b=map(int,input().split()) al.append(a) bl.append(b) print(exe()) ```
3
92
A
Chips
PROGRAMMING
800
[ "implementation", "math" ]
A. Chips
2
256
There are *n* walruses sitting in a circle. All of them are numbered in the clockwise order: the walrus number 2 sits to the left of the walrus number 1, the walrus number 3 sits to the left of the walrus number 2, ..., the walrus number 1 sits to the left of the walrus number *n*. The presenter has *m* chips. The presenter stands in the middle of the circle and starts giving the chips to the walruses starting from walrus number 1 and moving clockwise. The walrus number *i* gets *i* chips. If the presenter can't give the current walrus the required number of chips, then the presenter takes the remaining chips and the process ends. Determine by the given *n* and *m* how many chips the presenter will get in the end.
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=50, 1<=≤<=*m*<=≤<=104) — the number of walruses and the number of chips correspondingly.
Print the number of chips the presenter ended up with.
[ "4 11\n", "17 107\n", "3 8\n" ]
[ "0\n", "2\n", "1\n" ]
In the first sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, four chips to the walrus number 4, then again one chip to the walrus number 1. After that the presenter runs out of chips. He can't give anything to the walrus number 2 and the process finishes. In the third sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, then again one chip to the walrus number 1. The presenter has one chip left and he can't give two chips to the walrus number 2, that's why the presenter takes the last chip.
500
[ { "input": "4 11", "output": "0" }, { "input": "17 107", "output": "2" }, { "input": "3 8", "output": "1" }, { "input": "46 7262", "output": "35" }, { "input": "32 6864", "output": "0" }, { "input": "36 6218", "output": "14" }, { "input": "25 9712", "output": "11" }, { "input": "9 7601", "output": "5" }, { "input": "1 9058", "output": "0" }, { "input": "29 7772", "output": "26" }, { "input": "45 9465", "output": "14" }, { "input": "46 866", "output": "5" }, { "input": "29 1241", "output": "20" }, { "input": "17 4248", "output": "12" }, { "input": "20 8082", "output": "11" }, { "input": "50 9555", "output": "0" }, { "input": "4 7455", "output": "2" }, { "input": "36 880", "output": "4" }, { "input": "24 7440", "output": "9" }, { "input": "44 7888", "output": "12" }, { "input": "1 1", "output": "0" }, { "input": "50 10000", "output": "40" }, { "input": "1 10000", "output": "0" }, { "input": "50 1", "output": "0" }, { "input": "50 50", "output": "5" } ]
1,690,711,483
2,147,483,647
Python 3
OK
TESTS
25
92
0
A,B = map(int, input().split()) temp = A * (A + 1) // 2 for i in range(100000000): if temp <= B: B -= temp elif temp > B: break if B == 0: print(0) else: for i in range(1, A + 1): if B >= i: B -= i elif B < i: print(B) break
Title: Chips Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: There are *n* walruses sitting in a circle. All of them are numbered in the clockwise order: the walrus number 2 sits to the left of the walrus number 1, the walrus number 3 sits to the left of the walrus number 2, ..., the walrus number 1 sits to the left of the walrus number *n*. The presenter has *m* chips. The presenter stands in the middle of the circle and starts giving the chips to the walruses starting from walrus number 1 and moving clockwise. The walrus number *i* gets *i* chips. If the presenter can't give the current walrus the required number of chips, then the presenter takes the remaining chips and the process ends. Determine by the given *n* and *m* how many chips the presenter will get in the end. Input Specification: The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=50, 1<=≤<=*m*<=≤<=104) — the number of walruses and the number of chips correspondingly. Output Specification: Print the number of chips the presenter ended up with. Demo Input: ['4 11\n', '17 107\n', '3 8\n'] Demo Output: ['0\n', '2\n', '1\n'] Note: In the first sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, four chips to the walrus number 4, then again one chip to the walrus number 1. After that the presenter runs out of chips. He can't give anything to the walrus number 2 and the process finishes. In the third sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, then again one chip to the walrus number 1. The presenter has one chip left and he can't give two chips to the walrus number 2, that's why the presenter takes the last chip.
```python A,B = map(int, input().split()) temp = A * (A + 1) // 2 for i in range(100000000): if temp <= B: B -= temp elif temp > B: break if B == 0: print(0) else: for i in range(1, A + 1): if B >= i: B -= i elif B < i: print(B) break ```
3.977
744
A
Hongcow Builds A Nation
PROGRAMMING
1,500
[ "dfs and similar", "graphs" ]
null
null
Hongcow is ruler of the world. As ruler of the world, he wants to make it easier for people to travel by road within their own countries. The world can be modeled as an undirected graph with *n* nodes and *m* edges. *k* of the nodes are home to the governments of the *k* countries that make up the world. There is at most one edge connecting any two nodes and no edge connects a node to itself. Furthermore, for any two nodes corresponding to governments, there is no path between those two nodes. Any graph that satisfies all of these conditions is stable. Hongcow wants to add as many edges as possible to the graph while keeping it stable. Determine the maximum number of edges Hongcow can add.
The first line of input will contain three integers *n*, *m* and *k* (1<=≤<=*n*<=≤<=1<=000, 0<=≤<=*m*<=≤<=100<=000, 1<=≤<=*k*<=≤<=*n*) — the number of vertices and edges in the graph, and the number of vertices that are homes of the government. The next line of input will contain *k* integers *c*1,<=*c*2,<=...,<=*c**k* (1<=≤<=*c**i*<=≤<=*n*). These integers will be pairwise distinct and denote the nodes that are home to the governments in this world. The following *m* lines of input will contain two integers *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*). This denotes an undirected edge between nodes *u**i* and *v**i*. It is guaranteed that the graph described by the input is stable.
Output a single integer, the maximum number of edges Hongcow can add to the graph while keeping it stable.
[ "4 1 2\n1 3\n1 2\n", "3 3 1\n2\n1 2\n1 3\n2 3\n" ]
[ "2\n", "0\n" ]
For the first sample test, the graph looks like this: For the second sample test, the graph looks like this:
500
[ { "input": "4 1 2\n1 3\n1 2", "output": "2" }, { "input": "3 3 1\n2\n1 2\n1 3\n2 3", "output": "0" }, { "input": "10 3 2\n1 10\n1 2\n1 3\n4 5", "output": "33" }, { "input": "1 0 1\n1", "output": "0" }, { "input": "1000 0 1\n72", "output": "499500" }, { "input": "24 38 2\n4 13\n7 1\n24 1\n2 8\n17 2\n2 18\n22 2\n23 3\n5 9\n21 5\n6 7\n6 19\n6 20\n11 7\n7 20\n13 8\n16 8\n9 10\n14 9\n21 9\n12 10\n10 22\n23 10\n17 11\n11 24\n20 12\n13 16\n13 23\n15 14\n17 14\n14 20\n19 16\n17 20\n17 23\n18 22\n18 23\n22 19\n21 20\n23 24", "output": "215" }, { "input": "10 30 1\n4\n1 2\n3 1\n4 1\n1 6\n1 8\n10 1\n2 4\n2 7\n3 4\n3 5\n7 3\n3 9\n10 3\n5 4\n6 4\n7 4\n9 4\n10 4\n6 5\n5 8\n9 5\n10 5\n6 7\n9 6\n10 6\n7 8\n9 7\n10 7\n9 8\n10 8", "output": "15" }, { "input": "10 13 2\n5 10\n2 1\n1 4\n2 3\n2 8\n3 4\n7 3\n4 6\n8 4\n4 9\n6 7\n6 9\n10 6\n7 8", "output": "23" }, { "input": "10 10 3\n2 5 6\n1 3\n4 1\n4 3\n5 3\n3 9\n8 4\n9 4\n5 10\n8 7\n10 8", "output": "18" }, { "input": "10 5 3\n1 5 9\n1 3\n1 8\n2 3\n8 4\n5 7", "output": "17" }, { "input": "6 4 2\n1 4\n1 2\n2 3\n4 5\n5 6", "output": "2" }, { "input": "7 8 2\n1 4\n1 2\n2 3\n4 5\n4 6\n4 7\n5 6\n5 7\n6 7", "output": "1" }, { "input": "5 2 3\n1 3 4\n1 5\n2 4", "output": "0" }, { "input": "5 3 2\n1 2\n2 3\n2 4\n1 5", "output": "1" }, { "input": "9 5 2\n1 5\n1 2\n2 3\n3 4\n5 6\n6 7", "output": "13" }, { "input": "6 4 1\n1\n2 3\n3 4\n4 5\n5 6", "output": "11" }, { "input": "6 4 2\n1 5\n1 2\n2 3\n3 4\n5 6", "output": "3" }, { "input": "7 3 3\n1 5 6\n1 2\n1 3\n6 7", "output": "4" }, { "input": "5 2 2\n1 2\n1 3\n2 4", "output": "2" }, { "input": "11 7 2\n1 4\n1 2\n1 3\n4 5\n4 6\n5 6\n9 10\n1 11", "output": "24" }, { "input": "20 4 5\n1 3 9 10 20\n5 6\n1 2\n7 9\n4 10", "output": "89" } ]
1,620,413,385
2,147,483,647
Python 3
OK
TESTS
61
342
9,420,800
def functionAux(ind): if not C[ind]: C[ind]=True aux[0]+=1 for i in B[ind]: if not C[i]:functionAux(i) listOne,listTwo,listThree=list(map(int, input().split())) A=list(map(int, input().split())) A=[i-1 for i in A] B=[list([]) for i in range(listOne)] C=[False for i in range(listOne)] ans=0 auxMax=0 for i in range(listTwo): a,b=[i-1 for i in list(map(int, input().split()))] B[a].append(b) B[b].append(a) for i in range(listThree): aux=[0] functionAux(A[i]) ans+=aux[0]*(aux[0]-1)//2 auxMax=max(auxMax,aux[0]) ans-=auxMax*(auxMax-1)//2 for i in range(listOne): if not C[i]: aux=[0] functionAux(i) auxMax+=aux[0] result= ans - listTwo + auxMax * (auxMax-1) // 2 print(result)
Title: Hongcow Builds A Nation Time Limit: None seconds Memory Limit: None megabytes Problem Description: Hongcow is ruler of the world. As ruler of the world, he wants to make it easier for people to travel by road within their own countries. The world can be modeled as an undirected graph with *n* nodes and *m* edges. *k* of the nodes are home to the governments of the *k* countries that make up the world. There is at most one edge connecting any two nodes and no edge connects a node to itself. Furthermore, for any two nodes corresponding to governments, there is no path between those two nodes. Any graph that satisfies all of these conditions is stable. Hongcow wants to add as many edges as possible to the graph while keeping it stable. Determine the maximum number of edges Hongcow can add. Input Specification: The first line of input will contain three integers *n*, *m* and *k* (1<=≤<=*n*<=≤<=1<=000, 0<=≤<=*m*<=≤<=100<=000, 1<=≤<=*k*<=≤<=*n*) — the number of vertices and edges in the graph, and the number of vertices that are homes of the government. The next line of input will contain *k* integers *c*1,<=*c*2,<=...,<=*c**k* (1<=≤<=*c**i*<=≤<=*n*). These integers will be pairwise distinct and denote the nodes that are home to the governments in this world. The following *m* lines of input will contain two integers *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*). This denotes an undirected edge between nodes *u**i* and *v**i*. It is guaranteed that the graph described by the input is stable. Output Specification: Output a single integer, the maximum number of edges Hongcow can add to the graph while keeping it stable. Demo Input: ['4 1 2\n1 3\n1 2\n', '3 3 1\n2\n1 2\n1 3\n2 3\n'] Demo Output: ['2\n', '0\n'] Note: For the first sample test, the graph looks like this: For the second sample test, the graph looks like this:
```python def functionAux(ind): if not C[ind]: C[ind]=True aux[0]+=1 for i in B[ind]: if not C[i]:functionAux(i) listOne,listTwo,listThree=list(map(int, input().split())) A=list(map(int, input().split())) A=[i-1 for i in A] B=[list([]) for i in range(listOne)] C=[False for i in range(listOne)] ans=0 auxMax=0 for i in range(listTwo): a,b=[i-1 for i in list(map(int, input().split()))] B[a].append(b) B[b].append(a) for i in range(listThree): aux=[0] functionAux(A[i]) ans+=aux[0]*(aux[0]-1)//2 auxMax=max(auxMax,aux[0]) ans-=auxMax*(auxMax-1)//2 for i in range(listOne): if not C[i]: aux=[0] functionAux(i) auxMax+=aux[0] result= ans - listTwo + auxMax * (auxMax-1) // 2 print(result) ```
3
208
A
Dubstep
PROGRAMMING
900
[ "strings" ]
null
null
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them. Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club. For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX". Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
[ "WUBWUBABCWUB\n", "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n" ]
[ "ABC ", "WE ARE THE CHAMPIONS MY FRIEND " ]
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya. In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
500
[ { "input": "WUBWUBABCWUB", "output": "ABC " }, { "input": "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB", "output": "WE ARE THE CHAMPIONS MY FRIEND " }, { "input": "WUBWUBWUBSR", "output": "SR " }, { "input": "RWUBWUBWUBLWUB", "output": "R L " }, { "input": "ZJWUBWUBWUBJWUBWUBWUBL", "output": "ZJ J L " }, { "input": "CWUBBWUBWUBWUBEWUBWUBWUBQWUBWUBWUB", "output": "C B E Q " }, { "input": "WUBJKDWUBWUBWBIRAQKFWUBWUBYEWUBWUBWUBWVWUBWUB", "output": "JKD WBIRAQKF YE WV " }, { "input": "WUBKSDHEMIXUJWUBWUBRWUBWUBWUBSWUBWUBWUBHWUBWUBWUB", "output": "KSDHEMIXUJ R S H " }, { "input": "OGWUBWUBWUBXWUBWUBWUBIWUBWUBWUBKOWUBWUB", "output": "OG X I KO " }, { "input": "QWUBQQWUBWUBWUBIWUBWUBWWWUBWUBWUBJOPJPBRH", "output": "Q QQ I WW JOPJPBRH " }, { "input": "VSRNVEATZTLGQRFEGBFPWUBWUBWUBAJWUBWUBWUBPQCHNWUBCWUB", "output": "VSRNVEATZTLGQRFEGBFP AJ PQCHN C " }, { "input": "WUBWUBEWUBWUBWUBIQMJNIQWUBWUBWUBGZZBQZAUHYPWUBWUBWUBPMRWUBWUBWUBDCV", "output": "E IQMJNIQ GZZBQZAUHYP PMR DCV " }, { "input": "WUBWUBWUBFVWUBWUBWUBBPSWUBWUBWUBRXNETCJWUBWUBWUBJDMBHWUBWUBWUBBWUBWUBVWUBWUBB", "output": "FV BPS RXNETCJ JDMBH B V B " }, { "input": "WUBWUBWUBFBQWUBWUBWUBIDFSYWUBWUBWUBCTWDMWUBWUBWUBSXOWUBWUBWUBQIWUBWUBWUBL", "output": "FBQ IDFSY CTWDM SXO QI L " }, { "input": "IWUBWUBQLHDWUBYIIKZDFQWUBWUBWUBCXWUBWUBUWUBWUBWUBKWUBWUBWUBNL", "output": "I QLHD YIIKZDFQ CX U K NL " }, { "input": "KWUBUPDYXGOKUWUBWUBWUBAGOAHWUBIZDWUBWUBWUBIYWUBWUBWUBVWUBWUBWUBPWUBWUBWUBE", "output": "K UPDYXGOKU AGOAH IZD IY V P E " }, { "input": "WUBWUBOWUBWUBWUBIPVCQAFWYWUBWUBWUBQWUBWUBWUBXHDKCPYKCTWWYWUBWUBWUBVWUBWUBWUBFZWUBWUB", "output": "O IPVCQAFWY Q XHDKCPYKCTWWY V FZ " }, { "input": "PAMJGYWUBWUBWUBXGPQMWUBWUBWUBTKGSXUYWUBWUBWUBEWUBWUBWUBNWUBWUBWUBHWUBWUBWUBEWUBWUB", "output": "PAMJGY XGPQM TKGSXUY E N H E " }, { "input": "WUBYYRTSMNWUWUBWUBWUBCWUBWUBWUBCWUBWUBWUBFSYUINDWOBVWUBWUBWUBFWUBWUBWUBAUWUBWUBWUBVWUBWUBWUBJB", "output": "YYRTSMNWU C C FSYUINDWOBV F AU V JB " }, { "input": "WUBWUBYGPYEYBNRTFKOQCWUBWUBWUBUYGRTQEGWLFYWUBWUBWUBFVWUBHPWUBWUBWUBXZQWUBWUBWUBZDWUBWUBWUBM", "output": "YGPYEYBNRTFKOQC UYGRTQEGWLFY FV HP XZQ ZD M " }, { "input": "WUBZVMJWUBWUBWUBFOIMJQWKNZUBOFOFYCCWUBWUBWUBAUWWUBRDRADWUBWUBWUBCHQVWUBWUBWUBKFTWUBWUBWUBW", "output": "ZVMJ FOIMJQWKNZUBOFOFYCC AUW RDRAD CHQV KFT W " }, { "input": "WUBWUBZBKOKHQLGKRVIMZQMQNRWUBWUBWUBDACWUBWUBNZHFJMPEYKRVSWUBWUBWUBPPHGAVVPRZWUBWUBWUBQWUBWUBAWUBG", "output": "ZBKOKHQLGKRVIMZQMQNR DAC NZHFJMPEYKRVS PPHGAVVPRZ Q A G " }, { "input": "WUBWUBJWUBWUBWUBNFLWUBWUBWUBGECAWUBYFKBYJWTGBYHVSSNTINKWSINWSMAWUBWUBWUBFWUBWUBWUBOVWUBWUBLPWUBWUBWUBN", "output": "J NFL GECA YFKBYJWTGBYHVSSNTINKWSINWSMA F OV LP N " }, { "input": "WUBWUBLCWUBWUBWUBZGEQUEATJVIXETVTWUBWUBWUBEXMGWUBWUBWUBRSWUBWUBWUBVWUBWUBWUBTAWUBWUBWUBCWUBWUBWUBQG", "output": "LC ZGEQUEATJVIXETVT EXMG RS V TA C QG " }, { "input": "WUBMPWUBWUBWUBORWUBWUBDLGKWUBWUBWUBVVZQCAAKVJTIKWUBWUBWUBTJLUBZJCILQDIFVZWUBWUBYXWUBWUBWUBQWUBWUBWUBLWUB", "output": "MP OR DLGK VVZQCAAKVJTIK TJLUBZJCILQDIFVZ YX Q L " }, { "input": "WUBNXOLIBKEGXNWUBWUBWUBUWUBGITCNMDQFUAOVLWUBWUBWUBAIJDJZJHFMPVTPOXHPWUBWUBWUBISCIOWUBWUBWUBGWUBWUBWUBUWUB", "output": "NXOLIBKEGXN U GITCNMDQFUAOVL AIJDJZJHFMPVTPOXHP ISCIO G U " }, { "input": "WUBWUBNMMWCZOLYPNBELIYVDNHJUNINWUBWUBWUBDXLHYOWUBWUBWUBOJXUWUBWUBWUBRFHTGJCEFHCGWARGWUBWUBWUBJKWUBWUBSJWUBWUB", "output": "NMMWCZOLYPNBELIYVDNHJUNIN DXLHYO OJXU RFHTGJCEFHCGWARG JK SJ " }, { "input": "SGWLYSAUJOJBNOXNWUBWUBWUBBOSSFWKXPDPDCQEWUBWUBWUBDIRZINODWUBWUBWUBWWUBWUBWUBPPHWUBWUBWUBRWUBWUBWUBQWUBWUBWUBJWUB", "output": "SGWLYSAUJOJBNOXN BOSSFWKXPDPDCQE DIRZINOD W PPH R Q J " }, { "input": "TOWUBWUBWUBGBTBNWUBWUBWUBJVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSAWUBWUBWUBSWUBWUBWUBTOLVXWUBWUBWUBNHWUBWUBWUBO", "output": "TO GBTBN JVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSA S TOLVX NH O " }, { "input": "WUBWUBWSPLAYSZSAUDSWUBWUBWUBUWUBWUBWUBKRWUBWUBWUBRSOKQMZFIYZQUWUBWUBWUBELSHUWUBWUBWUBUKHWUBWUBWUBQXEUHQWUBWUBWUBBWUBWUBWUBR", "output": "WSPLAYSZSAUDS U KR RSOKQMZFIYZQU ELSHU UKH QXEUHQ B R " }, { "input": "WUBXEMWWVUHLSUUGRWUBWUBWUBAWUBXEGILZUNKWUBWUBWUBJDHHKSWUBWUBWUBDTSUYSJHWUBWUBWUBPXFWUBMOHNJWUBWUBWUBZFXVMDWUBWUBWUBZMWUBWUB", "output": "XEMWWVUHLSUUGR A XEGILZUNK JDHHKS DTSUYSJH PXF MOHNJ ZFXVMD ZM " }, { "input": "BMBWUBWUBWUBOQKWUBWUBWUBPITCIHXHCKLRQRUGXJWUBWUBWUBVWUBWUBWUBJCWUBWUBWUBQJPWUBWUBWUBBWUBWUBWUBBMYGIZOOXWUBWUBWUBTAGWUBWUBHWUB", "output": "BMB OQK PITCIHXHCKLRQRUGXJ V JC QJP B BMYGIZOOX TAG H " }, { "input": "CBZNWUBWUBWUBNHWUBWUBWUBYQSYWUBWUBWUBMWUBWUBWUBXRHBTMWUBWUBWUBPCRCWUBWUBWUBTZUYLYOWUBWUBWUBCYGCWUBWUBWUBCLJWUBWUBWUBSWUBWUBWUB", "output": "CBZN NH YQSY M XRHBTM PCRC TZUYLYO CYGC CLJ S " }, { "input": "DPDWUBWUBWUBEUQKWPUHLTLNXHAEKGWUBRRFYCAYZFJDCJLXBAWUBWUBWUBHJWUBOJWUBWUBWUBNHBJEYFWUBWUBWUBRWUBWUBWUBSWUBWWUBWUBWUBXDWUBWUBWUBJWUB", "output": "DPD EUQKWPUHLTLNXHAEKG RRFYCAYZFJDCJLXBA HJ OJ NHBJEYF R S W XD J " }, { "input": "WUBWUBWUBISERPQITVIYERSCNWUBWUBWUBQWUBWUBWUBDGSDIPWUBWUBWUBCAHKDZWEXBIBJVVSKKVQJWUBWUBWUBKIWUBWUBWUBCWUBWUBWUBAWUBWUBWUBPWUBWUBWUBHWUBWUBWUBF", "output": "ISERPQITVIYERSCN Q DGSDIP CAHKDZWEXBIBJVVSKKVQJ KI C A P H F " }, { "input": "WUBWUBWUBIWUBWUBLIKNQVWUBWUBWUBPWUBWUBWUBHWUBWUBWUBMWUBWUBWUBDPRSWUBWUBWUBBSAGYLQEENWXXVWUBWUBWUBXMHOWUBWUBWUBUWUBWUBWUBYRYWUBWUBWUBCWUBWUBWUBY", "output": "I LIKNQV P H M DPRS BSAGYLQEENWXXV XMHO U YRY C Y " }, { "input": "WUBWUBWUBMWUBWUBWUBQWUBWUBWUBITCFEYEWUBWUBWUBHEUWGNDFNZGWKLJWUBWUBWUBMZPWUBWUBWUBUWUBWUBWUBBWUBWUBWUBDTJWUBHZVIWUBWUBWUBPWUBFNHHWUBWUBWUBVTOWUB", "output": "M Q ITCFEYE HEUWGNDFNZGWKLJ MZP U B DTJ HZVI P FNHH VTO " }, { "input": "WUBWUBNDNRFHYJAAUULLHRRDEDHYFSRXJWUBWUBWUBMUJVDTIRSGYZAVWKRGIFWUBWUBWUBHMZWUBWUBWUBVAIWUBWUBWUBDDKJXPZRGWUBWUBWUBSGXWUBWUBWUBIFKWUBWUBWUBUWUBWUBWUBW", "output": "NDNRFHYJAAUULLHRRDEDHYFSRXJ MUJVDTIRSGYZAVWKRGIF HMZ VAI DDKJXPZRG SGX IFK U W " }, { "input": "WUBOJMWRSLAXXHQRTPMJNCMPGWUBWUBWUBNYGMZIXNLAKSQYWDWUBWUBWUBXNIWUBWUBWUBFWUBWUBWUBXMBWUBWUBWUBIWUBWUBWUBINWUBWUBWUBWDWUBWUBWUBDDWUBWUBWUBD", "output": "OJMWRSLAXXHQRTPMJNCMPG NYGMZIXNLAKSQYWD XNI F XMB I IN WD DD D " }, { "input": "WUBWUBWUBREHMWUBWUBWUBXWUBWUBWUBQASNWUBWUBWUBNLSMHLCMTICWUBWUBWUBVAWUBWUBWUBHNWUBWUBWUBNWUBWUBWUBUEXLSFOEULBWUBWUBWUBXWUBWUBWUBJWUBWUBWUBQWUBWUBWUBAWUBWUB", "output": "REHM X QASN NLSMHLCMTIC VA HN N UEXLSFOEULB X J Q A " }, { "input": "WUBWUBWUBSTEZTZEFFIWUBWUBWUBSWUBWUBWUBCWUBFWUBHRJPVWUBWUBWUBDYJUWUBWUBWUBPWYDKCWUBWUBWUBCWUBWUBWUBUUEOGCVHHBWUBWUBWUBEXLWUBWUBWUBVCYWUBWUBWUBMWUBWUBWUBYWUB", "output": "STEZTZEFFI S C F HRJPV DYJU PWYDKC C UUEOGCVHHB EXL VCY M Y " }, { "input": "WPPNMSQOQIWUBWUBWUBPNQXWUBWUBWUBHWUBWUBWUBNFLWUBWUBWUBGWSGAHVJFNUWUBWUBWUBFWUBWUBWUBWCMLRICFSCQQQTNBWUBWUBWUBSWUBWUBWUBKGWUBWUBWUBCWUBWUBWUBBMWUBWUBWUBRWUBWUB", "output": "WPPNMSQOQI PNQX H NFL GWSGAHVJFNU F WCMLRICFSCQQQTNB S KG C BM R " }, { "input": "YZJOOYITZRARKVFYWUBWUBRZQGWUBWUBWUBUOQWUBWUBWUBIWUBWUBWUBNKVDTBOLETKZISTWUBWUBWUBWLWUBQQFMMGSONZMAWUBZWUBWUBWUBQZUXGCWUBWUBWUBIRZWUBWUBWUBLTTVTLCWUBWUBWUBY", "output": "YZJOOYITZRARKVFY RZQG UOQ I NKVDTBOLETKZIST WL QQFMMGSONZMA Z QZUXGC IRZ LTTVTLC Y " }, { "input": "WUBCAXNCKFBVZLGCBWCOAWVWOFKZVQYLVTWUBWUBWUBNLGWUBWUBWUBAMGDZBDHZMRMQMDLIRMIWUBWUBWUBGAJSHTBSWUBWUBWUBCXWUBWUBWUBYWUBZLXAWWUBWUBWUBOHWUBWUBWUBZWUBWUBWUBGBWUBWUBWUBE", "output": "CAXNCKFBVZLGCBWCOAWVWOFKZVQYLVT NLG AMGDZBDHZMRMQMDLIRMI GAJSHTBS CX Y ZLXAW OH Z GB E " }, { "input": "WUBWUBCHXSOWTSQWUBWUBWUBCYUZBPBWUBWUBWUBSGWUBWUBWKWORLRRLQYUUFDNWUBWUBWUBYYGOJNEVEMWUBWUBWUBRWUBWUBWUBQWUBWUBWUBIHCKWUBWUBWUBKTWUBWUBWUBRGSNTGGWUBWUBWUBXCXWUBWUBWUBS", "output": "CHXSOWTSQ CYUZBPB SG WKWORLRRLQYUUFDN YYGOJNEVEM R Q IHCK KT RGSNTGG XCX S " }, { "input": "WUBWUBWUBHJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQWUBWUBWUBXTZKGIITWUBWUBWUBAWUBWUBWUBVNCXPUBCQWUBWUBWUBIDPNAWUBWUBWUBOWUBWUBWUBYGFWUBWUBWUBMQOWUBWUBWUBKWUBWUBWUBAZVWUBWUBWUBEP", "output": "HJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQ XTZKGIIT A VNCXPUBCQ IDPNA O YGF MQO K AZV EP " }, { "input": "WUBKYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTVWUBWUBWUBLRMIIWUBWUBWUBGWUBWUBWUBADPSWUBWUBWUBANBWUBWUBPCWUBWUBWUBPWUBWUBWUBGPVNLSWIRFORYGAABUXMWUBWUBWUBOWUBWUBWUBNWUBWUBWUBYWUBWUB", "output": "KYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTV LRMII G ADPS ANB PC P GPVNLSWIRFORYGAABUXM O N Y " }, { "input": "REWUBWUBWUBJDWUBWUBWUBNWUBWUBWUBTWWUBWUBWUBWZDOCKKWUBWUBWUBLDPOVBFRCFWUBWUBAKZIBQKEUAZEEWUBWUBWUBLQYPNPFWUBYEWUBWUBWUBFWUBWUBWUBBPWUBWUBWUBAWWUBWUBWUBQWUBWUBWUBBRWUBWUBWUBXJL", "output": "RE JD N TW WZDOCKK LDPOVBFRCF AKZIBQKEUAZEE LQYPNPF YE F BP AW Q BR XJL " }, { "input": "CUFGJDXGMWUBWUBWUBOMWUBWUBWUBSIEWUBWUBWUBJJWKNOWUBWUBWUBYBHVNRNORGYWUBWUBWUBOAGCAWUBWUBWUBSBLBKTPFKPBIWUBWUBWUBJBWUBWUBWUBRMFCJPGWUBWUBWUBDWUBWUBWUBOJOWUBWUBWUBZPWUBWUBWUBMWUBRWUBWUBWUBFXWWUBWUBWUBO", "output": "CUFGJDXGM OM SIE JJWKNO YBHVNRNORGY OAGCA SBLBKTPFKPBI JB RMFCJPG D OJO ZP M R FXW O " }, { "input": "WUBJZGAEXFMFEWMAKGQLUWUBWUBWUBICYTPQWGENELVYWANKUOJYWUBWUBWUBGWUBWUBWUBHYCJVLPHTUPNEGKCDGQWUBWUBWUBOFWUBWUBWUBCPGSOGZBRPRPVJJEWUBWUBWUBDQBCWUBWUBWUBHWUBWUBWUBMHOHYBMATWUBWUBWUBVWUBWUBWUBSWUBWUBWUBKOWU", "output": "JZGAEXFMFEWMAKGQLU ICYTPQWGENELVYWANKUOJY G HYCJVLPHTUPNEGKCDGQ OF CPGSOGZBRPRPVJJE DQBC H MHOHYBMAT V S KOWU " }, { "input": "A", "output": "A " }, { "input": "WUBA", "output": "A " }, { "input": "WUBWUBA", "output": "A " }, { "input": "AWUBWUBWUB", "output": "A " }, { "input": "AWUBBWUBCWUBD", "output": "A B C D " }, { "input": "WUBWWUBWUBWUBUWUBWUBBWUB", "output": "W U B " }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA " }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAWUBAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA " }, { "input": "WUWUBBWWUBUB", "output": "WU BW UB " }, { "input": "WUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUABWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUB", "output": "WUAB " }, { "input": "ZWUB", "output": "Z " }, { "input": "WU", "output": "WU " }, { "input": "UB", "output": "UB " }, { "input": "U", "output": "U " }, { "input": "WUBW", "output": "W " }, { "input": "WUBWU", "output": "WU " }, { "input": "WUWUB", "output": "WU " }, { "input": "UBWUB", "output": "UB " }, { "input": "WUWUBUBWUBUWUB", "output": "WU UB U " }, { "input": "WUBWWUBAWUB", "output": "W A " }, { "input": "WUUUUU", "output": "WUUUUU " } ]
1,674,575,455
2,147,483,647
Python 3
OK
TESTS
71
92
0
txt = input() txtsplit = txt.split("WUB") txtnew = '' for i in txtsplit: if i == '': continue txtnew += (i + ' ') print(txtnew)
Title: Dubstep Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them. Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club. For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX". Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song. Input Specification: The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word. Output Specification: Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space. Demo Input: ['WUBWUBABCWUB\n', 'WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n'] Demo Output: ['ABC ', 'WE ARE THE CHAMPIONS MY FRIEND '] Note: In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya. In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
```python txt = input() txtsplit = txt.split("WUB") txtnew = '' for i in txtsplit: if i == '': continue txtnew += (i + ' ') print(txtnew) ```
3
369
A
Valera and Plates
PROGRAMMING
900
[ "greedy", "implementation" ]
null
null
Valera is a lazy student. He has *m* clean bowls and *k* clean plates. Valera has made an eating plan for the next *n* days. As Valera is lazy, he will eat exactly one dish per day. At that, in order to eat a dish, he needs exactly one clean plate or bowl. We know that Valera can cook only two types of dishes. He can eat dishes of the first type from bowls and dishes of the second type from either bowls or plates. When Valera finishes eating, he leaves a dirty plate/bowl behind. His life philosophy doesn't let him eat from dirty kitchenware. So sometimes he needs to wash his plate/bowl before eating. Find the minimum number of times Valera will need to wash a plate/bowl, if he acts optimally.
The first line of the input contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=1000) — the number of the planned days, the number of clean bowls and the number of clean plates. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2). If *a**i* equals one, then on day *i* Valera will eat a first type dish. If *a**i* equals two, then on day *i* Valera will eat a second type dish.
Print a single integer — the minimum number of times Valera will need to wash a plate/bowl.
[ "3 1 1\n1 2 1\n", "4 3 1\n1 1 1 1\n", "3 1 2\n2 2 2\n", "8 2 2\n1 2 1 2 1 2 1 2\n" ]
[ "1\n", "1\n", "0\n", "4\n" ]
In the first sample Valera will wash a bowl only on the third day, so the answer is one. In the second sample, Valera will have the first type of the dish during all four days, and since there are only three bowls, he will wash a bowl exactly once. In the third sample, Valera will have the second type of dish for all three days, and as they can be eaten from either a plate or a bowl, he will never need to wash a plate/bowl.
500
[ { "input": "3 1 1\n1 2 1", "output": "1" }, { "input": "4 3 1\n1 1 1 1", "output": "1" }, { "input": "3 1 2\n2 2 2", "output": "0" }, { "input": "8 2 2\n1 2 1 2 1 2 1 2", "output": "4" }, { "input": "2 100 100\n2 2", "output": "0" }, { "input": "1 1 1\n2", "output": "0" }, { "input": "233 100 1\n2 2 1 1 1 2 2 2 2 1 1 2 2 2 1 2 2 1 1 1 2 2 1 1 1 1 2 1 2 2 1 1 2 2 1 2 2 1 2 1 2 1 2 2 2 1 1 1 1 2 1 2 1 1 2 1 1 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 2 2 2 1 1 2 2 1 1 1 1 2 1 1 2 1 2 2 2 1 1 1 2 2 2 1 1 1 1 2 1 2 1 1 1 1 2 2 2 1 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 2 1 1 1 2 2 1 1 2 1 2 1 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 1 2 2 1 1 1 2 2 1 1 2 2 1 1 2 1 1 2 2 1 2 2 2 2 2 2 1 2 2 2 2 2 1 1 2 2 2 2 2 2 1 1 1 2 1 2 2 2 2 2 2 2 2 1 1 2 1 2 1 2 2", "output": "132" }, { "input": "123 100 1\n2 2 2 1 1 2 2 2 2 1 1 2 2 2 1 2 2 2 2 1 2 2 2 1 1 1 2 2 2 2 1 2 2 2 2 2 2 1 2 1 2 1 2 2 2 1 2 1 2 2 1 2 2 1 2 2 1 2 2 1 2 2 2 1 1 1 1 1 1 1 1 1 2 2 2 2 2 1 1 2 2 1 1 1 1 2 1 2 2 1 2 2 2 1 1 1 2 2 2 1 2 2 2 2 1 2 2 2 2 1 2 2 2 1 1 2 1 2 1 2 1 1 1", "output": "22" }, { "input": "188 100 1\n2 2 1 1 1 2 2 2 2 1 1 2 2 2 1 2 2 1 1 1 2 2 1 1 1 1 2 1 2 2 1 1 2 2 1 2 2 1 2 1 2 1 2 2 2 1 1 1 1 2 1 2 1 1 2 1 1 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 2 2 2 1 1 2 2 1 1 1 1 2 1 1 2 1 2 2 2 1 1 1 2 2 2 1 1 1 1 2 1 2 1 1 1 1 2 2 2 1 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 2 1 1 1 2 2 1 1 2 1 2 1 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 1 2 2 1 1 1 2 2 1 1 2 2 1 1 2 1", "output": "87" }, { "input": "3 1 2\n1 1 1", "output": "2" }, { "input": "3 2 2\n1 1 1", "output": "1" }, { "input": "3 2 1\n1 1 1", "output": "1" }, { "input": "3 1 1\n1 1 1", "output": "2" }, { "input": "5 1 2\n2 2 2 2 2", "output": "2" }, { "input": "5 2 2\n2 2 2 2 2", "output": "1" }, { "input": "5 2 1\n2 2 2 2 2", "output": "2" }, { "input": "5 1 1\n2 2 2 2 2", "output": "3" }, { "input": "1 1 2\n2", "output": "0" }, { "input": "1 2 2\n2", "output": "0" }, { "input": "1 2 1\n2", "output": "0" }, { "input": "1 1 1\n2", "output": "0" }, { "input": "6 3 1\n1 1 2 2 2 2", "output": "2" }, { "input": "100 40 20\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "40" }, { "input": "7 5 2\n2 2 1 1 1 1 1", "output": "0" }, { "input": "10 4 4\n2 2 2 2 2 2 1 1 1 1", "output": "2" }, { "input": "3 2 1\n2 1 1", "output": "0" }, { "input": "7 6 1\n2 1 1 1 1 1 1", "output": "0" }, { "input": "7 5 1\n1 1 1 2 2 2 2", "output": "1" }, { "input": "5 3 1\n1 1 2 2 2", "output": "1" }, { "input": "3 1 1\n2 2 2", "output": "1" }, { "input": "5 2 2\n2 2 2 2 2", "output": "1" }, { "input": "3 1 3\n1 1 1", "output": "2" }, { "input": "5 2 1\n1 1 2 2 2", "output": "2" }, { "input": "4 3 2\n2 1 1 1", "output": "0" }, { "input": "4 2 1\n1 2 2 2", "output": "1" }, { "input": "14 4 7\n1 1 1 2 2 2 2 2 2 2 2 2 2 2", "output": "3" }, { "input": "12 10 4\n2 2 2 2 2 2 1 1 1 1 1 1", "output": "0" }, { "input": "5 3 2\n2 2 1 1 1", "output": "0" } ]
1,594,385,626
2,147,483,647
PyPy 3
OK
TESTS
63
155
20,172,800
l1 = [int(x) for x in input().split()] l2 = [int(x) for x in input().split()] bowls = l1[1] plates = l1[2] first = l2.count(1) second = l2.count(2) bfirst = max(0,first-bowls) bowls = max(0,bowls-first) bsecond = max(0,second-plates-bowls) print(bfirst+bsecond)
Title: Valera and Plates Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera is a lazy student. He has *m* clean bowls and *k* clean plates. Valera has made an eating plan for the next *n* days. As Valera is lazy, he will eat exactly one dish per day. At that, in order to eat a dish, he needs exactly one clean plate or bowl. We know that Valera can cook only two types of dishes. He can eat dishes of the first type from bowls and dishes of the second type from either bowls or plates. When Valera finishes eating, he leaves a dirty plate/bowl behind. His life philosophy doesn't let him eat from dirty kitchenware. So sometimes he needs to wash his plate/bowl before eating. Find the minimum number of times Valera will need to wash a plate/bowl, if he acts optimally. Input Specification: The first line of the input contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=1000) — the number of the planned days, the number of clean bowls and the number of clean plates. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2). If *a**i* equals one, then on day *i* Valera will eat a first type dish. If *a**i* equals two, then on day *i* Valera will eat a second type dish. Output Specification: Print a single integer — the minimum number of times Valera will need to wash a plate/bowl. Demo Input: ['3 1 1\n1 2 1\n', '4 3 1\n1 1 1 1\n', '3 1 2\n2 2 2\n', '8 2 2\n1 2 1 2 1 2 1 2\n'] Demo Output: ['1\n', '1\n', '0\n', '4\n'] Note: In the first sample Valera will wash a bowl only on the third day, so the answer is one. In the second sample, Valera will have the first type of the dish during all four days, and since there are only three bowls, he will wash a bowl exactly once. In the third sample, Valera will have the second type of dish for all three days, and as they can be eaten from either a plate or a bowl, he will never need to wash a plate/bowl.
```python l1 = [int(x) for x in input().split()] l2 = [int(x) for x in input().split()] bowls = l1[1] plates = l1[2] first = l2.count(1) second = l2.count(2) bfirst = max(0,first-bowls) bowls = max(0,bowls-first) bsecond = max(0,second-plates-bowls) print(bfirst+bsecond) ```
3
432
A
Choosing Teams
PROGRAMMING
800
[ "greedy", "implementation", "sortings" ]
null
null
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times. The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
Print a single number — the answer to the problem.
[ "5 2\n0 4 5 1 0\n", "6 4\n0 1 2 3 4 5\n", "6 5\n0 0 0 0 0 0\n" ]
[ "1\n", "0\n", "2\n" ]
In the first sample only one team could be made: the first, the fourth and the fifth participants. In the second sample no teams could be created. In the third sample two teams could be created. Any partition into two teams fits.
500
[ { "input": "5 2\n0 4 5 1 0", "output": "1" }, { "input": "6 4\n0 1 2 3 4 5", "output": "0" }, { "input": "6 5\n0 0 0 0 0 0", "output": "2" }, { "input": "3 4\n0 1 0", "output": "1" }, { "input": "3 4\n0 2 0", "output": "0" }, { "input": "6 5\n0 0 0 0 0 0", "output": "2" }, { "input": "12 2\n0 1 2 3 4 0 1 2 3 4 0 1", "output": "3" }, { "input": "15 2\n0 1 2 3 4 0 1 2 3 4 0 1 2 3 4", "output": "4" }, { "input": "13 1\n5 0 5 0 1 5 0 4 1 1 1 4 1", "output": "3" }, { "input": "20 1\n5 0 4 2 2 3 2 1 2 4 1 3 5 5 5 4 4 1 3 0", "output": "5" }, { "input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4", "output": "4" }, { "input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4", "output": "4" }, { "input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4", "output": "4" }, { "input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4", "output": "4" }, { "input": "6 3\n4 4 4 4 4 4", "output": "0" }, { "input": "1 4\n1", "output": "0" }, { "input": "1 1\n0", "output": "0" }, { "input": "2 3\n0 0", "output": "0" } ]
1,696,511,113
2,147,483,647
PyPy 3-64
OK
TESTS
35
62
1,740,800
def solve(): n, k = map(int, input().split()) l = [int(i) for i in input().split()] ans = 0 for i in l: ans += i+k <= 5 print(ans//3) # t = int(input()) t = 1 while t: solve() t -= 1
Title: Choosing Teams Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times. The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times? Input Specification: The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship. Output Specification: Print a single number — the answer to the problem. Demo Input: ['5 2\n0 4 5 1 0\n', '6 4\n0 1 2 3 4 5\n', '6 5\n0 0 0 0 0 0\n'] Demo Output: ['1\n', '0\n', '2\n'] Note: In the first sample only one team could be made: the first, the fourth and the fifth participants. In the second sample no teams could be created. In the third sample two teams could be created. Any partition into two teams fits.
```python def solve(): n, k = map(int, input().split()) l = [int(i) for i in input().split()] ans = 0 for i in l: ans += i+k <= 5 print(ans//3) # t = int(input()) t = 1 while t: solve() t -= 1 ```
3
705
A
Hulk
PROGRAMMING
800
[ "implementation" ]
null
null
Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings. Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on... For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on. Please help Dr. Banner.
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate.
Print Dr.Banner's feeling in one line.
[ "1\n", "2\n", "3\n" ]
[ "I hate it\n", "I hate that I love it\n", "I hate that I love that I hate it\n" ]
none
500
[ { "input": "1", "output": "I hate it" }, { "input": "2", "output": "I hate that I love it" }, { "input": "3", "output": "I hate that I love that I hate it" }, { "input": "4", "output": "I hate that I love that I hate that I love it" }, { "input": "5", "output": "I hate that I love that I hate that I love that I hate it" }, { "input": "10", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it" }, { "input": "18", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it" }, { "input": "19", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it" }, { "input": "76", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "77", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "81", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "82", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "85", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "86", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "100", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "99", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "98", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "33", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it" }, { "input": "34", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it" }, { "input": "57", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "100", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." } ]
1,700,228,474
2,147,483,647
Python 3
OK
TESTS
21
31
0
n=int(input("")) s="" if n==1: s+="I hate it" else: for i in range(n): i=i+1 if i+1 > n: if n%2 == 0: s += "I love it" else: s += "I hate it" else: if i%2 == 0: s += "I love that " else: s += "I hate that " print(s)
Title: Hulk Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings. Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on... For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on. Please help Dr. Banner. Input Specification: The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate. Output Specification: Print Dr.Banner's feeling in one line. Demo Input: ['1\n', '2\n', '3\n'] Demo Output: ['I hate it\n', 'I hate that I love it\n', 'I hate that I love that I hate it\n'] Note: none
```python n=int(input("")) s="" if n==1: s+="I hate it" else: for i in range(n): i=i+1 if i+1 > n: if n%2 == 0: s += "I love it" else: s += "I hate it" else: if i%2 == 0: s += "I love that " else: s += "I hate that " print(s) ```
3
614
B
Gena's Code
PROGRAMMING
1,400
[ "implementation", "math" ]
null
null
It's the year 4527 and the tanks game that we all know and love still exists. There also exists Great Gena's code, written in 2016. The problem this code solves is: given the number of tanks that go into the battle from each country, find their product. If it is turns to be too large, then the servers might have not enough time to assign tanks into teams and the whole game will collapse! There are exactly *n* distinct countries in the world and the *i*-th country added *a**i* tanks to the game. As the developers of the game are perfectionists, the number of tanks from each country is beautiful. A beautiful number, according to the developers, is such number that its decimal representation consists only of digits '1' and '0', moreover it contains at most one digit '1'. However, due to complaints from players, some number of tanks of one country was removed from the game, hence the number of tanks of this country may not remain beautiful. Your task is to write the program that solves exactly the same problem in order to verify Gena's code correctness. Just in case.
The first line of the input contains the number of countries *n* (1<=≤<=*n*<=≤<=100<=000). The second line contains *n* non-negative integers *a**i* without leading zeroes — the number of tanks of the *i*-th country. It is guaranteed that the second line contains at least *n*<=-<=1 beautiful numbers and the total length of all these number's representations doesn't exceed 100<=000.
Print a single number without leading zeroes — the product of the number of tanks presented by each country.
[ "3\n5 10 1\n", "4\n1 1 10 11\n", "5\n0 3 1 100 1\n" ]
[ "50", "110", "0" ]
In sample 1 numbers 10 and 1 are beautiful, number 5 is not not. In sample 2 number 11 is not beautiful (contains two '1's), all others are beautiful. In sample 3 number 3 is not beautiful, all others are beautiful.
1,000
[ { "input": "3\n5 10 1", "output": "50" }, { "input": "4\n1 1 10 11", "output": "110" }, { "input": "5\n0 3 1 100 1", "output": "0" }, { "input": "40\n10 100 10 1 10 10 100 10 10 100 10 100 100 10 1824868942 100 100 1 10 100 100 10 100 100 10 100 10 1 10 100 100 100 10 1 10 1 10 10 100 100", "output": "1824868942000000000000000000000000000000000000000000000000000" }, { "input": "6\n1000000000000000000000000000000000000 6643573784 1000000000000000000000000000000000000 1000000000000000000000000000000000000 1000000000000000000000000000000000000 1000000000000000000000000000000000000", "output": "6643573784000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000" }, { "input": "1\n0", "output": "0" }, { "input": "1\n1", "output": "1" }, { "input": "1\n9", "output": "9" }, { "input": "2\n10 50", "output": "500" }, { "input": "3\n500 1 10", "output": "5000" } ]
1,685,963,495
2,147,483,647
PyPy 3-64
OK
TESTS
32
62
8,294,400
# https://codeforces.com/contest/614 import sys input = lambda: sys.stdin.readline().rstrip() # faster! n = int(input()) a = list(input().split()) f, z = "1", 0 for x in a: if x == "0": print(0) exit() else: i = len(x) - 1 while i >= 0 and x[i] == "0": i -= 1 z += 1 if i > 0 or (i == 0 and x[0] != "1"): f = x[:i + 1] print(str(f) + "0" * z)
Title: Gena's Code Time Limit: None seconds Memory Limit: None megabytes Problem Description: It's the year 4527 and the tanks game that we all know and love still exists. There also exists Great Gena's code, written in 2016. The problem this code solves is: given the number of tanks that go into the battle from each country, find their product. If it is turns to be too large, then the servers might have not enough time to assign tanks into teams and the whole game will collapse! There are exactly *n* distinct countries in the world and the *i*-th country added *a**i* tanks to the game. As the developers of the game are perfectionists, the number of tanks from each country is beautiful. A beautiful number, according to the developers, is such number that its decimal representation consists only of digits '1' and '0', moreover it contains at most one digit '1'. However, due to complaints from players, some number of tanks of one country was removed from the game, hence the number of tanks of this country may not remain beautiful. Your task is to write the program that solves exactly the same problem in order to verify Gena's code correctness. Just in case. Input Specification: The first line of the input contains the number of countries *n* (1<=≤<=*n*<=≤<=100<=000). The second line contains *n* non-negative integers *a**i* without leading zeroes — the number of tanks of the *i*-th country. It is guaranteed that the second line contains at least *n*<=-<=1 beautiful numbers and the total length of all these number's representations doesn't exceed 100<=000. Output Specification: Print a single number without leading zeroes — the product of the number of tanks presented by each country. Demo Input: ['3\n5 10 1\n', '4\n1 1 10 11\n', '5\n0 3 1 100 1\n'] Demo Output: ['50', '110', '0'] Note: In sample 1 numbers 10 and 1 are beautiful, number 5 is not not. In sample 2 number 11 is not beautiful (contains two '1's), all others are beautiful. In sample 3 number 3 is not beautiful, all others are beautiful.
```python # https://codeforces.com/contest/614 import sys input = lambda: sys.stdin.readline().rstrip() # faster! n = int(input()) a = list(input().split()) f, z = "1", 0 for x in a: if x == "0": print(0) exit() else: i = len(x) - 1 while i >= 0 and x[i] == "0": i -= 1 z += 1 if i > 0 or (i == 0 and x[0] != "1"): f = x[:i + 1] print(str(f) + "0" * z) ```
3
43
A
Football
PROGRAMMING
1,000
[ "strings" ]
A. Football
2
256
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
[ "1\nABC\n", "5\nA\nABA\nABA\nA\nA\n" ]
[ "ABC\n", "A\n" ]
none
500
[ { "input": "1\nABC", "output": "ABC" }, { "input": "5\nA\nABA\nABA\nA\nA", "output": "A" }, { "input": "2\nXTSJEP\nXTSJEP", "output": "XTSJEP" }, { "input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ", "output": "XZYDJAEDZ" }, { "input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD", "output": "QCCYXL" }, { "input": "3\nAZID\nEERWBC\nEERWBC", "output": "EERWBC" }, { "input": "3\nHNCGYL\nHNCGYL\nHNCGYL", "output": "HNCGYL" }, { "input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG", "output": "ZZWZTG" }, { "input": "4\nA\nA\nKUDLJMXCSE\nA", "output": "A" }, { "input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW", "output": "PHBTW" }, { "input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN", "output": "PKUZYTFYWN" }, { "input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH", "output": "HH" }, { "input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW", "output": "W" }, { "input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP", "output": "XBCP" }, { "input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS", "output": "PYPAS" }, { "input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC", "output": "NC" }, { "input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI", "output": "VOCI" }, { "input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA", "output": "HA" }, { "input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS", "output": "G" }, { "input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL", "output": "WL" } ]
1,598,454,435
2,147,483,647
Python 3
OK
TESTS
34
218
0
d = {} for _ in range(int(input())): a = input() if(a not in d): d[a] = 1 else: d[a] +=1 print(max(d,key=d.get))
Title: Football Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams. Output Specification: Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner. Demo Input: ['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n'] Demo Output: ['ABC\n', 'A\n'] Note: none
```python d = {} for _ in range(int(input())): a = input() if(a not in d): d[a] = 1 else: d[a] +=1 print(max(d,key=d.get)) ```
3.9455
32
B
Borze
PROGRAMMING
800
[ "expression parsing", "implementation" ]
B. Borze
2
256
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
Output the decoded ternary number. It can have leading zeroes.
[ ".-.--\n", "--.\n", "-..-.--\n" ]
[ "012", "20", "1012" ]
none
1,000
[ { "input": ".-.--", "output": "012" }, { "input": "--.", "output": "20" }, { "input": "-..-.--", "output": "1012" }, { "input": "---..", "output": "210" }, { "input": "..--.---..", "output": "0020210" }, { "input": "-.....----.", "output": "10000220" }, { "input": ".", "output": "0" }, { "input": "-.", "output": "1" }, { "input": "--", "output": "2" }, { "input": "..", "output": "00" }, { "input": "--.", "output": "20" }, { "input": ".--.", "output": "020" }, { "input": ".-.-..", "output": "0110" }, { "input": "----.-.", "output": "2201" }, { "input": "-..--.-.", "output": "10201" }, { "input": "..--..--.", "output": "0020020" }, { "input": "-.-.---.--..-..-.-.-..-..-.--.", "output": "112120010111010120" }, { "input": "---.-.-.------..-..-..-..-.-..-.--.-.-..-.-.-----..-.-.", "output": "21112220010101011012011011221011" }, { "input": "-.-..--.-.-.-.-.-..-.-.-.---------.--.---..--...--.-----.-.-.-...--.-.-.---.------.--..-.--.-----.-...-..------", "output": "11020111110111222212021020002022111100201121222020012022110010222" }, { "input": "-.-..-.--.---..---.-..---.-...-.-.----..-.---.-.---..-.--.---.-.-------.---.--....----.-.---.---.---.----.-----..---.-.-.-.-----.--.-------.-..", "output": "110120210211021100112200121121012021122212120000220121212122022102111122120222110" }, { "input": ".-..-.-.---.-----.--.---...-.--.-.-....-..", "output": "01011212212021001201100010" }, { "input": ".------.-.---..--...-..-..-.-.-.--.--.-..-.--...-.-.---.-.-.------..--..-.---..----.-..-.--.---.-.----.-.---...-.-.-.-----.-.-.---.---.-.....-.-...-----.-...-.---.-..-.-----.--...---.-.-..-.--.-.---..", "output": "022201210200010101112020101200011211122200200121022010120211220121001112211121211000011002211001211012212000211101201210" }, { "input": ".-.--.---.-----.-.-----.-.-..-----..-..----..--.-.--.----..---.---..-.-.-----..-------.----..----.-..---...-----..-..-----...-..-.-.-----....---..---..-.-----...-.--...--.-.---.-.-.-.-.-...---..----.", "output": "01202122112211102210102200201202200212101122102221220022010210022101022100101122100021021012210012000201211111100210220" }, { "input": "..-.-.-.---.-.-.-..-.-..-.-.---.-------.---..-----.---....-.---.--.--.-.---.---------.-..---.-.-.--..---.---.-.---.-.-..-.-..-.-.-.----.--.-....--------.-.---..----.------.-.-.--.--.-----.-----.----", "output": "0011121111011011212221210221210001212020121222211021112002121121110110111220201000222201210220222011202022122122" }, { "input": "-..-------.------.-..--.-.-..--.-.-..-----..-.-.-..-..-..--.---..-----..---..-..--.-..-.-.---...-.....-------.---.-----.-...-.-...-.-.---.---.-----.--.--...-.--..-.-..-...-.-.-.-.---..---.-..-.-.-.-..", "output": "102221222010201102011022101110101020210221021010201011210010000222121221100110011212122120200012001101001111210211011110" }, { "input": ".-.----.-.--..-.-.-.-..----..-.-...--.-.---.---.-------..-.--..-......--.------.--.----.--...-.--.--..-----..-.....--.--.-.-.------..--------.----------..-.---.----.---.-..--..-.....-..------.--.", "output": "012201200111102200110020121212221012001000002022202022020001202002210100002020112220022220222220012122021102001000010222020" }, { "input": "------.-----.-....--.-.----.-.---.-.-..---.-.---.-----..-...-.-.---..-.-.-..-.-.-...-.-.-.----..--.------.----.-..-.--...-.-------...-.-..-.-.--.--.---..--..--------.--.-.-.---.-.-.-...----.--..-.--..", "output": "222022110002012201211102112122101001121011101110011122002022202201012000122210011011202021020022220201121111002202001200" }, { "input": "-.---...----...--.--...-.--.----", "output": "121002200020200012022" }, { "input": "--.--.--.---.--.-.---.-.-..-..--.-..---.-.....-..---.-----.--...-.-.-------.-.--.-.----.-..-.------.", "output": "202020212012111010201021100001021221200011222112012201012220" } ]
1,651,751,889
2,147,483,647
Python 3
OK
TESTS
30
92
0
a=input() ans='' x=0 while x<len(a): if a[x]=='.': ans+='0' x+=1 elif a[x:x+2]=='-.': ans+='1' x+=2 else: ans+='2' x+=2 print(ans)
Title: Borze Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet. Input Specification: The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes). Output Specification: Output the decoded ternary number. It can have leading zeroes. Demo Input: ['.-.--\n', '--.\n', '-..-.--\n'] Demo Output: ['012', '20', '1012'] Note: none
```python a=input() ans='' x=0 while x<len(a): if a[x]=='.': ans+='0' x+=1 elif a[x:x+2]=='-.': ans+='1' x+=2 else: ans+='2' x+=2 print(ans) ```
3.977
197
B
Limit
PROGRAMMING
1,400
[ "math" ]
null
null
You are given two polynomials: - *P*(*x*)<==<=*a*0·*x**n*<=+<=*a*1·*x**n*<=-<=1<=+<=...<=+<=*a**n*<=-<=1·*x*<=+<=*a**n* and - *Q*(*x*)<==<=*b*0·*x**m*<=+<=*b*1·*x**m*<=-<=1<=+<=...<=+<=*b**m*<=-<=1·*x*<=+<=*b**m*. Calculate limit .
The first line contains two space-separated integers *n* and *m* (0<=≤<=*n*,<=*m*<=≤<=100) — degrees of polynomials *P*(*x*) and *Q*(*x*) correspondingly. The second line contains *n*<=+<=1 space-separated integers — the factors of polynomial *P*(*x*): *a*0, *a*1, ..., *a**n*<=-<=1, *a**n* (<=-<=100<=≤<=*a**i*<=≤<=100,<=*a*0<=≠<=0). The third line contains *m*<=+<=1 space-separated integers — the factors of polynomial *Q*(*x*): *b*0, *b*1, ..., *b**m*<=-<=1, *b**m* (<=-<=100<=≤<=*b**i*<=≤<=100,<=*b*0<=≠<=0).
If the limit equals <=+<=∞, print "Infinity" (without quotes). If the limit equals <=-<=∞, print "-Infinity" (without the quotes). If the value of the limit equals zero, print "0/1" (without the quotes). Otherwise, print an irreducible fraction — the value of limit , in the format "p/q" (without the quotes), where *p* is the — numerator, *q* (*q*<=&gt;<=0) is the denominator of the fraction.
[ "2 1\n1 1 1\n2 5\n", "1 0\n-1 3\n2\n", "0 1\n1\n1 0\n", "2 2\n2 1 6\n4 5 -7\n", "1 1\n9 0\n-5 2\n" ]
[ "Infinity\n", "-Infinity\n", "0/1\n", "1/2\n", "-9/5\n" ]
Let's consider all samples: 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c28febca257452afdfcbd6984ba8623911f9bdbc.png" style="max-width: 100.0%;max-height: 100.0%;"/> 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1e55ecd04e54a45e5e0092ec9a5c1ea03bb29255.png" style="max-width: 100.0%;max-height: 100.0%;"/> 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/2c95fb684d373fcc1a481cfabeda4d5c2f3673ee.png" style="max-width: 100.0%;max-height: 100.0%;"/> 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4dc40cb8b3cd6375c42445366e50369649a2801a.png" style="max-width: 100.0%;max-height: 100.0%;"/> 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c6455aba35cfb3c4397505121d1f77afcd17c98e.png" style="max-width: 100.0%;max-height: 100.0%;"/> You can learn more about the definition and properties of limits if you follow the link: http://en.wikipedia.org/wiki/Limit_of_a_function
500
[ { "input": "2 1\n1 1 1\n2 5", "output": "Infinity" }, { "input": "1 0\n-1 3\n2", "output": "-Infinity" }, { "input": "0 1\n1\n1 0", "output": "0/1" }, { "input": "2 2\n2 1 6\n4 5 -7", "output": "1/2" }, { "input": "1 1\n9 0\n-5 2", "output": "-9/5" }, { "input": "1 2\n5 3\n-3 2 -1", "output": "0/1" }, { "input": "1 2\n-4 8\n-2 5 -3", "output": "0/1" }, { "input": "3 2\n4 3 1 2\n-5 7 0", "output": "-Infinity" }, { "input": "2 1\n-3 5 1\n-8 0", "output": "Infinity" }, { "input": "1 1\n-5 7\n3 1", "output": "-5/3" }, { "input": "2 2\n-4 2 1\n-5 8 -19", "output": "4/5" }, { "input": "0 100\n1\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "0/1" }, { "input": "100 0\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100\n1", "output": "Infinity" }, { "input": "0 0\n36\n-54", "output": "-2/3" }, { "input": "0 0\n36\n-8", "output": "-9/2" }, { "input": "0 0\n-6\n-8", "output": "3/4" }, { "input": "0 2\n-3\n1 4 6", "output": "0/1" }, { "input": "0 0\n-21\n13", "output": "-21/13" }, { "input": "0 0\n-34\n21", "output": "-34/21" }, { "input": "0 0\n-55\n34", "output": "-55/34" }, { "input": "33 100\n-15 -90 -84 57 67 60 -40 -82 83 -80 43 -15 -36 -14 -37 -49 42 -79 49 -7 -12 53 -44 -21 87 -91 -73 -27 13 65 5 74 -21 -52\n-67 -17 36 -46 -5 31 -45 -35 -49 13 -7 -82 92 -55 -67 -96 31 -70 76 24 -29 26 96 19 -40 99 -26 74 -17 -56 -72 24 -71 -62 10 -56 -74 75 -48 -98 -67 -26 47 7 63 -38 99 66 -25 -31 -24 -42 -49 -27 -45 -2 -37 -16 5 -21 97 33 85 -33 93 30 84 73 -48 18 -36 71 -38 -41 28 1 -7 -15 60 59 -20 -38 -86 90 2 -12 72 -43 26 76 97 7 -2 -47 -4 100 -40 -48 53 -54 0", "output": "0/1" }, { "input": "39 87\n78 -50 18 -32 -12 -65 83 41 -6 53 -26 64 -19 -53 -61 91 -49 -66 67 69 100 -39 95 99 86 -67 -66 63 48 26 -4 95 -54 -71 26 -74 -93 79 -91 -45\n-18 23 48 59 76 82 95 2 -26 18 -39 -74 44 -92 40 -44 1 -97 -100 -63 -54 -3 -86 85 28 -50 41 -53 -74 -29 -91 87 27 -42 -90 -15 -26 -15 -100 -70 -10 -41 16 85 71 -39 -31 -65 80 98 9 23 -40 14 -88 15 -34 10 -67 -94 -58 -24 75 48 -42 56 -77 -13 -25 -79 -100 -57 89 45 22 85 78 -93 -79 69 63 44 74 94 35 -65 -12 -88", "output": "0/1" }, { "input": "47 56\n31 -99 -97 6 -45 -5 89 35 -77 69 57 91 -32 -66 -36 16 30 61 -36 32 48 67 5 -85 65 -11 -51 -63 -51 -16 39 -26 -60 -28 91 43 -90 32 44 83 70 -53 51 56 68 -81 76 79\n61 -21 -75 -36 -24 -19 80 26 -28 93 27 72 -39 -46 -38 68 -29 -16 -63 84 -13 64 55 63 77 5 68 70 15 99 12 -69 50 -48 -82 -3 52 -54 68 91 -37 -100 -5 74 24 91 -1 74 28 29 -87 -13 -88 82 -13 58 23", "output": "0/1" }, { "input": "9 100\n-34 88 33 -80 87 31 -53 -3 8 -70\n31 -25 46 78 8 82 -92 -36 -30 85 -93 86 -87 75 8 -71 44 -41 -83 19 89 -28 81 42 79 86 41 -23 64 -31 46 24 -79 23 71 63 99 90 -16 -70 -1 88 10 65 3 -99 95 52 -80 53 -24 -43 -30 -7 51 40 -47 44 -10 -18 -61 -67 -84 37 45 93 -5 68 32 3 -61 -100 38 -21 -91 90 83 -45 75 89 17 -44 75 14 -28 1 -84 -100 -36 84 -40 88 -84 -54 2 -32 92 -49 77 85 91", "output": "0/1" }, { "input": "28 87\n-77 49 37 46 -92 65 89 100 53 76 -43 47 -80 -46 -94 -4 20 46 81 -41 86 25 69 60 15 -78 -98 -7 -42\n-85 96 59 -40 90 -72 41 -17 -40 -15 -98 66 47 9 -33 -63 59 -25 -31 25 -94 35 28 -36 -41 -38 -38 -54 -40 90 7 -10 98 -19 54 -10 46 -58 -88 -21 90 82 37 -70 -98 -63 41 75 -50 -59 -69 79 -93 -3 -45 14 76 28 -28 -98 -44 -39 71 44 90 91 0 45 7 65 68 39 -27 58 68 -47 -41 100 14 -95 -80 69 -88 -51 -89 -70 -23 95", "output": "0/1" }, { "input": "100 4\n-5 -93 89 -26 -79 14 -28 13 -45 69 50 -84 21 -68 62 30 -26 99 -12 39 20 -74 -39 -41 -28 -72 -55 28 20 31 -92 -20 76 -65 57 72 -36 4 33 -28 -19 -41 -40 40 84 -36 -83 75 -74 -80 32 -50 -56 72 16 75 57 90 -19 -10 67 -71 69 -48 -48 23 37 -31 -64 -86 20 67 97 14 82 -41 2 87 65 -81 -27 9 -79 -1 -5 84 -8 29 -34 31 82 40 21 -53 -31 -45 17 -33 79 50 -94\n56 -4 -90 36 84", "output": "-Infinity" }, { "input": "77 51\n89 45 -33 -87 33 -61 -79 40 -76 16 -17 31 27 25 99 82 51 -40 85 -66 19 89 -62 24 -61 -53 -77 17 21 83 53 -18 -56 75 9 -78 33 -11 -6 96 -33 -2 -57 97 30 20 -41 42 -13 45 -99 67 37 -20 51 -33 88 -62 2 40 17 36 45 71 4 -44 24 20 -2 29 -12 -84 -7 -84 -38 48 -73 79\n60 -43 60 1 90 -1 19 -18 -21 31 -76 51 79 91 12 39 -33 -14 71 -90 -65 -93 -58 93 49 17 77 19 32 -8 14 58 -9 85 -95 -73 0 85 -91 -99 -30 -43 61 20 -89 93 53 20 -33 -38 79 54", "output": "Infinity" }, { "input": "84 54\n82 -54 28 68 74 -61 54 98 59 67 -65 -1 16 65 -78 -16 61 -79 2 14 44 96 -62 77 51 87 37 66 65 28 88 -99 -21 -83 24 80 39 64 -65 45 86 -53 -49 94 -75 -31 -42 -1 -35 -18 74 30 31 -40 30 -6 47 58 -71 -21 20 13 75 -79 15 -98 -26 76 99 -77 -9 85 48 51 -87 56 -53 37 47 -3 94 64 -7 74 86\n72 51 -74 20 41 -76 98 58 24 -61 -97 -73 62 29 6 42 -92 -6 -65 89 -32 -9 82 -13 -88 -70 -97 25 -48 12 -54 33 -92 -29 48 60 -21 86 -17 -86 45 -34 -3 -9 -62 12 25 -74 -76 -89 48 55 -30 86 51", "output": "Infinity" }, { "input": "73 15\n-70 78 51 -33 -95 46 87 -33 16 62 67 -85 -57 75 -93 -59 98 -45 -90 -88 9 53 35 37 28 3 40 -87 28 5 18 11 9 1 72 69 -65 -62 1 73 -3 3 35 17 -28 -31 -45 60 64 18 60 38 -47 12 2 -90 -4 33 -51 -55 -54 90 38 -65 39 32 -70 0 -5 3 -12 100 78 55\n46 33 41 52 -89 -9 53 -81 34 -45 -11 -41 14 -28 95 -50", "output": "-Infinity" }, { "input": "33 1\n-75 -83 87 -27 -48 47 -90 -84 -18 -4 14 -1 -83 -98 -68 -85 -86 28 2 45 96 -59 86 -25 -2 -64 -92 65 69 72 72 -58 -99 90\n-1 72", "output": "Infinity" }, { "input": "58 58\n-25 40 -34 23 -52 94 -30 -99 -71 -90 -44 -71 69 48 -45 -59 0 66 -70 -96 95 91 82 90 -95 87 3 -77 -77 -26 15 87 -82 5 -24 82 -11 99 35 49 22 44 18 -60 -26 79 67 71 -13 29 -23 9 58 -90 88 18 77 5 -7\n-30 -11 -13 -50 61 -78 11 -74 -73 13 -66 -65 -82 38 58 25 -64 -24 78 -87 6 6 -80 -96 47 -25 -54 10 -41 -22 -50 -1 -6 -22 27 54 -32 30 93 88 -70 -100 -69 -47 -20 -92 -24 70 -93 42 78 42 -35 41 31 75 -67 -62 -83", "output": "5/6" }, { "input": "20 20\n5 4 91 -66 -57 55 -79 -2 -54 -72 -49 21 -23 -5 57 -48 70 -16 -86 -26 -19\n51 -60 64 -8 89 27 -96 4 95 -24 -2 -27 -41 -14 -88 -19 24 68 -31 34 -62", "output": "5/51" }, { "input": "69 69\n-90 -63 -21 23 23 -14 -82 65 42 -60 -42 -39 67 34 96 93 -42 -24 21 -80 44 -81 45 -74 -19 -88 39 58 90 87 16 48 -19 -2 36 87 4 -66 -82 -49 -32 -43 -65 12 34 -29 -58 46 -67 -20 -30 91 21 65 15 2 3 -92 -67 -68 39 -24 77 76 -17 -34 5 63 88 83\n-55 98 -79 18 -100 -67 -79 -85 -75 -44 -6 -73 -11 -12 -24 -78 47 -51 25 -29 -34 25 27 11 -87 15 -44 41 -44 46 -67 70 -35 41 62 -36 27 -41 -42 -50 96 31 26 -66 9 74 34 31 25 6 -84 41 74 -7 49 5 35 -5 -71 -37 28 58 -8 -40 -19 -83 -34 64 7 15", "output": "18/11" }, { "input": "0 0\n46\n-33", "output": "-46/33" }, { "input": "67 67\n-8 11 55 80 -26 -38 58 73 -48 -10 35 75 16 -84 55 -51 98 58 -28 98 77 81 51 -86 -46 68 -87 -80 -49 81 96 -97 -42 25 6 -8 -55 -25 93 -29 -33 -6 -26 -85 73 97 63 57 51 92 -6 -8 4 86 46 -45 36 -19 -71 1 71 39 97 -44 -34 -1 2 -46\n91 -32 -76 11 -40 91 -8 -100 73 80 47 82 24 0 -71 82 -93 38 -54 1 -55 -53 90 -86 0 10 -35 49 90 56 25 17 46 -43 13 16 -82 -33 64 -83 -56 22 12 -74 4 -68 85 -27 60 -28 -47 73 -93 69 -37 54 -3 90 -56 56 78 61 7 -79 48 -42 -10 -48", "output": "-8/91" }, { "input": "69 69\n-7 38 -3 -22 65 -78 -65 -99 -76 63 0 -4 -78 -51 54 -61 -53 60 80 34 -96 99 -78 -96 21 -10 -86 33 -9 -81 -19 -2 -76 -3 -66 -80 -55 -21 -50 37 -86 -37 47 44 76 -39 54 -25 41 -86 -3 -25 -67 94 18 67 27 -5 -30 -69 2 -76 7 -97 -52 -35 -55 -20 92 2\n90 -94 37 41 -27 -54 96 -15 -60 -29 -75 -93 -57 62 48 -88 -99 -62 4 -9 85 33 65 -95 -30 16 -29 -89 -33 -83 -35 -21 53 -52 80 -40 76 -33 86 47 18 43 -67 -36 -99 -42 1 -94 -78 34 -41 73 96 2 -60 29 68 -96 -21 -61 -98 -67 1 40 85 55 66 -25 -50 -83", "output": "-7/90" }, { "input": "17 17\n-54 59 -95 87 3 -27 -30 49 -87 74 45 78 36 60 -95 41 -53 -70\n-27 16 -67 -24 10 -73 -41 12 -52 53 -73 -17 -56 -74 -33 -8 100 -39", "output": "2/1" }, { "input": "1 1\n36 -49\n-32 -40", "output": "-9/8" }, { "input": "1 1\n1 1\n1 1", "output": "1/1" }, { "input": "1 1\n-2 1\n4 1", "output": "-1/2" }, { "input": "0 0\n2\n1", "output": "2/1" }, { "input": "0 0\n4\n-3", "output": "-4/3" }, { "input": "0 0\n2\n2", "output": "1/1" }, { "input": "0 0\n17\n-10", "output": "-17/10" }, { "input": "0 0\n-1\n2", "output": "-1/2" }, { "input": "0 0\n1\n1", "output": "1/1" }, { "input": "0 0\n50\n20", "output": "5/2" }, { "input": "0 0\n20\n20", "output": "1/1" }, { "input": "0 0\n4\n-2", "output": "-2/1" }, { "input": "0 0\n4\n-6", "output": "-2/3" }, { "input": "0 0\n1\n-2", "output": "-1/2" }, { "input": "0 0\n4\n2", "output": "2/1" }, { "input": "0 0\n2\n-4", "output": "-1/2" }, { "input": "1 1\n4 1\n2 1", "output": "2/1" }, { "input": "2 2\n-13 1 3\n6 3 2", "output": "-13/6" }, { "input": "99 99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2", "output": "1/2" }, { "input": "0 0\n5\n5", "output": "1/1" }, { "input": "0 0\n2\n-1", "output": "-2/1" } ]
1,565,769,563
2,147,483,647
PyPy 3
OK
TESTS
80
654
7,372,800
from fractions import Fraction class CodeforcesTask197BSolution: def __init__(self): self.result = '' self.n_m = [] self.p_x = [] self.q_x = [] def read_input(self): self.n_m = [int(x) for x in input().split(" ")] self.p_x = [int(x) for x in input().split(" ")] self.q_x = [int(x) for x in input().split(" ")] def process_task(self): if self.n_m[0] > self.n_m[1]: if self.p_x[0] * self.q_x[0] > 0: self.result = "Infinity" else: self.result = "-Infinity" elif self.n_m[1] > self.n_m[0]: self.result = "0/1" else: result = Fraction(self.p_x[0], self.q_x[0]) self.result = "{0}/{1}".format(result.numerator, result.denominator) def get_result(self): return self.result if __name__ == "__main__": Solution = CodeforcesTask197BSolution() Solution.read_input() Solution.process_task() print(Solution.get_result())
Title: Limit Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given two polynomials: - *P*(*x*)<==<=*a*0·*x**n*<=+<=*a*1·*x**n*<=-<=1<=+<=...<=+<=*a**n*<=-<=1·*x*<=+<=*a**n* and - *Q*(*x*)<==<=*b*0·*x**m*<=+<=*b*1·*x**m*<=-<=1<=+<=...<=+<=*b**m*<=-<=1·*x*<=+<=*b**m*. Calculate limit . Input Specification: The first line contains two space-separated integers *n* and *m* (0<=≤<=*n*,<=*m*<=≤<=100) — degrees of polynomials *P*(*x*) and *Q*(*x*) correspondingly. The second line contains *n*<=+<=1 space-separated integers — the factors of polynomial *P*(*x*): *a*0, *a*1, ..., *a**n*<=-<=1, *a**n* (<=-<=100<=≤<=*a**i*<=≤<=100,<=*a*0<=≠<=0). The third line contains *m*<=+<=1 space-separated integers — the factors of polynomial *Q*(*x*): *b*0, *b*1, ..., *b**m*<=-<=1, *b**m* (<=-<=100<=≤<=*b**i*<=≤<=100,<=*b*0<=≠<=0). Output Specification: If the limit equals <=+<=∞, print "Infinity" (without quotes). If the limit equals <=-<=∞, print "-Infinity" (without the quotes). If the value of the limit equals zero, print "0/1" (without the quotes). Otherwise, print an irreducible fraction — the value of limit , in the format "p/q" (without the quotes), where *p* is the — numerator, *q* (*q*<=&gt;<=0) is the denominator of the fraction. Demo Input: ['2 1\n1 1 1\n2 5\n', '1 0\n-1 3\n2\n', '0 1\n1\n1 0\n', '2 2\n2 1 6\n4 5 -7\n', '1 1\n9 0\n-5 2\n'] Demo Output: ['Infinity\n', '-Infinity\n', '0/1\n', '1/2\n', '-9/5\n'] Note: Let's consider all samples: 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c28febca257452afdfcbd6984ba8623911f9bdbc.png" style="max-width: 100.0%;max-height: 100.0%;"/> 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1e55ecd04e54a45e5e0092ec9a5c1ea03bb29255.png" style="max-width: 100.0%;max-height: 100.0%;"/> 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/2c95fb684d373fcc1a481cfabeda4d5c2f3673ee.png" style="max-width: 100.0%;max-height: 100.0%;"/> 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4dc40cb8b3cd6375c42445366e50369649a2801a.png" style="max-width: 100.0%;max-height: 100.0%;"/> 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c6455aba35cfb3c4397505121d1f77afcd17c98e.png" style="max-width: 100.0%;max-height: 100.0%;"/> You can learn more about the definition and properties of limits if you follow the link: http://en.wikipedia.org/wiki/Limit_of_a_function
```python from fractions import Fraction class CodeforcesTask197BSolution: def __init__(self): self.result = '' self.n_m = [] self.p_x = [] self.q_x = [] def read_input(self): self.n_m = [int(x) for x in input().split(" ")] self.p_x = [int(x) for x in input().split(" ")] self.q_x = [int(x) for x in input().split(" ")] def process_task(self): if self.n_m[0] > self.n_m[1]: if self.p_x[0] * self.q_x[0] > 0: self.result = "Infinity" else: self.result = "-Infinity" elif self.n_m[1] > self.n_m[0]: self.result = "0/1" else: result = Fraction(self.p_x[0], self.q_x[0]) self.result = "{0}/{1}".format(result.numerator, result.denominator) def get_result(self): return self.result if __name__ == "__main__": Solution = CodeforcesTask197BSolution() Solution.read_input() Solution.process_task() print(Solution.get_result()) ```
3
985
C
Liebig's Barrels
PROGRAMMING
1,500
[ "greedy" ]
null
null
You have *m*<==<=*n*·*k* wooden staves. The *i*-th stave has length *a**i*. You have to assemble *n* barrels consisting of *k* staves each, you can use any *k* staves to construct a barrel. Each stave must belong to exactly one barrel. Let volume *v**j* of barrel *j* be equal to the length of the minimal stave in it. You want to assemble exactly *n* barrels with the maximal total sum of volumes. But you have to make them equal enough, so a difference between volumes of any pair of the resulting barrels must not exceed *l*, i.e. |*v**x*<=-<=*v**y*|<=≤<=*l* for any 1<=≤<=*x*<=≤<=*n* and 1<=≤<=*y*<=≤<=*n*. Print maximal total sum of volumes of equal enough barrels or 0 if it's impossible to satisfy the condition above.
The first line contains three space-separated integers *n*, *k* and *l* (1<=≤<=*n*,<=*k*<=≤<=105, 1<=≤<=*n*·*k*<=≤<=105, 0<=≤<=*l*<=≤<=109). The second line contains *m*<==<=*n*·*k* space-separated integers *a*1,<=*a*2,<=...,<=*a**m* (1<=≤<=*a**i*<=≤<=109) — lengths of staves.
Print single integer — maximal total sum of the volumes of barrels or 0 if it's impossible to construct exactly *n* barrels satisfying the condition |*v**x*<=-<=*v**y*|<=≤<=*l* for any 1<=≤<=*x*<=≤<=*n* and 1<=≤<=*y*<=≤<=*n*.
[ "4 2 1\n2 2 1 2 3 2 2 3\n", "2 1 0\n10 10\n", "1 2 1\n5 2\n", "3 2 1\n1 2 3 4 5 6\n" ]
[ "7\n", "20\n", "2\n", "0\n" ]
In the first example you can form the following barrels: [1, 2], [2, 2], [2, 3], [2, 3]. In the second example you can form the following barrels: [10], [10]. In the third example you can form the following barrels: [2, 5]. In the fourth example difference between volumes of barrels in any partition is at least 2 so it is impossible to make barrels equal enough.
0
[ { "input": "4 2 1\n2 2 1 2 3 2 2 3", "output": "7" }, { "input": "2 1 0\n10 10", "output": "20" }, { "input": "1 2 1\n5 2", "output": "2" }, { "input": "3 2 1\n1 2 3 4 5 6", "output": "0" }, { "input": "10 3 189\n267 697 667 4 52 128 85 616 142 344 413 660 962 194 618 329 266 593 558 447 89 983 964 716 32 890 267 164 654 71", "output": "0" }, { "input": "10 3 453\n277 706 727 812 692 686 196 507 911 40 498 704 573 381 463 759 704 381 693 640 326 405 47 834 962 521 463 740 520 494", "output": "2979" }, { "input": "10 3 795\n398 962 417 307 760 534 536 450 421 280 608 111 687 726 941 903 630 900 555 403 795 122 814 188 234 976 679 539 525 104", "output": "5045" }, { "input": "6 2 29\n1 2 3 3 4 5 5 6 7 7 8 9", "output": "28" }, { "input": "2 1 2\n1 2", "output": "3" } ]
1,527,000,972
2,147,483,647
Python 3
OK
TESTS
50
218
8,089,600
[n,k,l] = [int(x) for x in input().split()] a = [int(x) for x in input().split()] import bisect s = 0 a = sorted(a) b = bisect.bisect_right(a,a[0]+l) a1 = a[:b] tot = n * k av = tot - b if b >= n: for i in range(b-1,b-n-1,-1): m = a1.pop() for j in range(0,k-1): if av > 0: av = av - 1 else: m = a1.pop() s = s + m print(s) else: print(0)
Title: Liebig's Barrels Time Limit: None seconds Memory Limit: None megabytes Problem Description: You have *m*<==<=*n*·*k* wooden staves. The *i*-th stave has length *a**i*. You have to assemble *n* barrels consisting of *k* staves each, you can use any *k* staves to construct a barrel. Each stave must belong to exactly one barrel. Let volume *v**j* of barrel *j* be equal to the length of the minimal stave in it. You want to assemble exactly *n* barrels with the maximal total sum of volumes. But you have to make them equal enough, so a difference between volumes of any pair of the resulting barrels must not exceed *l*, i.e. |*v**x*<=-<=*v**y*|<=≤<=*l* for any 1<=≤<=*x*<=≤<=*n* and 1<=≤<=*y*<=≤<=*n*. Print maximal total sum of volumes of equal enough barrels or 0 if it's impossible to satisfy the condition above. Input Specification: The first line contains three space-separated integers *n*, *k* and *l* (1<=≤<=*n*,<=*k*<=≤<=105, 1<=≤<=*n*·*k*<=≤<=105, 0<=≤<=*l*<=≤<=109). The second line contains *m*<==<=*n*·*k* space-separated integers *a*1,<=*a*2,<=...,<=*a**m* (1<=≤<=*a**i*<=≤<=109) — lengths of staves. Output Specification: Print single integer — maximal total sum of the volumes of barrels or 0 if it's impossible to construct exactly *n* barrels satisfying the condition |*v**x*<=-<=*v**y*|<=≤<=*l* for any 1<=≤<=*x*<=≤<=*n* and 1<=≤<=*y*<=≤<=*n*. Demo Input: ['4 2 1\n2 2 1 2 3 2 2 3\n', '2 1 0\n10 10\n', '1 2 1\n5 2\n', '3 2 1\n1 2 3 4 5 6\n'] Demo Output: ['7\n', '20\n', '2\n', '0\n'] Note: In the first example you can form the following barrels: [1, 2], [2, 2], [2, 3], [2, 3]. In the second example you can form the following barrels: [10], [10]. In the third example you can form the following barrels: [2, 5]. In the fourth example difference between volumes of barrels in any partition is at least 2 so it is impossible to make barrels equal enough.
```python [n,k,l] = [int(x) for x in input().split()] a = [int(x) for x in input().split()] import bisect s = 0 a = sorted(a) b = bisect.bisect_right(a,a[0]+l) a1 = a[:b] tot = n * k av = tot - b if b >= n: for i in range(b-1,b-n-1,-1): m = a1.pop() for j in range(0,k-1): if av > 0: av = av - 1 else: m = a1.pop() s = s + m print(s) else: print(0) ```
3
750
A
New Year and Hurry
PROGRAMMING
800
[ "binary search", "brute force", "implementation", "math" ]
null
null
Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5·*i* minutes to solve the *i*-th problem. Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first. How many problems can Limak solve if he wants to make it to the party?
The only line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=10, 1<=≤<=*k*<=≤<=240) — the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house.
Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier.
[ "3 222\n", "4 190\n", "7 1\n" ]
[ "2\n", "4\n", "7\n" ]
In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5 + 10 = 15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2. In the second sample, Limak can solve all 4 problems in 5 + 10 + 15 + 20 = 50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight. In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems.
500
[ { "input": "3 222", "output": "2" }, { "input": "4 190", "output": "4" }, { "input": "7 1", "output": "7" }, { "input": "10 135", "output": "6" }, { "input": "10 136", "output": "5" }, { "input": "1 1", "output": "1" }, { "input": "1 240", "output": "0" }, { "input": "10 1", "output": "9" }, { "input": "10 240", "output": "0" }, { "input": "9 240", "output": "0" }, { "input": "9 1", "output": "9" }, { "input": "9 235", "output": "1" }, { "input": "9 236", "output": "0" }, { "input": "5 225", "output": "2" }, { "input": "5 226", "output": "1" }, { "input": "4 210", "output": "3" }, { "input": "4 211", "output": "2" }, { "input": "4 191", "output": "3" }, { "input": "10 165", "output": "5" }, { "input": "10 166", "output": "4" }, { "input": "8 100", "output": "7" }, { "input": "8 101", "output": "6" }, { "input": "8 60", "output": "8" }, { "input": "8 61", "output": "7" }, { "input": "10 15", "output": "9" }, { "input": "10 16", "output": "8" }, { "input": "4 100", "output": "4" }, { "input": "4 101", "output": "4" }, { "input": "7 167", "output": "4" }, { "input": "10 164", "output": "5" }, { "input": "9 170", "output": "4" }, { "input": "8 160", "output": "5" }, { "input": "1 100", "output": "1" }, { "input": "8 123", "output": "6" }, { "input": "2 99", "output": "2" }, { "input": "10 88", "output": "7" }, { "input": "1 235", "output": "1" }, { "input": "1 1", "output": "1" }, { "input": "4 240", "output": "0" }, { "input": "1 55", "output": "1" }, { "input": "1 240", "output": "0" }, { "input": "3 240", "output": "0" }, { "input": "10 240", "output": "0" }, { "input": "2 240", "output": "0" }, { "input": "10 1", "output": "9" }, { "input": "9 1", "output": "9" }, { "input": "2 236", "output": "0" }, { "input": "10 2", "output": "9" }, { "input": "3 239", "output": "0" }, { "input": "1 237", "output": "0" }, { "input": "7 8", "output": "7" }, { "input": "10 235", "output": "1" } ]
1,693,119,848
2,147,483,647
Python 3
OK
TESTS
52
46
0
firstline = [int(n) for n in input().split()] NOP = firstline[0] Time = firstline[1] remainder_time = 240 - Time counter = 0 time , all_time = 0, 0 for i in range(1, NOP+1): time = i*5 if time+all_time <= remainder_time: all_time+=time counter+=1 print(counter)
Title: New Year and Hurry Time Limit: None seconds Memory Limit: None megabytes Problem Description: Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5·*i* minutes to solve the *i*-th problem. Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first. How many problems can Limak solve if he wants to make it to the party? Input Specification: The only line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=10, 1<=≤<=*k*<=≤<=240) — the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house. Output Specification: Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier. Demo Input: ['3 222\n', '4 190\n', '7 1\n'] Demo Output: ['2\n', '4\n', '7\n'] Note: In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5 + 10 = 15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2. In the second sample, Limak can solve all 4 problems in 5 + 10 + 15 + 20 = 50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight. In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems.
```python firstline = [int(n) for n in input().split()] NOP = firstline[0] Time = firstline[1] remainder_time = 240 - Time counter = 0 time , all_time = 0, 0 for i in range(1, NOP+1): time = i*5 if time+all_time <= remainder_time: all_time+=time counter+=1 print(counter) ```
3
298
A
Snow Footprints
PROGRAMMING
1,300
[ "greedy", "implementation" ]
null
null
There is a straight snowy road, divided into *n* blocks. The blocks are numbered from 1 to *n* from left to right. If one moves from the *i*-th block to the (*i*<=+<=1)-th block, he will leave a right footprint on the *i*-th block. Similarly, if one moves from the *i*-th block to the (*i*<=-<=1)-th block, he will leave a left footprint on the *i*-th block. If there already is a footprint on the *i*-th block, the new footprint will cover the old one. At the beginning, there were no footprints. Then polar bear Alice starts from the *s*-th block, makes a sequence of moves and ends in the *t*-th block. It is known that Alice never moves outside of the road. You are given the description of Alice's footprints. Your task is to find a pair of possible values of *s*,<=*t* by looking at the footprints.
The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=1000). The second line contains the description of the road — the string that consists of *n* characters. Each character will be either "." (a block without footprint), or "L" (a block with a left footprint), "R" (a block with a right footprint). It's guaranteed that the given string contains at least one character not equal to ".". Also, the first and the last character will always be ".". It's guaranteed that a solution exists.
Print two space-separated integers — the values of *s* and *t*. If there are several possible solutions you can print any of them.
[ "9\n..RRLL...\n", "11\n.RRRLLLLL..\n" ]
[ "3 4\n", "7 5\n" ]
The first test sample is the one in the picture.
500
[ { "input": "11\n.RRRLLLLL..", "output": "7 5" }, { "input": "4\n.RL.", "output": "3 2" }, { "input": "3\n.L.", "output": "2 1" }, { "input": "3\n.R.", "output": "2 3" } ]
1,443,248,346
2,147,483,647
Python 3
OK
TESTS
23
122
0
n = int(input()) s = input() ans = "" if 'L' in s and not 'R' in s: ans = str(s.index('L')+1)+" "+str(s.index('L')-1+1) elif 'R' in s and not 'L' in s: st = s.index('R') en = st+1 while s[en]=='R': en+=1 ans = str(st+1)+" "+str(en+1) else: st = s.index('R') en = st+1 while s[en]=='R': en+=1 ans = str(st+1)+" "+str(en+1) print(ans)
Title: Snow Footprints Time Limit: None seconds Memory Limit: None megabytes Problem Description: There is a straight snowy road, divided into *n* blocks. The blocks are numbered from 1 to *n* from left to right. If one moves from the *i*-th block to the (*i*<=+<=1)-th block, he will leave a right footprint on the *i*-th block. Similarly, if one moves from the *i*-th block to the (*i*<=-<=1)-th block, he will leave a left footprint on the *i*-th block. If there already is a footprint on the *i*-th block, the new footprint will cover the old one. At the beginning, there were no footprints. Then polar bear Alice starts from the *s*-th block, makes a sequence of moves and ends in the *t*-th block. It is known that Alice never moves outside of the road. You are given the description of Alice's footprints. Your task is to find a pair of possible values of *s*,<=*t* by looking at the footprints. Input Specification: The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=1000). The second line contains the description of the road — the string that consists of *n* characters. Each character will be either "." (a block without footprint), or "L" (a block with a left footprint), "R" (a block with a right footprint). It's guaranteed that the given string contains at least one character not equal to ".". Also, the first and the last character will always be ".". It's guaranteed that a solution exists. Output Specification: Print two space-separated integers — the values of *s* and *t*. If there are several possible solutions you can print any of them. Demo Input: ['9\n..RRLL...\n', '11\n.RRRLLLLL..\n'] Demo Output: ['3 4\n', '7 5\n'] Note: The first test sample is the one in the picture.
```python n = int(input()) s = input() ans = "" if 'L' in s and not 'R' in s: ans = str(s.index('L')+1)+" "+str(s.index('L')-1+1) elif 'R' in s and not 'L' in s: st = s.index('R') en = st+1 while s[en]=='R': en+=1 ans = str(st+1)+" "+str(en+1) else: st = s.index('R') en = st+1 while s[en]=='R': en+=1 ans = str(st+1)+" "+str(en+1) print(ans) ```
3
513
A
Game
PROGRAMMING
800
[ "constructive algorithms", "math" ]
null
null
Two players play a simple game. Each player is provided with a box with balls. First player's box contains exactly *n*1 balls and second player's box contains exactly *n*2 balls. In one move first player can take from 1 to *k*1 balls from his box and throw them away. Similarly, the second player can take from 1 to *k*2 balls from his box in his move. Players alternate turns and the first player starts the game. The one who can't make a move loses. Your task is to determine who wins if both players play optimally.
The first line contains four integers *n*1,<=*n*2,<=*k*1,<=*k*2. All numbers in the input are from 1 to 50. This problem doesn't have subproblems. You will get 3 points for the correct submission.
Output "First" if the first player wins and "Second" otherwise.
[ "2 2 1 2\n", "2 1 1 1\n" ]
[ "Second\n", "First\n" ]
Consider the first sample test. Each player has a box with 2 balls. The first player draws a single ball from his box in one move and the second player can either take 1 or 2 balls from his box in one move. No matter how the first player acts, the second player can always win if he plays wisely.
3
[ { "input": "2 2 1 2", "output": "Second" }, { "input": "2 1 1 1", "output": "First" }, { "input": "5 7 4 1", "output": "Second" }, { "input": "5 7 1 4", "output": "Second" }, { "input": "5 7 10 10", "output": "Second" }, { "input": "5 7 1 10", "output": "Second" }, { "input": "1 1 1 1", "output": "Second" }, { "input": "50 50 50 50", "output": "Second" }, { "input": "50 49 1 2", "output": "First" }, { "input": "50 48 3 1", "output": "First" }, { "input": "48 50 12 11", "output": "Second" }, { "input": "49 50 11 12", "output": "Second" }, { "input": "49 49 4 1", "output": "Second" }, { "input": "49 49 3 3", "output": "Second" }, { "input": "1 50 1 50", "output": "Second" }, { "input": "1 50 50 50", "output": "Second" }, { "input": "50 1 1 1", "output": "First" }, { "input": "50 1 1 50", "output": "First" }, { "input": "32 31 10 9", "output": "First" }, { "input": "32 4 17 3", "output": "First" } ]
1,577,535,844
2,147,483,647
Python 3
OK
TESTS
20
109
307,200
def solve(n1, n2, k1, k2): if n1 > n2: return "First" else: return "Second" def main(): n1, n2, k1, k2 = list(map(int, input().split())) print(solve(n1, n2, k1, k2)) main()
Title: Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Two players play a simple game. Each player is provided with a box with balls. First player's box contains exactly *n*1 balls and second player's box contains exactly *n*2 balls. In one move first player can take from 1 to *k*1 balls from his box and throw them away. Similarly, the second player can take from 1 to *k*2 balls from his box in his move. Players alternate turns and the first player starts the game. The one who can't make a move loses. Your task is to determine who wins if both players play optimally. Input Specification: The first line contains four integers *n*1,<=*n*2,<=*k*1,<=*k*2. All numbers in the input are from 1 to 50. This problem doesn't have subproblems. You will get 3 points for the correct submission. Output Specification: Output "First" if the first player wins and "Second" otherwise. Demo Input: ['2 2 1 2\n', '2 1 1 1\n'] Demo Output: ['Second\n', 'First\n'] Note: Consider the first sample test. Each player has a box with 2 balls. The first player draws a single ball from his box in one move and the second player can either take 1 or 2 balls from his box in one move. No matter how the first player acts, the second player can always win if he plays wisely.
```python def solve(n1, n2, k1, k2): if n1 > n2: return "First" else: return "Second" def main(): n1, n2, k1, k2 = list(map(int, input().split())) print(solve(n1, n2, k1, k2)) main() ```
3
794
A
Bank Robbery
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
A robber has attempted to rob a bank but failed to complete his task. However, he had managed to open all the safes. Oleg the bank client loves money (who doesn't), and decides to take advantage of this failed robbery and steal some money from the safes. There are many safes arranged in a line, where the *i*-th safe from the left is called safe *i*. There are *n* banknotes left in all the safes in total. The *i*-th banknote is in safe *x**i*. Oleg is now at safe *a*. There are two security guards, one of which guards the safe *b* such that *b*<=&lt;<=*a*, i.e. the first guard is to the left of Oleg. The other guard guards the safe *c* so that *c*<=&gt;<=*a*, i.e. he is to the right of Oleg. The two guards are very lazy, so they do not move. In every second, Oleg can either take all the banknotes from the current safe or move to any of the neighboring safes. However, he cannot visit any safe that is guarded by security guards at any time, becaues he might be charged for stealing. Determine the maximum amount of banknotes Oleg can gather.
The first line of input contains three space-separated integers, *a*, *b* and *c* (1<=≤<=*b*<=&lt;<=*a*<=&lt;<=*c*<=≤<=109), denoting the positions of Oleg, the first security guard and the second security guard, respectively. The next line of input contains a single integer *n* (1<=≤<=*n*<=≤<=105), denoting the number of banknotes. The next line of input contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=109), denoting that the *i*-th banknote is located in the *x**i*-th safe. Note that *x**i* are not guaranteed to be distinct.
Output a single integer: the maximum number of banknotes Oleg can take.
[ "5 3 7\n8\n4 7 5 5 3 6 2 8\n", "6 5 7\n5\n1 5 7 92 3\n" ]
[ "4\n", "0\n" ]
In the first example Oleg can take the banknotes in positions 4, 5, 6 (note that there are 2 banknotes at position 5). Oleg can't take the banknotes in safes 7 and 8 because he can't run into the second security guard. Similarly, Oleg cannot take the banknotes at positions 3 and 2 because he can't run into the first security guard. Thus, he can take a maximum of 4 banknotes. For the second sample, Oleg can't take any banknotes without bumping into any of the security guards.
500
[ { "input": "5 3 7\n8\n4 7 5 5 3 6 2 8", "output": "4" }, { "input": "6 5 7\n5\n1 5 7 92 3", "output": "0" }, { "input": "3 2 4\n1\n3", "output": "1" }, { "input": "5 3 8\n12\n8 3 4 5 7 6 8 3 5 4 7 6", "output": "8" }, { "input": "7 3 10\n5\n3 3 3 3 3", "output": "0" }, { "input": "3 2 5\n4\n1 3 4 5", "output": "2" }, { "input": "3 2 4\n1\n1", "output": "0" }, { "input": "6 4 8\n1\n4", "output": "0" }, { "input": "2 1 3\n1\n3", "output": "0" } ]
1,571,512,499
2,147,483,647
Python 3
OK
TESTS
46
156
8,396,800
a, b, c = map(int, input().split()) input() all_cells = map(int, input().split()) cells = [x for x in all_cells if b < x < c] print(len(cells))
Title: Bank Robbery Time Limit: None seconds Memory Limit: None megabytes Problem Description: A robber has attempted to rob a bank but failed to complete his task. However, he had managed to open all the safes. Oleg the bank client loves money (who doesn't), and decides to take advantage of this failed robbery and steal some money from the safes. There are many safes arranged in a line, where the *i*-th safe from the left is called safe *i*. There are *n* banknotes left in all the safes in total. The *i*-th banknote is in safe *x**i*. Oleg is now at safe *a*. There are two security guards, one of which guards the safe *b* such that *b*<=&lt;<=*a*, i.e. the first guard is to the left of Oleg. The other guard guards the safe *c* so that *c*<=&gt;<=*a*, i.e. he is to the right of Oleg. The two guards are very lazy, so they do not move. In every second, Oleg can either take all the banknotes from the current safe or move to any of the neighboring safes. However, he cannot visit any safe that is guarded by security guards at any time, becaues he might be charged for stealing. Determine the maximum amount of banknotes Oleg can gather. Input Specification: The first line of input contains three space-separated integers, *a*, *b* and *c* (1<=≤<=*b*<=&lt;<=*a*<=&lt;<=*c*<=≤<=109), denoting the positions of Oleg, the first security guard and the second security guard, respectively. The next line of input contains a single integer *n* (1<=≤<=*n*<=≤<=105), denoting the number of banknotes. The next line of input contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=109), denoting that the *i*-th banknote is located in the *x**i*-th safe. Note that *x**i* are not guaranteed to be distinct. Output Specification: Output a single integer: the maximum number of banknotes Oleg can take. Demo Input: ['5 3 7\n8\n4 7 5 5 3 6 2 8\n', '6 5 7\n5\n1 5 7 92 3\n'] Demo Output: ['4\n', '0\n'] Note: In the first example Oleg can take the banknotes in positions 4, 5, 6 (note that there are 2 banknotes at position 5). Oleg can't take the banknotes in safes 7 and 8 because he can't run into the second security guard. Similarly, Oleg cannot take the banknotes at positions 3 and 2 because he can't run into the first security guard. Thus, he can take a maximum of 4 banknotes. For the second sample, Oleg can't take any banknotes without bumping into any of the security guards.
```python a, b, c = map(int, input().split()) input() all_cells = map(int, input().split()) cells = [x for x in all_cells if b < x < c] print(len(cells)) ```
3
94
A
Restoring Password
PROGRAMMING
900
[ "implementation", "strings" ]
A. Restoring Password
2
256
Igor K. always used to trust his favorite Kashpirovsky Antivirus. That is why he didn't hesitate to download the link one of his groupmates sent him via QIP Infinium. The link was said to contain "some real funny stuff about swine influenza". The antivirus had no objections and Igor K. run the flash application he had downloaded. Immediately his QIP Infinium said: "invalid login/password". Igor K. entered the ISQ from his additional account and looked at the info of his main one. His name and surname changed to "H1N1" and "Infected" correspondingly, and the "Additional Information" field contained a strange-looking binary code 80 characters in length, consisting of zeroes and ones. "I've been hacked" — thought Igor K. and run the Internet Exploiter browser to quickly type his favourite search engine's address. Soon he learned that it really was a virus that changed ISQ users' passwords. Fortunately, he soon found out that the binary code was actually the encrypted password where each group of 10 characters stood for one decimal digit. Accordingly, the original password consisted of 8 decimal digits. Help Igor K. restore his ISQ account by the encrypted password and encryption specification.
The input data contains 11 lines. The first line represents the binary code 80 characters in length. That is the code written in Igor K.'s ISQ account's info. Next 10 lines contain pairwise distinct binary codes 10 characters in length, corresponding to numbers 0, 1, ..., 9.
Print one line containing 8 characters — The password to Igor K.'s ISQ account. It is guaranteed that the solution exists.
[ "01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110\n", "10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000\n" ]
[ "12345678\n", "30234919\n" ]
none
500
[ { "input": "01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110", "output": "12345678" }, { "input": "10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000", "output": "30234919" }, { "input": "00010101101110110101100110101100010101100010101111000101011010011010110010000011\n0101010110\n0001001101\n1001101011\n0000100011\n0010101111\n1110110101\n0001010110\n0110111000\n0000111110\n0010000011", "output": "65264629" }, { "input": "10100100010010010011011001101000100100110110011010011001101011000100110110011010\n1111110011\n1001000111\n1001000100\n1100010011\n0110011010\n0010000001\n1110101110\n0010000110\n0010010011\n1010010001", "output": "98484434" }, { "input": "00101100011111010001001000000110110000000110010011001111111010110010001011000000\n0010000001\n0110010011\n0010000010\n1011001000\n0011111110\n0110001000\n1111010001\n1011000000\n0000100110\n0010110001", "output": "96071437" }, { "input": "10001110111110000001000010001010001110110000100010100010111101101101010000100010\n0000010110\n1101010111\n1000101111\n0001011110\n0011110101\n0101100100\n0110110101\n0000100010\n1000111011\n1110000001", "output": "89787267" }, { "input": "10010100011001010001010101001101010100110100111011001010111100011001000010100000\n0011100000\n1001100100\n0001100100\n0010100000\n0101010011\n0010101110\n0010101111\n0100111011\n1001010001\n1111111110", "output": "88447623" }, { "input": "01101100111000000101011011001110000001011111111000111111100001011010001001011001\n1000000101\n0101101000\n0101110101\n1101011110\n0000101100\n1111111000\n0001001101\n0110111011\n0110110011\n1001011001", "output": "80805519" }, { "input": "11100011000100010110010011101010101010011110001100011010111110011000011010110111\n1110001100\n0110101111\n0100111010\n0101000000\n1001100001\n1010101001\n0000100010\n1010110111\n1100011100\n0100010110", "output": "09250147" }, { "input": "10000110110000010100000010001000111101110110101011110111000100001101000000100010\n0000010100\n0000110001\n0110101011\n1101110001\n1000011011\n0000110100\n0011110111\n1000110010\n0000100010\n0000011011", "output": "40862358" }, { "input": "01000000010000000110100101000110110000100100000001101100001000011111111001010001\n1011000010\n1111101010\n0111110011\n0000000110\n0000001001\n0001111111\n0110010010\n0100000001\n1011001000\n1001010001", "output": "73907059" }, { "input": "01111000111110011001110101110011110000111110010001101100110110100111101011001101\n1110010001\n1001100000\n1100001000\n1010011110\n1011001101\n0111100011\n1101011100\n1110011001\n1111000011\n0010000101", "output": "57680434" }, { "input": "01001100101000100010001011110001000101001001100010010000001001001100101001011111\n1001011111\n1110010111\n0111101011\n1000100010\n0011100101\n0100000010\n0010111100\n0100010100\n1001100010\n0100110010", "output": "93678590" }, { "input": "01110111110000111011101010110110101011010100110111000011101101110101011101001000\n0110000101\n1010101101\n1101010111\n1101011100\n0100110111\n0111011111\n1100011001\n0111010101\n0000111011\n1101001000", "output": "58114879" }, { "input": "11101001111100110101110011010100110011011110100111010110110011000111000011001101\n1100011100\n1100110101\n1011101000\n0011011110\n0011001101\n0100010001\n1110100111\n1010101100\n1110110100\n0101101100", "output": "61146904" }, { "input": "10101010001011010001001001011000100101100001011011101010101110101010001010101000\n0010110101\n1010011010\n1010101000\n1011010001\n1010101011\n0010010110\n0110100010\n1010100101\n0001011011\n0110100001", "output": "23558422" }, { "input": "11110101001100010000110100001110101011011111010100110001000001001010001001101111\n0101101100\n1001101111\n1010101101\n0100101000\n1111110000\n0101010010\n1100010000\n1111010100\n1101000011\n1011111111", "output": "76827631" }, { "input": "10001100110000110111100011001101111110110011110101000011011100001101110000110111\n0011110101\n0101100011\n1000110011\n1011011001\n0111111011\n0101111011\n0000110111\n0100001110\n1000000111\n0110110111", "output": "26240666" }, { "input": "10000100010000111101100100111101111011101000001001100001000110000010010000111101\n1001001111\n0000111101\n1000010001\n0110011101\n0110101000\n1011111001\n0111101110\n1000001001\n1101011111\n0001010100", "output": "21067271" }, { "input": "01101111000110111100011011110001101111001010001100101000110001010101100100000010\n1010001100\n0011010011\n0101010110\n1111001100\n1100011000\n0100101100\n1001100101\n0110111100\n0011001101\n0100000010", "output": "77770029" }, { "input": "10100111011010001011111000000111100000010101000011000010111101010000111010011101\n1010011101\n1010111111\n0110100110\n1111000100\n1110000001\n0000101111\n0011111000\n1000110001\n0101000011\n1010001011", "output": "09448580" }, { "input": "10000111111000011111001010101010010011111001001111000010010100100011000010001100\n1101101110\n1001001111\n0000100101\n1100111010\n0010101010\n1110000110\n1100111101\n0010001100\n1110000001\n1000011111", "output": "99411277" }, { "input": "10110110111011001111101100111100111111011011011011001111110110010011100010000111\n0111010011\n0111101100\n1001101010\n0101000101\n0010000111\n0011111101\n1011001111\n1101111000\n1011011011\n1001001110", "output": "86658594" }, { "input": "01001001100101100011110110111100000110001111001000100000110111110010000000011000\n0100100110\n1000001011\n1000111110\n0000011000\n0101100011\n1101101111\n1111001000\n1011011001\n1000001101\n0010101000", "output": "04536863" }, { "input": "10010100011101000011100100001100101111000010111100000010010000001001001101011101\n1001000011\n1101000011\n1001010001\n1101011101\n1000010110\n0011111101\n0010111100\n0000100100\n1010001000\n0101000110", "output": "21066773" }, { "input": "01111111110101111111011111111111010010000001100000101000100100111001011010001001\n0111111111\n0101111111\n0100101101\n0001100000\n0011000101\n0011100101\n1101001000\n0010111110\n1010001001\n1111000111", "output": "01063858" }, { "input": "00100011111001001010001111000011101000001110100000000100101011101000001001001010\n0010001111\n1001001010\n1010011001\n0011100111\n1000111000\n0011110000\n0000100010\n0001001010\n1111110111\n1110100000", "output": "01599791" }, { "input": "11011101000100110100110011010101100011111010011010010011010010010010100110101111\n0100110100\n1001001010\n0001111101\n1101011010\n1101110100\n1100110101\n0110101111\n0110001111\n0001101000\n1010011010", "output": "40579016" }, { "input": "10000010111101110110011000111110000011100110001111100100000111000011011000001011\n0111010100\n1010110110\n1000001110\n1110000100\n0110001111\n1101110110\n1100001101\n1000001011\n0000000101\n1001000001", "output": "75424967" }, { "input": "11101100101110111110111011111010001111111111000001001001000010001111111110110010\n0101100001\n1111010011\n1110111110\n0100110100\n1110011111\n1000111111\n0010010000\n1110110010\n0011000010\n1111000001", "output": "72259657" }, { "input": "01011110100101111010011000001001100000101001110011010111101011010000110110010101\n0100111100\n0101110011\n0101111010\n0110000010\n0101001111\n1101000011\n0110010101\n0111011010\n0001101110\n1001110011", "output": "22339256" }, { "input": "01100000100101111000100001100010000110000010100100100001100000110011101001110000\n0101111000\n1001110000\n0001000101\n0110110111\n0010100100\n1000011000\n1101110110\n0110000010\n0001011010\n0011001110", "output": "70554591" }, { "input": "11110011011000001001111100110101001000010100100000110011001110011111100100100001\n1010011000\n1111001101\n0100100001\n1111010011\n0100100000\n1001111110\n1010100111\n1000100111\n1000001001\n1100110011", "output": "18124952" }, { "input": "10001001011000100101010110011101011001110010000001010110000101000100101111101010\n0101100001\n1100001100\n1111101010\n1000100101\n0010000001\n0100010010\n0010110110\n0101100111\n0000001110\n1101001110", "output": "33774052" }, { "input": "00110010000111001001001100100010010111101011011110001011111100000101000100000001\n0100000001\n1011011110\n0010111111\n0111100111\n0100111001\n0000010100\n1001011110\n0111001001\n0100010011\n0011001000", "output": "97961250" }, { "input": "01101100001000110101101100101111101110010011010111100011010100010001101000110101\n1001101001\n1000110101\n0110110000\n0111100100\n0011010111\n1110111001\n0001000110\n0000000100\n0001101001\n1011001011", "output": "21954161" }, { "input": "10101110000011010110101011100000101101000110100000101101101101110101000011110010\n0110100000\n1011011011\n0011110010\n0001110110\n0010110100\n1100010010\n0001101011\n1010111000\n0011010110\n0111010100", "output": "78740192" }, { "input": "11000101011100100111010000010001000001001100101100000011000000001100000101011010\n1100010101\n1111101011\n0101011010\n0100000100\n1000110111\n1100100111\n1100101100\n0111001000\n0000110000\n0110011111", "output": "05336882" }, { "input": "11110100010000101110010110001000001011100101100010110011011011111110001100110110\n0101100010\n0100010001\n0000101110\n1100110110\n0101000101\n0011001011\n1111010001\n1000110010\n1111111000\n1010011111", "output": "62020383" }, { "input": "00011001111110000011101011010001010111100110100101000110011111011001100000001100\n0111001101\n0101011110\n0001100111\n1101011111\n1110000011\n0000001100\n0111010001\n1101100110\n1010110100\n0110100101", "output": "24819275" }, { "input": "10111110010011111001001111100101010111010011111001001110101000111110011001111101\n0011111001\n0101011101\n0100001010\n0001110010\n1001111101\n0011101010\n1111001001\n1100100001\n1001101000\n1011111001", "output": "90010504" }, { "input": "01111101111100101010001001011110111001110111110111011111011110110111111011011111\n1111110111\n0010000101\n0110000100\n0111111011\n1011100111\n1100101010\n1011011111\n1100010001\n0111110111\n0010010111", "output": "85948866" }, { "input": "01111100000111110000110010111001111100001001101010110010111010001000101001101010\n0100010101\n1011110101\n1010100100\n1010000001\n1001101010\n0101100110\n1000100010\n0111110000\n1100101110\n0110010110", "output": "77874864" }, { "input": "11100011010000000010011110010111001011111001000111000000001000000000100111100101\n0000000010\n1110001101\n0011010101\n0111100101\n1001000111\n1101001111\n0111010110\n1100101111\n0110000000\n1101101011", "output": "10374003" }, { "input": "01111011100111101110011001000110001111101000111110100100100001011111001011100010\n0110010100\n1100010001\n0111101110\n1001001000\n1010011011\n1000111110\n0010110101\n1011100010\n0101111100\n0110010001", "output": "22955387" }, { "input": "11011010001100000011000100110011010101000110011110110000001100111100001000011111\n0000100010\n1000011111\n1101101000\n0110011110\n0011110000\n1100000011\n0010001100\n0101101000\n0001001100\n1101010100", "output": "25893541" }, { "input": "01011001011111010010101111011001000011001100011101101111011011010011101011110110\n0100001100\n0101100101\n1111111011\n1111010010\n1111101100\n1100011101\n1011000011\n1101001110\n1011110110\n0110001010", "output": "13805878" }, { "input": "11110011011000111111001100111110001111111100000010111100110100110011111111001101\n1111001101\n1001101010\n1100110010\n0011001111\n0001011110\n1000110011\n1000111111\n0110001010\n1001011101\n1100000010", "output": "06369030" }, { "input": "01110011110010000011011001011000001000010110010110011001100001100110001100101000\n0000100001\n0110011000\n1010000010\n1110011101\n0111001111\n1100101000\n0010000011\n0110010000\n1100100101\n0110010110", "output": "46909115" }, { "input": "00001011001111110111111111011111111101110101110100010111010010100101100001010110\n1111110111\n0001010110\n0111011011\n0111000001\n1010010110\n0101110100\n0001000101\n0000111000\n0110100001\n0000101100", "output": "90005541" } ]
1,406,679,800
2,147,483,647
Python 3
OK
TESTS
50
124
0
p = input() num = {} for i in range(10): num[input()] = i out = '' for i in range(0,len(p),10): part = p[i:i+10] out += str(num[part]) print(out)
Title: Restoring Password Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Igor K. always used to trust his favorite Kashpirovsky Antivirus. That is why he didn't hesitate to download the link one of his groupmates sent him via QIP Infinium. The link was said to contain "some real funny stuff about swine influenza". The antivirus had no objections and Igor K. run the flash application he had downloaded. Immediately his QIP Infinium said: "invalid login/password". Igor K. entered the ISQ from his additional account and looked at the info of his main one. His name and surname changed to "H1N1" and "Infected" correspondingly, and the "Additional Information" field contained a strange-looking binary code 80 characters in length, consisting of zeroes and ones. "I've been hacked" — thought Igor K. and run the Internet Exploiter browser to quickly type his favourite search engine's address. Soon he learned that it really was a virus that changed ISQ users' passwords. Fortunately, he soon found out that the binary code was actually the encrypted password where each group of 10 characters stood for one decimal digit. Accordingly, the original password consisted of 8 decimal digits. Help Igor K. restore his ISQ account by the encrypted password and encryption specification. Input Specification: The input data contains 11 lines. The first line represents the binary code 80 characters in length. That is the code written in Igor K.'s ISQ account's info. Next 10 lines contain pairwise distinct binary codes 10 characters in length, corresponding to numbers 0, 1, ..., 9. Output Specification: Print one line containing 8 characters — The password to Igor K.'s ISQ account. It is guaranteed that the solution exists. Demo Input: ['01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110\n', '10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000\n'] Demo Output: ['12345678\n', '30234919\n'] Note: none
```python p = input() num = {} for i in range(10): num[input()] = i out = '' for i in range(0,len(p),10): part = p[i:i+10] out += str(num[part]) print(out) ```
3.969
946
A
Partition
PROGRAMMING
800
[ "greedy" ]
null
null
You are given a sequence *a* consisting of *n* integers. You may partition this sequence into two sequences *b* and *c* in such a way that every element belongs exactly to one of these sequences. Let *B* be the sum of elements belonging to *b*, and *C* be the sum of elements belonging to *c* (if some of these sequences is empty, then its sum is 0). What is the maximum possible value of *B*<=-<=*C*?
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in *a*. The second line contains *n* integers *a*1, *a*2, ..., *a**n* (<=-<=100<=≤<=*a**i*<=≤<=100) — the elements of sequence *a*.
Print the maximum possible value of *B*<=-<=*C*, where *B* is the sum of elements of sequence *b*, and *C* is the sum of elements of sequence *c*.
[ "3\n1 -2 0\n", "6\n16 23 16 15 42 8\n" ]
[ "3\n", "120\n" ]
In the first example we may choose *b* = {1, 0}, *c* = { - 2}. Then *B* = 1, *C* =  - 2, *B* - *C* = 3. In the second example we choose *b* = {16, 23, 16, 15, 42, 8}, *c* = {} (an empty sequence). Then *B* = 120, *C* = 0, *B* - *C* = 120.
0
[ { "input": "3\n1 -2 0", "output": "3" }, { "input": "6\n16 23 16 15 42 8", "output": "120" }, { "input": "1\n-1", "output": "1" }, { "input": "100\n-100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100", "output": "10000" }, { "input": "2\n-1 5", "output": "6" }, { "input": "3\n-2 0 1", "output": "3" }, { "input": "12\n-1 -2 -3 4 4 -6 -6 56 3 3 -3 3", "output": "94" }, { "input": "4\n1 -1 1 -1", "output": "4" }, { "input": "4\n100 -100 100 -100", "output": "400" }, { "input": "3\n-2 -5 10", "output": "17" }, { "input": "5\n1 -2 3 -4 5", "output": "15" }, { "input": "3\n-100 100 -100", "output": "300" }, { "input": "6\n1 -1 1 -1 1 -1", "output": "6" }, { "input": "6\n2 -2 2 -2 2 -2", "output": "12" }, { "input": "9\n12 93 -2 0 0 0 3 -3 -9", "output": "122" }, { "input": "6\n-1 2 4 -5 -3 55", "output": "70" }, { "input": "6\n-12 8 68 -53 1 -15", "output": "157" }, { "input": "2\n-2 1", "output": "3" }, { "input": "3\n100 -100 100", "output": "300" }, { "input": "5\n100 100 -1 -100 2", "output": "303" }, { "input": "6\n-5 -4 -3 -2 -1 0", "output": "15" }, { "input": "6\n4 4 4 -3 -3 2", "output": "20" }, { "input": "2\n-1 2", "output": "3" }, { "input": "1\n100", "output": "100" }, { "input": "5\n-1 -2 3 1 2", "output": "9" }, { "input": "5\n100 -100 100 -100 100", "output": "500" }, { "input": "5\n1 -1 1 -1 1", "output": "5" }, { "input": "4\n0 0 0 -1", "output": "1" }, { "input": "5\n100 -100 -1 2 100", "output": "303" }, { "input": "2\n75 0", "output": "75" }, { "input": "4\n55 56 -59 -58", "output": "228" }, { "input": "2\n9 71", "output": "80" }, { "input": "2\n9 70", "output": "79" }, { "input": "2\n9 69", "output": "78" }, { "input": "2\n100 -100", "output": "200" }, { "input": "4\n-9 4 -9 5", "output": "27" }, { "input": "42\n91 -27 -79 -56 80 -93 -23 10 80 94 61 -89 -64 81 34 99 31 -32 -69 92 79 -9 73 66 -8 64 99 99 58 -19 -40 21 1 -33 93 -23 -62 27 55 41 57 36", "output": "2348" }, { "input": "7\n-1 2 2 2 -1 2 -1", "output": "11" }, { "input": "6\n-12 8 17 -69 7 -88", "output": "201" }, { "input": "3\n1 -2 5", "output": "8" }, { "input": "6\n-2 3 -4 5 6 -1", "output": "21" }, { "input": "2\n-5 1", "output": "6" }, { "input": "4\n2 2 -2 4", "output": "10" }, { "input": "68\n21 47 -75 -25 64 83 83 -21 89 24 43 44 -35 34 -42 92 -96 -52 -66 64 14 -87 25 -61 -78 83 -96 -18 95 83 -93 -28 75 49 87 65 -93 -69 -2 95 -24 -36 -61 -71 88 -53 -93 -51 -81 -65 -53 -46 -56 6 65 58 19 100 57 61 -53 44 -58 48 -8 80 -88 72", "output": "3991" }, { "input": "5\n5 5 -10 -1 1", "output": "22" }, { "input": "3\n-1 2 3", "output": "6" }, { "input": "76\n57 -38 -48 -81 93 -32 96 55 -44 2 38 -46 42 64 71 -73 95 31 -39 -62 -1 75 -17 57 28 52 12 -11 82 -84 59 -86 73 -97 34 97 -57 -85 -6 39 -5 -54 95 24 -44 35 -18 9 91 7 -22 -61 -80 54 -40 74 -90 15 -97 66 -52 -49 -24 65 21 -93 -29 -24 -4 -1 76 -93 7 -55 -53 1", "output": "3787" }, { "input": "5\n-1 -2 1 2 3", "output": "9" }, { "input": "4\n2 2 -2 -2", "output": "8" }, { "input": "6\n100 -100 100 -100 100 -100", "output": "600" }, { "input": "100\n-59 -33 34 0 69 24 -22 58 62 -36 5 45 -19 -73 61 -9 95 42 -73 -64 91 -96 2 53 -8 82 -79 16 18 -5 -53 26 71 38 -31 12 -33 -1 -65 -6 3 -89 22 33 -27 -36 41 11 -47 -32 47 -56 -38 57 -63 -41 23 41 29 78 16 -65 90 -58 -12 6 -60 42 -36 -52 -54 -95 -10 29 70 50 -94 1 93 48 -71 -77 -16 54 56 -60 66 76 31 8 44 -61 -74 23 37 38 18 -18 29 41", "output": "4362" }, { "input": "2\n-1 1", "output": "2" }, { "input": "3\n1 -2 100", "output": "103" }, { "input": "5\n1 -2 3 1 2", "output": "9" }, { "input": "10\n100 -10 -100 10 10 10 10 10 10 10", "output": "280" }, { "input": "4\n2 0 -2 4", "output": "8" }, { "input": "4\n3 -3 1 -1", "output": "8" }, { "input": "3\n1 -1 1", "output": "3" }, { "input": "4\n2 5 -2 4", "output": "13" }, { "input": "2\n-2 2", "output": "4" }, { "input": "3\n1 -2 1", "output": "4" }, { "input": "5\n-1 -2 1 1 -1", "output": "6" }, { "input": "4\n-2 0 2 4", "output": "8" }, { "input": "8\n-42 7 87 -16 -5 65 -88 1", "output": "311" }, { "input": "3\n1 -3 4", "output": "8" }, { "input": "1\n1", "output": "1" }, { "input": "2\n0 1", "output": "1" }, { "input": "3\n-1 2 -1", "output": "4" }, { "input": "18\n-21 12 65 66 -24 62 82 35 -45 -47 28 37 5 -32 22 -14 -69 -95", "output": "761" }, { "input": "4\n-1 1 -1 1", "output": "4" }, { "input": "5\n-1 2 1 1 1", "output": "6" }, { "input": "3\n1 1 1", "output": "3" } ]
1,578,050,659
2,147,483,647
Python 3
OK
TESTS
72
124
0
if __name__ == '__main__': # n, a, b = map(int, input().split()) n = int(input()) arrs = map(int, input().split()) b = [] c = [] for num in arrs: if num >= 0: b.append(num) else: c.append(num) print(sum(b) - sum(c))
Title: Partition Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a sequence *a* consisting of *n* integers. You may partition this sequence into two sequences *b* and *c* in such a way that every element belongs exactly to one of these sequences. Let *B* be the sum of elements belonging to *b*, and *C* be the sum of elements belonging to *c* (if some of these sequences is empty, then its sum is 0). What is the maximum possible value of *B*<=-<=*C*? Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in *a*. The second line contains *n* integers *a*1, *a*2, ..., *a**n* (<=-<=100<=≤<=*a**i*<=≤<=100) — the elements of sequence *a*. Output Specification: Print the maximum possible value of *B*<=-<=*C*, where *B* is the sum of elements of sequence *b*, and *C* is the sum of elements of sequence *c*. Demo Input: ['3\n1 -2 0\n', '6\n16 23 16 15 42 8\n'] Demo Output: ['3\n', '120\n'] Note: In the first example we may choose *b* = {1, 0}, *c* = { - 2}. Then *B* = 1, *C* =  - 2, *B* - *C* = 3. In the second example we choose *b* = {16, 23, 16, 15, 42, 8}, *c* = {} (an empty sequence). Then *B* = 120, *C* = 0, *B* - *C* = 120.
```python if __name__ == '__main__': # n, a, b = map(int, input().split()) n = int(input()) arrs = map(int, input().split()) b = [] c = [] for num in arrs: if num >= 0: b.append(num) else: c.append(num) print(sum(b) - sum(c)) ```
3
340
A
The Wall
PROGRAMMING
1,200
[ "math" ]
null
null
Iahub and his friend Floyd have started painting a wall. Iahub is painting the wall red and Floyd is painting it pink. You can consider the wall being made of a very large number of bricks, numbered 1, 2, 3 and so on. Iahub has the following scheme of painting: he skips *x*<=-<=1 consecutive bricks, then he paints the *x*-th one. That is, he'll paint bricks *x*, 2·*x*, 3·*x* and so on red. Similarly, Floyd skips *y*<=-<=1 consecutive bricks, then he paints the *y*-th one. Hence he'll paint bricks *y*, 2·*y*, 3·*y* and so on pink. After painting the wall all day, the boys observed that some bricks are painted both red and pink. Iahub has a lucky number *a* and Floyd has a lucky number *b*. Boys wonder how many bricks numbered no less than *a* and no greater than *b* are painted both red and pink. This is exactly your task: compute and print the answer to the question.
The input will have a single line containing four integers in this order: *x*, *y*, *a*, *b*. (1<=≤<=*x*,<=*y*<=≤<=1000, 1<=≤<=*a*,<=*b*<=≤<=2·109, *a*<=≤<=*b*).
Output a single integer — the number of bricks numbered no less than *a* and no greater than *b* that are painted both red and pink.
[ "2 3 6 18\n" ]
[ "3" ]
Let's look at the bricks from *a* to *b* (*a* = 6, *b* = 18). The bricks colored in red are numbered 6, 8, 10, 12, 14, 16, 18. The bricks colored in pink are numbered 6, 9, 12, 15, 18. The bricks colored in both red and pink are numbered with 6, 12 and 18.
500
[ { "input": "2 3 6 18", "output": "3" }, { "input": "4 6 20 201", "output": "15" }, { "input": "15 27 100 10000", "output": "74" }, { "input": "105 60 3456 78910", "output": "179" }, { "input": "1 1 1000 100000", "output": "99001" }, { "input": "3 2 5 5", "output": "0" }, { "input": "555 777 1 1000000", "output": "257" }, { "input": "1000 1000 1 32323", "output": "32" }, { "input": "45 125 93451125 100000000", "output": "5821" }, { "input": "101 171 1 1000000000", "output": "57900" }, { "input": "165 255 69696 1000000000", "output": "356482" }, { "input": "555 777 666013 1000000000", "output": "257229" }, { "input": "23 46 123321 900000000", "output": "19562537" }, { "input": "321 123 15 1000000", "output": "75" }, { "input": "819 1000 9532 152901000", "output": "186" }, { "input": "819 1000 10000 1000000", "output": "1" }, { "input": "1 1 1 1", "output": "1" }, { "input": "1 2 2 1000003", "output": "500001" }, { "input": "1 1 1 1000000000", "output": "1000000000" }, { "input": "10 15 69 195610342", "output": "6520342" }, { "input": "2 1 1 1000000000", "output": "500000000" }, { "input": "1000 1000 1 20", "output": "0" }, { "input": "1 1 1 2000000000", "output": "2000000000" }, { "input": "1 2 1 2000000000", "output": "1000000000" }, { "input": "2 1 1 2000000000", "output": "1000000000" }, { "input": "2 3 1 1000000000", "output": "166666666" }, { "input": "2 3 1 2000000000", "output": "333333333" }, { "input": "3 7 1 1000000000", "output": "47619047" }, { "input": "1 1 1000000000 2000000000", "output": "1000000001" }, { "input": "2 2 1 2000000000", "output": "1000000000" }, { "input": "1 1 2 2000000000", "output": "1999999999" }, { "input": "3 2 1 2000000000", "output": "333333333" }, { "input": "1 1 2000000000 2000000000", "output": "1" }, { "input": "2 3 7 7", "output": "0" }, { "input": "3 3 3 7", "output": "2" } ]
1,520,522,438
2,147,483,647
Python 3
OK
TESTS
35
124
5,632,000
def gcd(a,b): while b: a,b=b,a%b return a x,y,a,b=map(int,input().split()) k=(x*y)//gcd(x,y) m=int(a%k==0) print((b//k)-(a//k)+m)
Title: The Wall Time Limit: None seconds Memory Limit: None megabytes Problem Description: Iahub and his friend Floyd have started painting a wall. Iahub is painting the wall red and Floyd is painting it pink. You can consider the wall being made of a very large number of bricks, numbered 1, 2, 3 and so on. Iahub has the following scheme of painting: he skips *x*<=-<=1 consecutive bricks, then he paints the *x*-th one. That is, he'll paint bricks *x*, 2·*x*, 3·*x* and so on red. Similarly, Floyd skips *y*<=-<=1 consecutive bricks, then he paints the *y*-th one. Hence he'll paint bricks *y*, 2·*y*, 3·*y* and so on pink. After painting the wall all day, the boys observed that some bricks are painted both red and pink. Iahub has a lucky number *a* and Floyd has a lucky number *b*. Boys wonder how many bricks numbered no less than *a* and no greater than *b* are painted both red and pink. This is exactly your task: compute and print the answer to the question. Input Specification: The input will have a single line containing four integers in this order: *x*, *y*, *a*, *b*. (1<=≤<=*x*,<=*y*<=≤<=1000, 1<=≤<=*a*,<=*b*<=≤<=2·109, *a*<=≤<=*b*). Output Specification: Output a single integer — the number of bricks numbered no less than *a* and no greater than *b* that are painted both red and pink. Demo Input: ['2 3 6 18\n'] Demo Output: ['3'] Note: Let's look at the bricks from *a* to *b* (*a* = 6, *b* = 18). The bricks colored in red are numbered 6, 8, 10, 12, 14, 16, 18. The bricks colored in pink are numbered 6, 9, 12, 15, 18. The bricks colored in both red and pink are numbered with 6, 12 and 18.
```python def gcd(a,b): while b: a,b=b,a%b return a x,y,a,b=map(int,input().split()) k=(x*y)//gcd(x,y) m=int(a%k==0) print((b//k)-(a//k)+m) ```
3
82
A
Double Cola
PROGRAMMING
1,100
[ "implementation", "math" ]
A. Double Cola
1
256
Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum. For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny. Write a program that will print the name of a man who will drink the *n*-th can. Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon.
The input data consist of a single integer *n* (1<=≤<=*n*<=≤<=109). It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers.
Print the single line — the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially.
[ "1\n", "6\n", "1802\n" ]
[ "Sheldon\n", "Sheldon\n", "Penny\n" ]
none
500
[ { "input": "1", "output": "Sheldon" }, { "input": "6", "output": "Sheldon" }, { "input": "1802", "output": "Penny" }, { "input": "1", "output": "Sheldon" }, { "input": "2", "output": "Leonard" }, { "input": "3", "output": "Penny" }, { "input": "4", "output": "Rajesh" }, { "input": "5", "output": "Howard" }, { "input": "10", "output": "Penny" }, { "input": "534", "output": "Rajesh" }, { "input": "5033", "output": "Howard" }, { "input": "10010", "output": "Howard" }, { "input": "500000000", "output": "Penny" }, { "input": "63", "output": "Rajesh" }, { "input": "841", "output": "Leonard" }, { "input": "3667", "output": "Penny" }, { "input": "38614", "output": "Howard" }, { "input": "282798", "output": "Rajesh" }, { "input": "9266286", "output": "Rajesh" }, { "input": "27385966", "output": "Leonard" }, { "input": "121580142", "output": "Penny" }, { "input": "5", "output": "Howard" }, { "input": "300", "output": "Howard" }, { "input": "1745", "output": "Leonard" }, { "input": "8302", "output": "Rajesh" }, { "input": "184518", "output": "Sheldon" }, { "input": "1154414", "output": "Rajesh" }, { "input": "28643950", "output": "Leonard" }, { "input": "159222638", "output": "Howard" }, { "input": "24", "output": "Penny" }, { "input": "505", "output": "Penny" }, { "input": "4425", "output": "Rajesh" }, { "input": "12079", "output": "Sheldon" }, { "input": "469726", "output": "Penny" }, { "input": "3961838", "output": "Penny" }, { "input": "57710446", "output": "Leonard" }, { "input": "80719470", "output": "Howard" }, { "input": "1000000000", "output": "Penny" }, { "input": "999999999", "output": "Penny" }, { "input": "999999998", "output": "Penny" }, { "input": "5", "output": "Howard" } ]
1,685,167,878
2,147,483,647
Python 3
OK
TESTS
41
46
0
target = int(input()) multiplier = 1 index = 0 q = ["Sheldon", "Leonard", "Penny", "Rajesh", "Howard"] while target > 0: index = 0 for i in range(5): target -= multiplier if target <= 0: break index += 1 multiplier *= 2 print(q[index])
Title: Double Cola Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum. For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny. Write a program that will print the name of a man who will drink the *n*-th can. Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon. Input Specification: The input data consist of a single integer *n* (1<=≤<=*n*<=≤<=109). It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers. Output Specification: Print the single line — the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially. Demo Input: ['1\n', '6\n', '1802\n'] Demo Output: ['Sheldon\n', 'Sheldon\n', 'Penny\n'] Note: none
```python target = int(input()) multiplier = 1 index = 0 q = ["Sheldon", "Leonard", "Penny", "Rajesh", "Howard"] while target > 0: index = 0 for i in range(5): target -= multiplier if target <= 0: break index += 1 multiplier *= 2 print(q[index]) ```
3.977
959
A
Mahmoud and Ehab and the even-odd game
PROGRAMMING
800
[ "games", "math" ]
null
null
Mahmoud and Ehab play a game called the even-odd game. Ehab chooses his favorite integer *n* and then they take turns, starting from Mahmoud. In each player's turn, he has to choose an integer *a* and subtract it from *n* such that: - 1<=≤<=*a*<=≤<=*n*. - If it's Mahmoud's turn, *a* has to be even, but if it's Ehab's turn, *a* has to be odd. If the current player can't choose any number satisfying the conditions, he loses. Can you determine the winner if they both play optimally?
The only line contains an integer *n* (1<=≤<=*n*<=≤<=109), the number at the beginning of the game.
Output "Mahmoud" (without quotes) if Mahmoud wins and "Ehab" (without quotes) otherwise.
[ "1\n", "2\n" ]
[ "Ehab", "Mahmoud" ]
In the first sample, Mahmoud can't choose any integer *a* initially because there is no positive even integer less than or equal to 1 so Ehab wins. In the second sample, Mahmoud has to choose *a* = 2 and subtract it from *n*. It's Ehab's turn and *n* = 0. There is no positive odd integer less than or equal to 0 so Mahmoud wins.
500
[ { "input": "1", "output": "Ehab" }, { "input": "2", "output": "Mahmoud" }, { "input": "10000", "output": "Mahmoud" }, { "input": "33333", "output": "Ehab" }, { "input": "5", "output": "Ehab" }, { "input": "1000000000", "output": "Mahmoud" }, { "input": "999999999", "output": "Ehab" }, { "input": "123123123", "output": "Ehab" }, { "input": "22222221", "output": "Ehab" }, { "input": "22222220", "output": "Mahmoud" }, { "input": "3", "output": "Ehab" }, { "input": "4", "output": "Mahmoud" }, { "input": "6", "output": "Mahmoud" }, { "input": "7", "output": "Ehab" }, { "input": "8", "output": "Mahmoud" }, { "input": "9", "output": "Ehab" }, { "input": "10", "output": "Mahmoud" }, { "input": "536870912", "output": "Mahmoud" }, { "input": "536870913", "output": "Ehab" }, { "input": "536870911", "output": "Ehab" } ]
1,631,613,761
2,147,483,647
Python 3
OK
TESTS
20
62
7,065,600
#!/usr/bin/env python import sys, math, itertools if __name__ == '__main__': wtf = sys.stdin.read() wtf = wtf.strip().split('\n') n = int(wtf[0]) ans = ["Mahmoud", "Ehab"] ct = 0 while n > 0: if ct == 0: if n % 2 == 0: print(ans[ct]) break else: if n - 2 > 0: n -= 2 ct = 1 else: if n % 2 != 0: print(ans[ct]) break else: if n - 1 > 0: n -= 1 ct = 0
Title: Mahmoud and Ehab and the even-odd game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mahmoud and Ehab play a game called the even-odd game. Ehab chooses his favorite integer *n* and then they take turns, starting from Mahmoud. In each player's turn, he has to choose an integer *a* and subtract it from *n* such that: - 1<=≤<=*a*<=≤<=*n*. - If it's Mahmoud's turn, *a* has to be even, but if it's Ehab's turn, *a* has to be odd. If the current player can't choose any number satisfying the conditions, he loses. Can you determine the winner if they both play optimally? Input Specification: The only line contains an integer *n* (1<=≤<=*n*<=≤<=109), the number at the beginning of the game. Output Specification: Output "Mahmoud" (without quotes) if Mahmoud wins and "Ehab" (without quotes) otherwise. Demo Input: ['1\n', '2\n'] Demo Output: ['Ehab', 'Mahmoud'] Note: In the first sample, Mahmoud can't choose any integer *a* initially because there is no positive even integer less than or equal to 1 so Ehab wins. In the second sample, Mahmoud has to choose *a* = 2 and subtract it from *n*. It's Ehab's turn and *n* = 0. There is no positive odd integer less than or equal to 0 so Mahmoud wins.
```python #!/usr/bin/env python import sys, math, itertools if __name__ == '__main__': wtf = sys.stdin.read() wtf = wtf.strip().split('\n') n = int(wtf[0]) ans = ["Mahmoud", "Ehab"] ct = 0 while n > 0: if ct == 0: if n % 2 == 0: print(ans[ct]) break else: if n - 2 > 0: n -= 2 ct = 1 else: if n % 2 != 0: print(ans[ct]) break else: if n - 1 > 0: n -= 1 ct = 0 ```
3
278
A
Circle Line
PROGRAMMING
800
[ "implementation" ]
null
null
The circle line of the Berland subway has *n* stations. We know the distances between all pairs of neighboring stations: - *d*1 is the distance between the 1-st and the 2-nd station;- *d*2 is the distance between the 2-nd and the 3-rd station;...- *d**n*<=-<=1 is the distance between the *n*<=-<=1-th and the *n*-th station;- *d**n* is the distance between the *n*-th and the 1-st station. The trains go along the circle line in both directions. Find the shortest distance between stations with numbers *s* and *t*.
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — the number of stations on the circle line. The second line contains *n* integers *d*1,<=*d*2,<=...,<=*d**n* (1<=≤<=*d**i*<=≤<=100) — the distances between pairs of neighboring stations. The third line contains two integers *s* and *t* (1<=≤<=*s*,<=*t*<=≤<=*n*) — the numbers of stations, between which you need to find the shortest distance. These numbers can be the same. The numbers in the lines are separated by single spaces.
Print a single number — the length of the shortest path between stations number *s* and *t*.
[ "4\n2 3 4 9\n1 3\n", "4\n5 8 2 100\n4 1\n", "3\n1 1 1\n3 1\n", "3\n31 41 59\n1 1\n" ]
[ "5\n", "15\n", "1\n", "0\n" ]
In the first sample the length of path 1 → 2 → 3 equals 5, the length of path 1 → 4 → 3 equals 13. In the second sample the length of path 4 → 1 is 100, the length of path 4 → 3 → 2 → 1 is 15. In the third sample the length of path 3 → 1 is 1, the length of path 3 → 2 → 1 is 2. In the fourth sample the numbers of stations are the same, so the shortest distance equals 0.
500
[ { "input": "4\n2 3 4 9\n1 3", "output": "5" }, { "input": "4\n5 8 2 100\n4 1", "output": "15" }, { "input": "3\n1 1 1\n3 1", "output": "1" }, { "input": "3\n31 41 59\n1 1", "output": "0" }, { "input": "5\n16 13 10 30 15\n4 2", "output": "23" }, { "input": "6\n89 82 87 32 67 33\n4 4", "output": "0" }, { "input": "7\n2 3 17 10 2 2 2\n4 2", "output": "18" }, { "input": "3\n4 37 33\n3 3", "output": "0" }, { "input": "8\n87 40 96 7 86 86 72 97\n6 8", "output": "158" }, { "input": "10\n91 94 75 99 100 91 79 86 79 92\n2 8", "output": "348" }, { "input": "19\n1 1 1 1 2 1 1 1 1 1 2 1 3 2 2 1 1 1 2\n7 7", "output": "0" }, { "input": "34\n96 65 24 99 74 76 97 93 99 69 94 82 92 91 98 83 95 97 96 81 90 95 86 87 43 78 88 86 82 62 76 99 83 96\n21 16", "output": "452" }, { "input": "50\n75 98 65 75 99 89 84 65 9 53 62 61 61 53 80 7 6 47 86 1 89 27 67 1 31 39 53 92 19 20 76 41 60 15 29 94 76 82 87 89 93 38 42 6 87 36 100 97 93 71\n2 6", "output": "337" }, { "input": "99\n1 15 72 78 23 22 26 98 7 2 75 58 100 98 45 79 92 69 79 72 33 88 62 9 15 87 17 73 68 54 34 89 51 91 28 44 20 11 74 7 85 61 30 46 95 72 36 18 48 22 42 46 29 46 86 53 96 55 98 34 60 37 75 54 1 81 20 68 84 19 18 18 75 84 86 57 73 34 23 43 81 87 47 96 57 41 69 1 52 44 54 7 85 35 5 1 19 26 7\n4 64", "output": "1740" }, { "input": "100\n33 63 21 27 49 82 86 93 43 55 4 72 89 85 5 34 80 7 23 13 21 49 22 73 89 65 81 25 6 92 82 66 58 88 48 96 1 1 16 48 67 96 84 63 87 76 20 100 36 4 31 41 35 62 55 76 74 70 68 41 4 16 39 81 2 41 34 73 66 57 41 89 78 93 68 96 87 47 92 60 40 58 81 12 19 74 56 83 56 61 83 97 26 92 62 52 39 57 89 95\n71 5", "output": "2127" }, { "input": "100\n95 98 99 81 98 96 100 92 96 90 99 91 98 98 91 78 97 100 96 98 87 93 96 99 91 92 96 92 90 97 85 83 99 95 66 91 87 89 100 95 100 88 99 84 96 79 99 100 94 100 99 99 92 89 99 91 100 94 98 97 91 92 90 87 84 99 97 98 93 100 90 85 75 95 86 71 98 93 91 87 92 95 98 94 95 94 100 98 96 100 97 96 95 95 86 86 94 97 98 96\n67 57", "output": "932" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 97 100 100 100 100 100 99 100 100 99 99 100 99 100 100 100 100 100 100 100 100 100 97 99 98 98 100 98 98 100 99 100 100 100 100 99 100 98 100 99 98 99 98 98 100 100 100 100 100 100 100 100 100 100 99 100 100 100 100 100 98 100 99 99 100 96 100 96 100 99 100 100 99 100 99 100 100 100 99 100 100 100 100 98 98 97 100 100 99 98\n16 6", "output": "997" }, { "input": "100\n3 6 23 4 23 1 2 14 2 3 3 9 17 8 10 5 1 14 8 5 7 4 13 8 5 6 24 3 12 3 4 9 2 8 2 1 2 1 3 2 1 6 14 23 8 6 3 5 7 8 18 9 2 5 22 6 13 16 2 4 31 20 4 3 3 6 6 1 1 18 5 11 1 14 4 16 6 37 11 1 8 3 7 11 21 14 3 3 12 2 5 1 9 16 3 1 3 4 4 2\n98 24", "output": "195" }, { "input": "100\n1 1 3 1 1 2 1 2 1 1 2 2 2 1 1 1 1 1 1 3 1 1 1 3 1 3 3 1 1 2 1 1 1 1 1 2 1 1 1 4 1 1 3 3 2 1 1 1 1 1 2 2 1 3 1 1 1 2 4 1 1 2 5 2 1 1 2 1 1 1 2 3 1 1 1 1 2 1 1 1 1 2 1 1 1 1 1 2 2 3 1 7 3 1 3 1 2 1 2 1\n49 10", "output": "60" }, { "input": "100\n75 62 31 96 62 76 93 96 72 67 88 35 67 34 60 56 95 86 82 48 64 61 74 100 56 98 76 98 78 55 53 10 12 78 58 45 86 90 93 77 69 73 88 66 92 88 33 50 95 69 89 12 93 57 93 89 59 53 71 86 15 13 61 93 24 100 58 76 46 95 76 82 50 20 79 38 5 72 99 81 55 90 90 65 85 44 63 39 6 34 98 72 88 30 59 73 84 61 25 67\n86 25", "output": "2523" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100\n1 51", "output": "5000" }, { "input": "4\n1 1 1 1\n2 4", "output": "2" }, { "input": "4\n1 1 2 1\n2 4", "output": "2" } ]
1,496,867,069
2,147,483,647
Python 3
OK
TESTS
23
124
0
x = int(input()) y = list(map(int, input().split())) a, b = sorted(list(map(int, input().split()))) ab = sum(y[a-1:b-1]) ba = sum(y) - ab if ab < ba: print(ab) else: print(ba)
Title: Circle Line Time Limit: None seconds Memory Limit: None megabytes Problem Description: The circle line of the Berland subway has *n* stations. We know the distances between all pairs of neighboring stations: - *d*1 is the distance between the 1-st and the 2-nd station;- *d*2 is the distance between the 2-nd and the 3-rd station;...- *d**n*<=-<=1 is the distance between the *n*<=-<=1-th and the *n*-th station;- *d**n* is the distance between the *n*-th and the 1-st station. The trains go along the circle line in both directions. Find the shortest distance between stations with numbers *s* and *t*. Input Specification: The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — the number of stations on the circle line. The second line contains *n* integers *d*1,<=*d*2,<=...,<=*d**n* (1<=≤<=*d**i*<=≤<=100) — the distances between pairs of neighboring stations. The third line contains two integers *s* and *t* (1<=≤<=*s*,<=*t*<=≤<=*n*) — the numbers of stations, between which you need to find the shortest distance. These numbers can be the same. The numbers in the lines are separated by single spaces. Output Specification: Print a single number — the length of the shortest path between stations number *s* and *t*. Demo Input: ['4\n2 3 4 9\n1 3\n', '4\n5 8 2 100\n4 1\n', '3\n1 1 1\n3 1\n', '3\n31 41 59\n1 1\n'] Demo Output: ['5\n', '15\n', '1\n', '0\n'] Note: In the first sample the length of path 1 → 2 → 3 equals 5, the length of path 1 → 4 → 3 equals 13. In the second sample the length of path 4 → 1 is 100, the length of path 4 → 3 → 2 → 1 is 15. In the third sample the length of path 3 → 1 is 1, the length of path 3 → 2 → 1 is 2. In the fourth sample the numbers of stations are the same, so the shortest distance equals 0.
```python x = int(input()) y = list(map(int, input().split())) a, b = sorted(list(map(int, input().split()))) ab = sum(y[a-1:b-1]) ba = sum(y) - ab if ab < ba: print(ab) else: print(ba) ```
3
615
A
Bulbs
PROGRAMMING
800
[ "implementation" ]
null
null
Vasya wants to turn on Christmas lights consisting of *m* bulbs. Initially, all bulbs are turned off. There are *n* buttons, each of them is connected to some set of bulbs. Vasya can press any of these buttons. When the button is pressed, it turns on all the bulbs it's connected to. Can Vasya light up all the bulbs? If Vasya presses the button such that some bulbs connected to it are already turned on, they do not change their state, i.e. remain turned on.
The first line of the input contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of buttons and the number of bulbs respectively. Each of the next *n* lines contains *x**i* (0<=≤<=*x**i*<=≤<=*m*) — the number of bulbs that are turned on by the *i*-th button, and then *x**i* numbers *y**ij* (1<=≤<=*y**ij*<=≤<=*m*) — the numbers of these bulbs.
If it's possible to turn on all *m* bulbs print "YES", otherwise print "NO".
[ "3 4\n2 1 4\n3 1 3 1\n1 2\n", "3 3\n1 1\n1 2\n1 1\n" ]
[ "YES\n", "NO\n" ]
In the first sample you can press each button once and turn on all the bulbs. In the 2 sample it is impossible to turn on the 3-rd lamp.
500
[ { "input": "3 4\n2 1 4\n3 1 3 1\n1 2", "output": "YES" }, { "input": "3 3\n1 1\n1 2\n1 1", "output": "NO" }, { "input": "3 4\n1 1\n1 2\n1 3", "output": "NO" }, { "input": "1 5\n5 1 2 3 4 5", "output": "YES" }, { "input": "1 5\n5 4 4 1 2 3", "output": "NO" }, { "input": "1 5\n5 1 1 1 1 5", "output": "NO" }, { "input": "2 5\n4 3 1 4 2\n4 2 3 4 5", "output": "YES" }, { "input": "5 7\n2 6 7\n5 1 1 1 1 1\n3 6 5 4\n0\n4 4 3 2 1", "output": "YES" }, { "input": "100 100\n0\n0\n0\n1 53\n0\n0\n1 34\n1 54\n0\n1 14\n0\n1 33\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 82\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 34\n0\n0\n1 26\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 34\n0\n0\n0\n0\n0\n1 3\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 40\n0\n0\n0\n1 26\n0\n0\n0\n0\n0\n1 97\n0\n1 5\n0\n0\n0\n0\n0", "output": "NO" }, { "input": "100 100\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0", "output": "NO" }, { "input": "5 6\n3 1 2 6\n3 1 2 6\n1 1\n2 3 4\n3 1 5 6", "output": "YES" }, { "input": "5 2\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "NO" }, { "input": "1 4\n3 1 2 3", "output": "NO" }, { "input": "1 4\n3 2 3 4", "output": "NO" }, { "input": "2 4\n3 2 3 4\n1 1", "output": "YES" }, { "input": "2 4\n3 1 2 3\n1 4", "output": "YES" }, { "input": "5 1\n0\n0\n0\n0\n0", "output": "NO" }, { "input": "1 1\n0", "output": "NO" }, { "input": "1 10\n10 1 2 3 4 5 6 7 8 9 10", "output": "YES" }, { "input": "1 1\n1 1", "output": "YES" }, { "input": "1 100\n99 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99", "output": "NO" }, { "input": "1 3\n3 1 2 1", "output": "NO" }, { "input": "1 100\n100 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "YES" } ]
1,604,312,145
2,147,483,647
Python 3
OK
TESTS
45
109
614,400
n , m = map(int,input().split()) b1 = [] for i in range (n): a = input().split() for j in a[1:]: b1.append(j) b2 = list(set(b1)) if m == len(b2): print('YES') else: print('NO')
Title: Bulbs Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya wants to turn on Christmas lights consisting of *m* bulbs. Initially, all bulbs are turned off. There are *n* buttons, each of them is connected to some set of bulbs. Vasya can press any of these buttons. When the button is pressed, it turns on all the bulbs it's connected to. Can Vasya light up all the bulbs? If Vasya presses the button such that some bulbs connected to it are already turned on, they do not change their state, i.e. remain turned on. Input Specification: The first line of the input contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of buttons and the number of bulbs respectively. Each of the next *n* lines contains *x**i* (0<=≤<=*x**i*<=≤<=*m*) — the number of bulbs that are turned on by the *i*-th button, and then *x**i* numbers *y**ij* (1<=≤<=*y**ij*<=≤<=*m*) — the numbers of these bulbs. Output Specification: If it's possible to turn on all *m* bulbs print "YES", otherwise print "NO". Demo Input: ['3 4\n2 1 4\n3 1 3 1\n1 2\n', '3 3\n1 1\n1 2\n1 1\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample you can press each button once and turn on all the bulbs. In the 2 sample it is impossible to turn on the 3-rd lamp.
```python n , m = map(int,input().split()) b1 = [] for i in range (n): a = input().split() for j in a[1:]: b1.append(j) b2 = list(set(b1)) if m == len(b2): print('YES') else: print('NO') ```
3
75
A
Life Without Zeros
PROGRAMMING
1,000
[ "implementation" ]
A. Life Without Zeros
2
256
Can you imagine our life if we removed all zeros from it? For sure we will have many problems. In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros? For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation. But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation.
The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*.
The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise.
[ "101\n102\n", "105\n106\n" ]
[ "YES\n", "NO\n" ]
none
500
[ { "input": "101\n102", "output": "YES" }, { "input": "105\n106", "output": "NO" }, { "input": "544\n397", "output": "YES" }, { "input": "822\n280", "output": "NO" }, { "input": "101\n413", "output": "NO" }, { "input": "309\n139", "output": "NO" }, { "input": "693\n970", "output": "NO" }, { "input": "981\n1", "output": "YES" }, { "input": "352\n276", "output": "YES" }, { "input": "164\n691", "output": "YES" }, { "input": "110036\n43", "output": "YES" }, { "input": "100\n1000", "output": "NO" }, { "input": "1000000000\n1000000000", "output": "YES" }, { "input": "999999999\n999999999", "output": "YES" }, { "input": "6\n4", "output": "NO" }, { "input": "123456\n876543", "output": "YES" }, { "input": "1234567\n9876543", "output": "NO" }, { "input": "1111111\n1119111", "output": "NO" }, { "input": "10502405\n40403403", "output": "YES" }, { "input": "1\n1", "output": "YES" }, { "input": "5\n4", "output": "YES" }, { "input": "1\n6", "output": "YES" }, { "input": "40\n17", "output": "NO" }, { "input": "35\n81", "output": "YES" }, { "input": "347\n908", "output": "NO" }, { "input": "2081\n7450", "output": "NO" }, { "input": "84355694\n373629503", "output": "NO" }, { "input": "885992048\n510468672", "output": "NO" }, { "input": "540144752\n647307841", "output": "NO" }, { "input": "341781108\n784147010", "output": "NO" }, { "input": "960440938\n572334653", "output": "NO" }, { "input": "657414510\n768771903", "output": "NO" }, { "input": "501871728\n725074574", "output": "NO" }, { "input": "968\n851", "output": "YES" }, { "input": "943\n939", "output": "YES" }, { "input": "347\n908", "output": "NO" }, { "input": "611\n41", "output": "YES" }, { "input": "737\n289", "output": "NO" }, { "input": "168\n571", "output": "YES" }, { "input": "868\n463", "output": "YES" }, { "input": "815732007\n913882008", "output": "NO" }, { "input": "459039901\n453033850", "output": "NO" }, { "input": "975305404\n484601256", "output": "NO" } ]
1,663,485,859
2,147,483,647
Python 3
OK
TESTS
43
92
0
n=int(input()) k=int(input()) p=n+k a=b=c='' n=str(n) for i in n: if i!='0': a+=i k=str(k) for i in k: if i!='0': b+=i q=str(p) for i in q: if i!='0': c+=i if int(a)+int(b)==int(c): print('YES') else: print('NO')
Title: Life Without Zeros Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Can you imagine our life if we removed all zeros from it? For sure we will have many problems. In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros? For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation. But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation. Input Specification: The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*. Output Specification: The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise. Demo Input: ['101\n102\n', '105\n106\n'] Demo Output: ['YES\n', 'NO\n'] Note: none
```python n=int(input()) k=int(input()) p=n+k a=b=c='' n=str(n) for i in n: if i!='0': a+=i k=str(k) for i in k: if i!='0': b+=i q=str(p) for i in q: if i!='0': c+=i if int(a)+int(b)==int(c): print('YES') else: print('NO') ```
3.977
294
C
Shaass and Lights
PROGRAMMING
1,900
[ "combinatorics", "number theory" ]
null
null
There are *n* lights aligned in a row. These lights are numbered 1 to *n* from left to right. Initially some of the lights are switched on. Shaass wants to switch all the lights on. At each step he can switch a light on (this light should be switched off at that moment) if there's at least one adjacent light which is already switched on. He knows the initial state of lights and he's wondering how many different ways there exist to switch all the lights on. Please find the required number of ways modulo 1000000007 (109<=+<=7).
The first line of the input contains two integers *n* and *m* where *n* is the number of lights in the sequence and *m* is the number of lights which are initially switched on, (1<=≤<=*n*<=≤<=1000,<=1<=≤<=*m*<=≤<=*n*). The second line contains *m* distinct integers, each between 1 to *n* inclusive, denoting the indices of lights which are initially switched on.
In the only line of the output print the number of different possible ways to switch on all the lights modulo 1000000007 (109<=+<=7).
[ "3 1\n1\n", "4 2\n1 4\n", "11 2\n4 8\n" ]
[ "1\n", "2\n", "6720\n" ]
none
1,500
[ { "input": "3 1\n1", "output": "1" }, { "input": "4 2\n1 4", "output": "2" }, { "input": "11 2\n4 8", "output": "6720" }, { "input": "4 2\n1 3", "output": "2" }, { "input": "4 4\n1 2 3 4", "output": "1" }, { "input": "4 2\n1 3", "output": "2" }, { "input": "4 4\n1 2 3 4", "output": "1" }, { "input": "1000 3\n100 900 10", "output": "727202008" }, { "input": "74 13\n6 14 19 20 21 24 30 43 58 61 69 70 73", "output": "16623551" }, { "input": "74 13\n6 14 19 20 21 24 30 43 58 61 69 70 73", "output": "16623551" }, { "input": "74 13\n6 14 19 20 21 24 30 43 58 61 69 70 73", "output": "16623551" }, { "input": "74 13\n6 14 19 20 21 24 30 43 58 61 69 70 73", "output": "16623551" }, { "input": "74 13\n6 14 19 20 21 24 30 43 58 61 69 70 73", "output": "16623551" }, { "input": "74 13\n6 14 19 20 21 24 30 43 58 61 69 70 73", "output": "16623551" }, { "input": "68 37\n1 2 3 6 7 8 10 11 12 14 16 18 22 23 24 26 30 31 32 35 37 39 41 42 45 47 50 51 52 54 58 59 61 62 63 64 68", "output": "867201120" }, { "input": "132 48\n6 7 8 12 15 17 18 19 22 24 25 26 30 33 35 38 40 43 46 49 50 51 52 54 59 60 66 70 76 79 87 89 91 92 94 98 99 101 102 105 106 109 113 115 116 118 120 129", "output": "376947760" }, { "input": "36 24\n1 7 8 10 11 12 13 14 15 16 17 19 21 22 25 26 27 28 29 30 31 32 35 36", "output": "63866880" }, { "input": "100 100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "1" }, { "input": "100 2\n11 64", "output": "910895596" }, { "input": "100 90\n1 2 3 4 5 7 8 9 10 11 12 13 15 16 17 18 19 20 21 22 23 24 25 27 28 29 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 58 59 60 61 62 63 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 82 83 84 86 87 88 89 90 91 92 94 95 96 98 99 100", "output": "3628800" }, { "input": "1000 1\n35", "output": "253560421" }, { "input": "1000 2\n747 798", "output": "474746180" }, { "input": "1000 3\n804 811 984", "output": "600324842" }, { "input": "1 1\n1", "output": "1" } ]
1,603,178,099
2,147,483,647
PyPy 3
OK
TESTS
30
140
1,638,400
M= 1000000007 f = [1]*2000 for i in range(1,2000): f[i]=f[i-1]*i%M n,m = map(int,input().split()) a = sorted(map(int,input().split())) b = [] for i in range (1,m): x=a[i]-a[i-1]-1 if(x>0): b.append(x) count = pow(2,sum(b)-len(b),M)*f[n-m]%M b = [a[0]-1]+b+[n-a[-1]] for i in b: count = count*pow(f[i],M-2,M)%M print(count)
Title: Shaass and Lights Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are *n* lights aligned in a row. These lights are numbered 1 to *n* from left to right. Initially some of the lights are switched on. Shaass wants to switch all the lights on. At each step he can switch a light on (this light should be switched off at that moment) if there's at least one adjacent light which is already switched on. He knows the initial state of lights and he's wondering how many different ways there exist to switch all the lights on. Please find the required number of ways modulo 1000000007 (109<=+<=7). Input Specification: The first line of the input contains two integers *n* and *m* where *n* is the number of lights in the sequence and *m* is the number of lights which are initially switched on, (1<=≤<=*n*<=≤<=1000,<=1<=≤<=*m*<=≤<=*n*). The second line contains *m* distinct integers, each between 1 to *n* inclusive, denoting the indices of lights which are initially switched on. Output Specification: In the only line of the output print the number of different possible ways to switch on all the lights modulo 1000000007 (109<=+<=7). Demo Input: ['3 1\n1\n', '4 2\n1 4\n', '11 2\n4 8\n'] Demo Output: ['1\n', '2\n', '6720\n'] Note: none
```python M= 1000000007 f = [1]*2000 for i in range(1,2000): f[i]=f[i-1]*i%M n,m = map(int,input().split()) a = sorted(map(int,input().split())) b = [] for i in range (1,m): x=a[i]-a[i-1]-1 if(x>0): b.append(x) count = pow(2,sum(b)-len(b),M)*f[n-m]%M b = [a[0]-1]+b+[n-a[-1]] for i in b: count = count*pow(f[i],M-2,M)%M print(count) ```
3
544
A
Set of Strings
PROGRAMMING
1,100
[ "implementation", "strings" ]
null
null
You are given a string *q*. A sequence of *k* strings *s*1,<=*s*2,<=...,<=*s**k* is called beautiful, if the concatenation of these strings is string *q* (formally, *s*1<=+<=*s*2<=+<=...<=+<=*s**k*<==<=*q*) and the first characters of these strings are distinct. Find any beautiful sequence of strings or determine that the beautiful sequence doesn't exist.
The first line contains a positive integer *k* (1<=≤<=*k*<=≤<=26) — the number of strings that should be in a beautiful sequence. The second line contains string *q*, consisting of lowercase Latin letters. The length of the string is within range from 1 to 100, inclusive.
If such sequence doesn't exist, then print in a single line "NO" (without the quotes). Otherwise, print in the first line "YES" (without the quotes) and in the next *k* lines print the beautiful sequence of strings *s*1,<=*s*2,<=...,<=*s**k*. If there are multiple possible answers, print any of them.
[ "1\nabca\n", "2\naaacas\n", "4\nabc\n" ]
[ "YES\nabca\n", "YES\naaa\ncas\n", "NO\n" ]
In the second sample there are two possible answers: {"*aaaca*", "*s*"} and {"*aaa*", "*cas*"}.
500
[ { "input": "1\nabca", "output": "YES\nabca" }, { "input": "2\naaacas", "output": "YES\naaa\ncas" }, { "input": "4\nabc", "output": "NO" }, { "input": "3\nnddkhkhkdndknndkhrnhddkrdhrnrrnkkdnnndndrdhnknknhnrnnkrrdhrkhkrkhnkhkhhrhdnrndnknrrhdrdrkhdrkkhkrnkk", "output": "YES\nn\ndd\nkhkhkdndknndkhrnhddkrdhrnrrnkkdnnndndrdhnknknhnrnnkrrdhrkhkrkhnkhkhhrhdnrndnknrrhdrdrkhdrkkhkrnkk" }, { "input": "26\nbiibfmmfifmffbmmfmbmbmiimbmiffmffibibfbiffibibiiimbffbbfbifmiibffbmbbbfmfibmibfffibfbffmfmimbmmmfmfm", "output": "NO" }, { "input": "3\nkydoybxlfeugtrbvqnrjtzshorrsrwsxkvlwyolbaadtzpmyyfllxuciia", "output": "YES\nk\ny\ndoybxlfeugtrbvqnrjtzshorrsrwsxkvlwyolbaadtzpmyyfllxuciia" }, { "input": "3\nssussususskkskkskuusksuuussksukkskuksukukusssususuususkkuukssuksskusukkssuksskskuskusussusskskksksus", "output": "YES\nss\nussususs\nkkskkskuusksuuussksukkskuksukukusssususuususkkuukssuksskusukkssuksskskuskusussusskskksksus" }, { "input": "5\naaaaabcdef", "output": "YES\naaaaa\nb\nc\nd\nef" }, { "input": "3\niiiiiiimiriiriwmimtmwrhhxmbmhwgghhgbqhywebrblyhlxjrthoooltehrmdhqhuodjmsjwcgrfnttiitpmqvbhlafwtzyikc", "output": "YES\niiiiiii\nmi\nriiriwmimtmwrhhxmbmhwgghhgbqhywebrblyhlxjrthoooltehrmdhqhuodjmsjwcgrfnttiitpmqvbhlafwtzyikc" }, { "input": "20\ngggggllglgllltgtlglttstsgtttsslhhlssghgagtlsaghhoggtfgsaahtotdodthfltdxggxislnttlanxonhnkddtigppitdh", "output": "NO" }, { "input": "16\nkkkkkkyykkynkknkkonyokdndkyonokdywkwykdkdotknnwzkoywiooinkcyzyntcdnitnppnpziomyzdspomoqmomcyrrospppn", "output": "NO" }, { "input": "15\nwwwgggowgwwhoohwgwghwyohhggywhyyodgwydwgggkhgyydqyggkgkpokgthqghidhworprodtcogqkwgtfiodwdurcctkmrfmh", "output": "YES\nwww\nggg\nowgww\nhoohwgwghw\nyohhggywhyyo\ndgwydwggg\nkhgyyd\nqyggkgk\npokg\nthqgh\nidhwo\nrprodt\ncogqkwgt\nfiodwd\nurcctkmrfmh" }, { "input": "15\nnnnnnntnttttttqqnqqynnqqwwnnnwneenhwtyhhoqeyeqyeuthwtnhtpnphhwetjhouhwnpojvvovoswwjryrwerbwwpbvrwvjj", "output": "YES\nnnnnnn\ntntttttt\nqqnqq\nynnqq\nwwnnnwn\neen\nhwtyhh\noqeyeqye\nuthwtnht\npnphhwet\njhouhwnpoj\nvvovo\nswwj\nryrwer\nbwwpbvrwvjj" }, { "input": "15\nvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvv", "output": "NO" }, { "input": "1\niiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiaaaaaiiiiaiaiiiiaaiaiiiaiiaiaaiaiiaiiiiiaiiiaiiiaiaiaai", "output": "YES\niiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiaaaaaiiiiaiaiiiiaaiaiiiaiiaiaaiaiiaiiiiiaiiiaiiiaiaiaai" }, { "input": "26\nvvvnnsnnnpsnnswwspncvshtncwphaphmwnwkhvvhuvctvnehemowkmtzissswjaxuuvphzrmfzihamdqmmyhhijbitlipgltyy", "output": "YES\nvvv\nnn\nsnnn\npsnns\nwwspn\ncvs\nh\ntncwph\naph\nmwnw\nkhvvh\nuvctvn\nehem\nowkmt\nz\nisssw\nja\nxuuvphz\nrm\nfziham\nd\nqmm\nyhhij\nbit\nlip\ngltyy" }, { "input": "26\njexzsbwaih", "output": "NO" }, { "input": "1\nk", "output": "YES\nk" }, { "input": "1\nzz", "output": "YES\nzz" }, { "input": "3\nziw", "output": "YES\nz\ni\nw" }, { "input": "26\ntjmbyqwuahlixegopkzrfndcsv", "output": "YES\nt\nj\nm\nb\ny\nq\nw\nu\na\nh\nl\ni\nx\ne\ng\no\np\nk\nz\nr\nf\nn\nd\nc\ns\nv" }, { "input": "25\nvobekscyadzqwnjxruplifmthg", "output": "YES\nv\no\nb\ne\nk\ns\nc\ny\na\nd\nz\nq\nw\nn\nj\nx\nr\nu\np\nl\ni\nf\nm\nt\nhg" }, { "input": "26\nlllplzkkzflzflffzznnnnfgflqlttlmtnkzlztskngyymitqagattkdllyutzimsrskpapcmuupjdopxqlnhqcscwvdtxbflefy", "output": "YES\nlll\npl\nz\nkkz\nflzflffzz\nnnnnf\ngfl\nql\nttl\nmtnkzlzt\nskng\nyym\nitq\nagattk\ndlly\nutzims\nrskpap\ncmuup\njd\nop\nxqln\nhqcsc\nw\nvdtx\nbfl\nefy" }, { "input": "25\nkkrrkrkrkrsrskpskbrppdsdbgbkrbllkbswdwcchgskmkhwiidicczlscsodtjglxbmeotzxnmbjmoqgkquglaoxgcykxvbhdi", "output": "YES\nkk\nrrkrkrkr\nsrsk\npsk\nbrpp\ndsdb\ngbkrb\nllkbs\nwdw\ncc\nhgsk\nmkhw\niidicc\nzlscs\nod\nt\njgl\nxbm\neotzx\nnmbjmo\nqgkq\nugl\naoxgc\nykx\nvbhdi" }, { "input": "25\nuuuuuccpucubccbupxubcbpujiliwbpqbpyiweuywaxwqasbsllwehceruytjvphytraawgbjmerfeymoayujqranlvkpkiypadr", "output": "YES\nuuuuu\ncc\npucu\nbccbup\nxubcbpu\nj\ni\nli\nwbp\nqbp\nyiw\neuyw\naxwqa\nsbsllwe\nhce\nruy\ntj\nvphytraaw\ngbj\nmer\nfeym\noayujqra\nnlv\nkpkiypa\ndr" }, { "input": "26\nxxjxodrogovufvohrodliretxxyjqnrbzmicorptkjafiwmsbwml", "output": "YES\nxx\njx\no\nd\nro\ngo\nv\nu\nfvo\nhrod\nl\nir\ne\ntxx\nyj\nq\nnr\nb\nz\nmi\ncor\npt\nkj\nafi\nwm\nsbwml" }, { "input": "26\npjhsxjbvkqntwmsdnrguecaofylzti", "output": "YES\np\nj\nh\ns\nxj\nb\nv\nk\nq\nn\nt\nw\nms\ndn\nr\ng\nu\ne\nc\na\no\nf\ny\nl\nzt\ni" }, { "input": "25\nrrrrqqwrlqrwglrlylwhrrwyvrhvzgvqahrhgsvavtggyduayivxzgeicinlnrkapoepbsfyjjrt", "output": "YES\nrrrr\nqq\nwr\nlqrw\nglrl\nylw\nhrrwy\nvrhv\nzgvq\nahrhg\nsvav\ntggy\nd\nuay\niv\nxzg\nei\nci\nnlnr\nka\np\noep\nbs\nfy\njjrt" }, { "input": "26\ncccccccaacwwaxxaacczacnnnqqwnaggzqrwagcnabxnrcvgjqjamqzgdntzanaxvjfwqlvdttuzjoxiwtkqvrydospmpeirhg", "output": "YES\nccccccc\naac\nwwa\nxxaacc\nzac\nnnn\nqqwna\nggzq\nrwagcna\nbxnrc\nvg\njqja\nmqzg\ndn\ntzanaxvj\nfwq\nlvdtt\nuzj\nox\niwt\nkqvr\nydo\ns\npmp\neir\nhg" }, { "input": "4\nsssssssssssssssssssssssssslsslslsllsslssslslssllaaslsaalsasaassllasasalrlrslarlaarlsrsaslasarlr", "output": "YES\nssssssssssssssssssssssssss\nlsslslsllsslssslslssll\naaslsaalsasaassllasasal\nrlrslarlaarlsrsaslasarlr" }, { "input": "26\na", "output": "NO" }, { "input": "26\nab", "output": "NO" }, { "input": "2\nab", "output": "YES\na\nb" } ]
1,618,139,215
2,147,483,647
PyPy 3
OK
TESTS
33
93
0
n = int(input()) s = input() arr = set(list(s)) if len(arr) < n: print("NO") else: ans = [] d = {} for i in s: if i in d: ans[-1] += i else: d[i] = 1 ans.append(i) print("YES") for i in ans[:n-1]: print(i) print(''.join(ans[n-1:]))
Title: Set of Strings Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given a string *q*. A sequence of *k* strings *s*1,<=*s*2,<=...,<=*s**k* is called beautiful, if the concatenation of these strings is string *q* (formally, *s*1<=+<=*s*2<=+<=...<=+<=*s**k*<==<=*q*) and the first characters of these strings are distinct. Find any beautiful sequence of strings or determine that the beautiful sequence doesn't exist. Input Specification: The first line contains a positive integer *k* (1<=≤<=*k*<=≤<=26) — the number of strings that should be in a beautiful sequence. The second line contains string *q*, consisting of lowercase Latin letters. The length of the string is within range from 1 to 100, inclusive. Output Specification: If such sequence doesn't exist, then print in a single line "NO" (without the quotes). Otherwise, print in the first line "YES" (without the quotes) and in the next *k* lines print the beautiful sequence of strings *s*1,<=*s*2,<=...,<=*s**k*. If there are multiple possible answers, print any of them. Demo Input: ['1\nabca\n', '2\naaacas\n', '4\nabc\n'] Demo Output: ['YES\nabca\n', 'YES\naaa\ncas\n', 'NO\n'] Note: In the second sample there are two possible answers: {"*aaaca*", "*s*"} and {"*aaa*", "*cas*"}.
```python n = int(input()) s = input() arr = set(list(s)) if len(arr) < n: print("NO") else: ans = [] d = {} for i in s: if i in d: ans[-1] += i else: d[i] = 1 ans.append(i) print("YES") for i in ans[:n-1]: print(i) print(''.join(ans[n-1:])) ```
3
439
B
Devu, the Dumb Guy
PROGRAMMING
1,200
[ "implementation", "sortings" ]
null
null
Devu is a dumb guy, his learning curve is very slow. You are supposed to teach him *n* subjects, the *i**th* subject has *c**i* chapters. When you teach him, you are supposed to teach all the chapters of a subject continuously. Let us say that his initial per chapter learning power of a subject is *x* hours. In other words he can learn a chapter of a particular subject in *x* hours. Well Devu is not complete dumb, there is a good thing about him too. If you teach him a subject, then time required to teach any chapter of the next subject will require exactly 1 hour less than previously required (see the examples to understand it more clearly). Note that his per chapter learning power can not be less than 1 hour. You can teach him the *n* subjects in any possible order. Find out minimum amount of time (in hours) Devu will take to understand all the subjects and you will be free to do some enjoying task rather than teaching a dumb guy. Please be careful that answer might not fit in 32 bit data type.
The first line will contain two space separated integers *n*, *x* (1<=≤<=*n*,<=*x*<=≤<=105). The next line will contain *n* space separated integers: *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=105).
Output a single integer representing the answer to the problem.
[ "2 3\n4 1\n", "4 2\n5 1 2 1\n", "3 3\n1 1 1\n" ]
[ "11\n", "10\n", "6\n" ]
Look at the first example. Consider the order of subjects: 1, 2. When you teach Devu the first subject, it will take him 3 hours per chapter, so it will take 12 hours to teach first subject. After teaching first subject, his per chapter learning time will be 2 hours. Now teaching him second subject will take 2 × 1 = 2 hours. Hence you will need to spend 12 + 2 = 14 hours. Consider the order of subjects: 2, 1. When you teach Devu the second subject, then it will take him 3 hours per chapter, so it will take 3 × 1 = 3 hours to teach the second subject. After teaching the second subject, his per chapter learning time will be 2 hours. Now teaching him the first subject will take 2 × 4 = 8 hours. Hence you will need to spend 11 hours. So overall, minimum of both the cases is 11 hours. Look at the third example. The order in this example doesn't matter. When you teach Devu the first subject, it will take him 3 hours per chapter. When you teach Devu the second subject, it will take him 2 hours per chapter. When you teach Devu the third subject, it will take him 1 hours per chapter. In total it takes 6 hours.
1,000
[ { "input": "2 3\n4 1", "output": "11" }, { "input": "4 2\n5 1 2 1", "output": "10" }, { "input": "3 3\n1 1 1", "output": "6" }, { "input": "20 4\n1 1 3 5 5 1 3 4 2 5 2 4 3 1 3 3 3 3 4 3", "output": "65" }, { "input": "20 10\n6 6 1 2 6 4 5 3 6 5 4 5 6 5 4 6 6 2 3 3", "output": "196" }, { "input": "1 1\n9273", "output": "9273" }, { "input": "1 1\n1", "output": "1" }, { "input": "1 2\n1", "output": "2" }, { "input": "1 2\n2", "output": "4" }, { "input": "2 1\n1 2", "output": "3" } ]
1,559,319,141
2,147,483,647
Python 3
OK
TESTS
31
187
7,372,800
n,x = [int(i) for i in input().split()] arr = sorted([int(i) for i in input().split()]) ans = 0 for i in arr: if x>1: ans+=i*x x-=1 else: ans+=i print(ans)
Title: Devu, the Dumb Guy Time Limit: None seconds Memory Limit: None megabytes Problem Description: Devu is a dumb guy, his learning curve is very slow. You are supposed to teach him *n* subjects, the *i**th* subject has *c**i* chapters. When you teach him, you are supposed to teach all the chapters of a subject continuously. Let us say that his initial per chapter learning power of a subject is *x* hours. In other words he can learn a chapter of a particular subject in *x* hours. Well Devu is not complete dumb, there is a good thing about him too. If you teach him a subject, then time required to teach any chapter of the next subject will require exactly 1 hour less than previously required (see the examples to understand it more clearly). Note that his per chapter learning power can not be less than 1 hour. You can teach him the *n* subjects in any possible order. Find out minimum amount of time (in hours) Devu will take to understand all the subjects and you will be free to do some enjoying task rather than teaching a dumb guy. Please be careful that answer might not fit in 32 bit data type. Input Specification: The first line will contain two space separated integers *n*, *x* (1<=≤<=*n*,<=*x*<=≤<=105). The next line will contain *n* space separated integers: *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=105). Output Specification: Output a single integer representing the answer to the problem. Demo Input: ['2 3\n4 1\n', '4 2\n5 1 2 1\n', '3 3\n1 1 1\n'] Demo Output: ['11\n', '10\n', '6\n'] Note: Look at the first example. Consider the order of subjects: 1, 2. When you teach Devu the first subject, it will take him 3 hours per chapter, so it will take 12 hours to teach first subject. After teaching first subject, his per chapter learning time will be 2 hours. Now teaching him second subject will take 2 × 1 = 2 hours. Hence you will need to spend 12 + 2 = 14 hours. Consider the order of subjects: 2, 1. When you teach Devu the second subject, then it will take him 3 hours per chapter, so it will take 3 × 1 = 3 hours to teach the second subject. After teaching the second subject, his per chapter learning time will be 2 hours. Now teaching him the first subject will take 2 × 4 = 8 hours. Hence you will need to spend 11 hours. So overall, minimum of both the cases is 11 hours. Look at the third example. The order in this example doesn't matter. When you teach Devu the first subject, it will take him 3 hours per chapter. When you teach Devu the second subject, it will take him 2 hours per chapter. When you teach Devu the third subject, it will take him 1 hours per chapter. In total it takes 6 hours.
```python n,x = [int(i) for i in input().split()] arr = sorted([int(i) for i in input().split()]) ans = 0 for i in arr: if x>1: ans+=i*x x-=1 else: ans+=i print(ans) ```
3
658
A
Bear and Reverse Radewoosh
PROGRAMMING
800
[ "implementation" ]
null
null
Limak and Radewoosh are going to compete against each other in the upcoming algorithmic contest. They are equally skilled but they won't solve problems in the same order. There will be *n* problems. The *i*-th problem has initial score *p**i* and it takes exactly *t**i* minutes to solve it. Problems are sorted by difficulty — it's guaranteed that *p**i*<=&lt;<=*p**i*<=+<=1 and *t**i*<=&lt;<=*t**i*<=+<=1. A constant *c* is given too, representing the speed of loosing points. Then, submitting the *i*-th problem at time *x* (*x* minutes after the start of the contest) gives *max*(0,<= *p**i*<=-<=*c*·*x*) points. Limak is going to solve problems in order 1,<=2,<=...,<=*n* (sorted increasingly by *p**i*). Radewoosh is going to solve them in order *n*,<=*n*<=-<=1,<=...,<=1 (sorted decreasingly by *p**i*). Your task is to predict the outcome — print the name of the winner (person who gets more points at the end) or a word "Tie" in case of a tie. You may assume that the duration of the competition is greater or equal than the sum of all *t**i*. That means both Limak and Radewoosh will accept all *n* problems.
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=50,<=1<=≤<=*c*<=≤<=1000) — the number of problems and the constant representing the speed of loosing points. The second line contains *n* integers *p*1,<=*p*2,<=...,<=*p**n* (1<=≤<=*p**i*<=≤<=1000,<=*p**i*<=&lt;<=*p**i*<=+<=1) — initial scores. The third line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000,<=*t**i*<=&lt;<=*t**i*<=+<=1) where *t**i* denotes the number of minutes one needs to solve the *i*-th problem.
Print "Limak" (without quotes) if Limak will get more points in total. Print "Radewoosh" (without quotes) if Radewoosh will get more points in total. Print "Tie" (without quotes) if Limak and Radewoosh will get the same total number of points.
[ "3 2\n50 85 250\n10 15 25\n", "3 6\n50 85 250\n10 15 25\n", "8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76\n" ]
[ "Limak\n", "Radewoosh\n", "Tie\n" ]
In the first sample, there are 3 problems. Limak solves them as follows: 1. Limak spends 10 minutes on the 1-st problem and he gets 50 - *c*·10 = 50 - 2·10 = 30 points. 1. Limak spends 15 minutes on the 2-nd problem so he submits it 10 + 15 = 25 minutes after the start of the contest. For the 2-nd problem he gets 85 - 2·25 = 35 points. 1. He spends 25 minutes on the 3-rd problem so he submits it 10 + 15 + 25 = 50 minutes after the start. For this problem he gets 250 - 2·50 = 150 points. So, Limak got 30 + 35 + 150 = 215 points. Radewoosh solves problem in the reversed order: 1. Radewoosh solves 3-rd problem after 25 minutes so he gets 250 - 2·25 = 200 points. 1. He spends 15 minutes on the 2-nd problem so he submits it 25 + 15 = 40 minutes after the start. He gets 85 - 2·40 = 5 points for this problem. 1. He spends 10 minutes on the 1-st problem so he submits it 25 + 15 + 10 = 50 minutes after the start. He gets *max*(0, 50 - 2·50) = *max*(0,  - 50) = 0 points. Radewoosh got 200 + 5 + 0 = 205 points in total. Limak has 215 points so Limak wins. In the second sample, Limak will get 0 points for each problem and Radewoosh will first solve the hardest problem and he will get 250 - 6·25 = 100 points for that. Radewoosh will get 0 points for other two problems but he is the winner anyway. In the third sample, Limak will get 2 points for the 1-st problem and 2 points for the 2-nd problem. Radewoosh will get 4 points for the 8-th problem. They won't get points for other problems and thus there is a tie because 2 + 2 = 4.
500
[ { "input": "3 2\n50 85 250\n10 15 25", "output": "Limak" }, { "input": "3 6\n50 85 250\n10 15 25", "output": "Radewoosh" }, { "input": "8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76", "output": "Tie" }, { "input": "4 1\n3 5 6 9\n1 2 4 8", "output": "Limak" }, { "input": "4 1\n1 3 6 10\n1 5 7 8", "output": "Radewoosh" }, { "input": "4 1\n2 4 5 10\n2 3 9 10", "output": "Tie" }, { "input": "18 4\n68 97 121 132 146 277 312 395 407 431 458 461 595 634 751 855 871 994\n1 2 3 4 9 10 13 21 22 29 31 34 37 38 39 41 48 49", "output": "Radewoosh" }, { "input": "50 1\n5 14 18 73 137 187 195 197 212 226 235 251 262 278 287 304 310 322 342 379 393 420 442 444 448 472 483 485 508 515 517 523 559 585 618 627 636 646 666 682 703 707 780 853 937 951 959 989 991 992\n30 84 113 173 199 220 235 261 266 277 300 306 310 312 347 356 394 396 397 409 414 424 446 462 468 487 507 517 537 566 594 643 656 660 662 668 706 708 773 774 779 805 820 827 868 896 929 942 961 995", "output": "Tie" }, { "input": "4 1\n4 6 9 10\n2 3 4 5", "output": "Radewoosh" }, { "input": "4 1\n4 6 9 10\n3 4 5 7", "output": "Radewoosh" }, { "input": "4 1\n1 6 7 10\n2 7 8 10", "output": "Tie" }, { "input": "4 1\n4 5 7 9\n1 4 5 8", "output": "Limak" }, { "input": "50 1\n6 17 44 82 94 127 134 156 187 211 212 252 256 292 294 303 352 355 379 380 398 409 424 434 480 524 584 594 631 714 745 756 777 778 789 793 799 821 841 849 859 878 879 895 925 932 944 952 958 990\n15 16 40 42 45 71 99 100 117 120 174 181 186 204 221 268 289 332 376 394 403 409 411 444 471 487 499 539 541 551 567 589 619 623 639 669 689 722 735 776 794 822 830 840 847 907 917 927 936 988", "output": "Radewoosh" }, { "input": "50 10\n25 49 52 73 104 117 127 136 149 164 171 184 226 251 257 258 286 324 337 341 386 390 428 453 464 470 492 517 543 565 609 634 636 660 678 693 710 714 729 736 739 749 781 836 866 875 956 960 977 979\n2 4 7 10 11 22 24 26 27 28 31 35 37 38 42 44 45 46 52 53 55 56 57 59 60 61 64 66 67 68 69 71 75 76 77 78 79 81 83 85 86 87 89 90 92 93 94 98 99 100", "output": "Limak" }, { "input": "50 10\n11 15 25 71 77 83 95 108 143 150 182 183 198 203 213 223 279 280 346 348 350 355 375 376 412 413 415 432 470 545 553 562 589 595 607 633 635 637 688 719 747 767 771 799 842 883 905 924 942 944\n1 3 5 6 7 10 11 12 13 14 15 16 19 20 21 23 25 32 35 36 37 38 40 41 42 43 47 50 51 54 55 56 57 58 59 60 62 63 64 65 66 68 69 70 71 72 73 75 78 80", "output": "Radewoosh" }, { "input": "32 6\n25 77 141 148 157 159 192 196 198 244 245 255 332 392 414 457 466 524 575 603 629 700 738 782 838 841 845 847 870 945 984 985\n1 2 4 5 8 9 10 12 13 14 15 16 17 18 20 21 22 23 24 26 28 31 38 39 40 41 42 43 45 47 48 49", "output": "Radewoosh" }, { "input": "5 1\n256 275 469 671 842\n7 9 14 17 26", "output": "Limak" }, { "input": "2 1000\n1 2\n1 2", "output": "Tie" }, { "input": "3 1\n1 50 809\n2 8 800", "output": "Limak" }, { "input": "1 13\n866\n10", "output": "Tie" }, { "input": "15 1\n9 11 66 128 199 323 376 386 393 555 585 718 935 960 971\n3 11 14 19 20 21 24 26 32 38 40 42 44 47 50", "output": "Limak" }, { "input": "1 10\n546\n45", "output": "Tie" }, { "input": "50 20\n21 43 51 99 117 119 158 167 175 190 196 244 250 316 335 375 391 403 423 428 451 457 460 480 487 522 539 559 566 584 598 602 604 616 626 666 675 730 771 787 828 841 861 867 886 889 898 970 986 991\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50", "output": "Limak" }, { "input": "50 21\n13 20 22 38 62 84 118 135 141 152 170 175 194 218 227 229 232 253 260 263 278 313 329 357 396 402 422 452 454 533 575 576 580 594 624 644 653 671 676 759 789 811 816 823 831 833 856 924 933 987\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50", "output": "Tie" }, { "input": "1 36\n312\n42", "output": "Tie" }, { "input": "1 1000\n1\n1000", "output": "Tie" }, { "input": "1 1\n1000\n1", "output": "Tie" }, { "input": "50 35\n9 17 28 107 136 152 169 174 186 188 201 262 291 312 324 330 341 358 385 386 393 397 425 431 479 498 502 523 530 540 542 554 578 588 622 623 684 696 709 722 784 819 836 845 850 932 945 969 983 984\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50", "output": "Tie" }, { "input": "50 20\n12 113 116 120 138 156 167 183 185 194 211 228 234 261 278 287 310 317 346 361 364 397 424 470 496 522 527 536 611 648 668 704 707 712 717 752 761 766 815 828 832 864 872 885 889 901 904 929 982 993\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50", "output": "Limak" } ]
1,566,913,202
2,147,483,647
Python 3
OK
TESTS
29
109
0
# import sys # sys.stdin=open("input.in","r") # sys.stdout=open("output.out","w") a,b=map(int,input().split()) i=list(map(int,input().split())) j=list(map(int,input().split())) Limak,Radewoosh,d,e=0,0,0,0 for x in range(a): d+=j[x] Limak+=max(0,(i[x]-d*b)) e+=j[a-1-x] Radewoosh+=max(0,(i[a-1-x]-e*b)) # print(d,e,Limak,Radewoosh) if Limak==Radewoosh: print('Tie') elif Limak>Radewoosh: print('Limak') else: print('Radewoosh')
Title: Bear and Reverse Radewoosh Time Limit: None seconds Memory Limit: None megabytes Problem Description: Limak and Radewoosh are going to compete against each other in the upcoming algorithmic contest. They are equally skilled but they won't solve problems in the same order. There will be *n* problems. The *i*-th problem has initial score *p**i* and it takes exactly *t**i* minutes to solve it. Problems are sorted by difficulty — it's guaranteed that *p**i*<=&lt;<=*p**i*<=+<=1 and *t**i*<=&lt;<=*t**i*<=+<=1. A constant *c* is given too, representing the speed of loosing points. Then, submitting the *i*-th problem at time *x* (*x* minutes after the start of the contest) gives *max*(0,<= *p**i*<=-<=*c*·*x*) points. Limak is going to solve problems in order 1,<=2,<=...,<=*n* (sorted increasingly by *p**i*). Radewoosh is going to solve them in order *n*,<=*n*<=-<=1,<=...,<=1 (sorted decreasingly by *p**i*). Your task is to predict the outcome — print the name of the winner (person who gets more points at the end) or a word "Tie" in case of a tie. You may assume that the duration of the competition is greater or equal than the sum of all *t**i*. That means both Limak and Radewoosh will accept all *n* problems. Input Specification: The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=50,<=1<=≤<=*c*<=≤<=1000) — the number of problems and the constant representing the speed of loosing points. The second line contains *n* integers *p*1,<=*p*2,<=...,<=*p**n* (1<=≤<=*p**i*<=≤<=1000,<=*p**i*<=&lt;<=*p**i*<=+<=1) — initial scores. The third line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000,<=*t**i*<=&lt;<=*t**i*<=+<=1) where *t**i* denotes the number of minutes one needs to solve the *i*-th problem. Output Specification: Print "Limak" (without quotes) if Limak will get more points in total. Print "Radewoosh" (without quotes) if Radewoosh will get more points in total. Print "Tie" (without quotes) if Limak and Radewoosh will get the same total number of points. Demo Input: ['3 2\n50 85 250\n10 15 25\n', '3 6\n50 85 250\n10 15 25\n', '8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76\n'] Demo Output: ['Limak\n', 'Radewoosh\n', 'Tie\n'] Note: In the first sample, there are 3 problems. Limak solves them as follows: 1. Limak spends 10 minutes on the 1-st problem and he gets 50 - *c*·10 = 50 - 2·10 = 30 points. 1. Limak spends 15 minutes on the 2-nd problem so he submits it 10 + 15 = 25 minutes after the start of the contest. For the 2-nd problem he gets 85 - 2·25 = 35 points. 1. He spends 25 minutes on the 3-rd problem so he submits it 10 + 15 + 25 = 50 minutes after the start. For this problem he gets 250 - 2·50 = 150 points. So, Limak got 30 + 35 + 150 = 215 points. Radewoosh solves problem in the reversed order: 1. Radewoosh solves 3-rd problem after 25 minutes so he gets 250 - 2·25 = 200 points. 1. He spends 15 minutes on the 2-nd problem so he submits it 25 + 15 = 40 minutes after the start. He gets 85 - 2·40 = 5 points for this problem. 1. He spends 10 minutes on the 1-st problem so he submits it 25 + 15 + 10 = 50 minutes after the start. He gets *max*(0, 50 - 2·50) = *max*(0,  - 50) = 0 points. Radewoosh got 200 + 5 + 0 = 205 points in total. Limak has 215 points so Limak wins. In the second sample, Limak will get 0 points for each problem and Radewoosh will first solve the hardest problem and he will get 250 - 6·25 = 100 points for that. Radewoosh will get 0 points for other two problems but he is the winner anyway. In the third sample, Limak will get 2 points for the 1-st problem and 2 points for the 2-nd problem. Radewoosh will get 4 points for the 8-th problem. They won't get points for other problems and thus there is a tie because 2 + 2 = 4.
```python # import sys # sys.stdin=open("input.in","r") # sys.stdout=open("output.out","w") a,b=map(int,input().split()) i=list(map(int,input().split())) j=list(map(int,input().split())) Limak,Radewoosh,d,e=0,0,0,0 for x in range(a): d+=j[x] Limak+=max(0,(i[x]-d*b)) e+=j[a-1-x] Radewoosh+=max(0,(i[a-1-x]-e*b)) # print(d,e,Limak,Radewoosh) if Limak==Radewoosh: print('Tie') elif Limak>Radewoosh: print('Limak') else: print('Radewoosh') ```
3
762
A
k-th divisor
PROGRAMMING
1,400
[ "math", "number theory" ]
null
null
You are given two integers *n* and *k*. Find *k*-th smallest divisor of *n*, or report that it doesn't exist. Divisor of *n* is any such natural number, that *n* can be divided by it without remainder.
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=1015, 1<=≤<=*k*<=≤<=109).
If *n* has less than *k* divisors, output -1. Otherwise, output the *k*-th smallest divisor of *n*.
[ "4 2\n", "5 3\n", "12 5\n" ]
[ "2\n", "-1\n", "6\n" ]
In the first example, number 4 has three divisors: 1, 2 and 4. The second one is 2. In the second example, number 5 has only two divisors: 1 and 5. The third divisor doesn't exist, so the answer is -1.
0
[ { "input": "4 2", "output": "2" }, { "input": "5 3", "output": "-1" }, { "input": "12 5", "output": "6" }, { "input": "1 1", "output": "1" }, { "input": "866421317361600 26880", "output": "866421317361600" }, { "input": "866421317361600 26881", "output": "-1" }, { "input": "1000000000000000 1000000000", "output": "-1" }, { "input": "1000000000000000 100", "output": "1953125" }, { "input": "1 2", "output": "-1" }, { "input": "4 3", "output": "4" }, { "input": "4 4", "output": "-1" }, { "input": "9 3", "output": "9" }, { "input": "21 3", "output": "7" }, { "input": "67280421310721 1", "output": "1" }, { "input": "6 3", "output": "3" }, { "input": "3 3", "output": "-1" }, { "input": "16 3", "output": "4" }, { "input": "1 1000", "output": "-1" }, { "input": "16 4", "output": "8" }, { "input": "36 8", "output": "18" }, { "input": "49 4", "output": "-1" }, { "input": "9 4", "output": "-1" }, { "input": "16 1", "output": "1" }, { "input": "16 6", "output": "-1" }, { "input": "16 5", "output": "16" }, { "input": "25 4", "output": "-1" }, { "input": "4010815561 2", "output": "63331" }, { "input": "49 3", "output": "49" }, { "input": "36 6", "output": "9" }, { "input": "36 10", "output": "-1" }, { "input": "25 3", "output": "25" }, { "input": "22876792454961 28", "output": "7625597484987" }, { "input": "1234 2", "output": "2" }, { "input": "179458711 2", "output": "179458711" }, { "input": "900104343024121 100000", "output": "-1" }, { "input": "8 3", "output": "4" }, { "input": "100 6", "output": "20" }, { "input": "15500 26", "output": "-1" }, { "input": "111111 1", "output": "1" }, { "input": "100000000000000 200", "output": "160000000000" }, { "input": "1000000000000 100", "output": "6400000" }, { "input": "100 10", "output": "-1" }, { "input": "1000000000039 2", "output": "1000000000039" }, { "input": "64 5", "output": "16" }, { "input": "999999961946176 33", "output": "63245552" }, { "input": "376219076689 3", "output": "376219076689" }, { "input": "999999961946176 63", "output": "999999961946176" }, { "input": "1048576 12", "output": "2048" }, { "input": "745 21", "output": "-1" }, { "input": "748 6", "output": "22" }, { "input": "999999961946176 50", "output": "161082468097" }, { "input": "10 3", "output": "5" }, { "input": "1099511627776 22", "output": "2097152" }, { "input": "1000000007 100010", "output": "-1" }, { "input": "3 1", "output": "1" }, { "input": "100 8", "output": "50" }, { "input": "100 7", "output": "25" }, { "input": "7 2", "output": "7" }, { "input": "999999961946176 64", "output": "-1" }, { "input": "20 5", "output": "10" }, { "input": "999999999999989 2", "output": "999999999999989" }, { "input": "100000000000000 114", "output": "10240000" }, { "input": "99999640000243 3", "output": "9999991" }, { "input": "999998000001 566", "output": "333332666667" }, { "input": "99999820000081 2", "output": "9999991" }, { "input": "49000042000009 3", "output": "49000042000009" }, { "input": "151491429961 4", "output": "-1" }, { "input": "32416190071 2", "output": "32416190071" }, { "input": "1000 8", "output": "25" }, { "input": "1999967841 15", "output": "1999967841" }, { "input": "26880 26880", "output": "-1" }, { "input": "151491429961 3", "output": "151491429961" }, { "input": "90000000000 300", "output": "100000000" }, { "input": "98765004361 10", "output": "-1" }, { "input": "15 2", "output": "3" }, { "input": "16 2", "output": "2" }, { "input": "1996 2", "output": "2" }, { "input": "1997 2", "output": "1997" }, { "input": "1999 2", "output": "1999" }, { "input": "1998 2", "output": "2" }, { "input": "1998 1", "output": "1" }, { "input": "1998 7", "output": "27" }, { "input": "1998 8", "output": "37" }, { "input": "100000380000361 2", "output": "10000019" }, { "input": "15 1", "output": "1" }, { "input": "100000000000000 226", "output": "-1" }, { "input": "844030857550613 517", "output": "-1" }, { "input": "4567890 14", "output": "430" }, { "input": "123123123 123123123", "output": "-1" }, { "input": "24 4", "output": "4" }, { "input": "999999993568952 17", "output": "31622777" }, { "input": "99999999994190 9", "output": "241656799" }, { "input": "999997874844049 4", "output": "-1" }, { "input": "99999999999931 2", "output": "99999999999931" }, { "input": "2 3", "output": "-1" }, { "input": "67280421310721 2", "output": "67280421310721" } ]
1,666,328,140
2,147,483,647
PyPy 3-64
OK
TESTS
96
451
2,252,800
n,k=map(int,input().split()) def divisors(n): lower,upper=[],[] i=1 while i*i<=n: if n%i==0: lower.append(i) if i!=n//i: upper.append(n//i) i+=1 return lower+upper[::-1] d=divisors(n) if len(d)>=k: print(d[k-1]) else: print(-1)
Title: k-th divisor Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given two integers *n* and *k*. Find *k*-th smallest divisor of *n*, or report that it doesn't exist. Divisor of *n* is any such natural number, that *n* can be divided by it without remainder. Input Specification: The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=1015, 1<=≤<=*k*<=≤<=109). Output Specification: If *n* has less than *k* divisors, output -1. Otherwise, output the *k*-th smallest divisor of *n*. Demo Input: ['4 2\n', '5 3\n', '12 5\n'] Demo Output: ['2\n', '-1\n', '6\n'] Note: In the first example, number 4 has three divisors: 1, 2 and 4. The second one is 2. In the second example, number 5 has only two divisors: 1 and 5. The third divisor doesn't exist, so the answer is -1.
```python n,k=map(int,input().split()) def divisors(n): lower,upper=[],[] i=1 while i*i<=n: if n%i==0: lower.append(i) if i!=n//i: upper.append(n//i) i+=1 return lower+upper[::-1] d=divisors(n) if len(d)>=k: print(d[k-1]) else: print(-1) ```
3
520
A
Pangram
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
A word or a sentence in some language is called a pangram if all the characters of the alphabet of this language appear in it at least once. Pangrams are often used to demonstrate fonts in printing or test the output devices. You are given a string consisting of lowercase and uppercase Latin letters. Check whether this string is a pangram. We say that the string contains a letter of the Latin alphabet if this letter occurs in the string in uppercase or lowercase.
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of characters in the string. The second line contains the string. The string consists only of uppercase and lowercase Latin letters.
Output "YES", if the string is a pangram and "NO" otherwise.
[ "12\ntoosmallword\n", "35\nTheQuickBrownFoxJumpsOverTheLazyDog\n" ]
[ "NO\n", "YES\n" ]
none
500
[ { "input": "12\ntoosmallword", "output": "NO" }, { "input": "35\nTheQuickBrownFoxJumpsOverTheLazyDog", "output": "YES" }, { "input": "1\na", "output": "NO" }, { "input": "26\nqwertyuiopasdfghjklzxcvbnm", "output": "YES" }, { "input": "26\nABCDEFGHIJKLMNOPQRSTUVWXYZ", "output": "YES" }, { "input": "48\nthereisasyetinsufficientdataforameaningfulanswer", "output": "NO" }, { "input": "30\nToBeOrNotToBeThatIsTheQuestion", "output": "NO" }, { "input": "30\njackdawslovemybigsphinxofquarz", "output": "NO" }, { "input": "31\nTHEFIVEBOXINGWIZARDSJUMPQUICKLY", "output": "YES" }, { "input": "26\naaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "NO" }, { "input": "26\nMGJYIZDKsbhpVeNFlquRTcWoAx", "output": "YES" }, { "input": "26\nfWMOhAPsbIVtyUEZrGNQXDklCJ", "output": "YES" }, { "input": "26\nngPMVFSThiRCwLEuyOAbKxQzDJ", "output": "YES" }, { "input": "25\nnxYTzLFwzNolAumjgcAboyxAj", "output": "NO" }, { "input": "26\npRWdodGdxUESvcScPGbUoooZsC", "output": "NO" }, { "input": "66\nBovdMlDzTaqKllZILFVfxbLGsRnzmtVVTmqiIDTYrossLEPlmsPrkUYtWEsGHVOnFj", "output": "NO" }, { "input": "100\nmKtsiDRJypUieHIkvJaMFkwaKxcCIbBszZQLIyPpCDCjhNpAnYFngLjRpnKWpKWtGnwoSteeZXuFHWQxxxOpFlNeYTwKocsXuCoa", "output": "YES" }, { "input": "26\nEoqxUbsLjPytUHMiFnvcGWZdRK", "output": "NO" }, { "input": "26\nvCUFRKElZOnjmXGylWQaHDiPst", "output": "NO" }, { "input": "26\nWtrPuaHdXLKJMsnvQfgOiJZBEY", "output": "NO" }, { "input": "26\npGiFluRteQwkaVoPszJyNBChxM", "output": "NO" }, { "input": "26\ncTUpqjPmANrdbzSFhlWIoKxgVY", "output": "NO" }, { "input": "26\nLndjgvAEuICHKxPwqYztosrmBN", "output": "NO" }, { "input": "26\nMdaXJrCipnOZLykfqHWEStevbU", "output": "NO" }, { "input": "26\nEjDWsVxfKTqGXRnUMOLYcIzPba", "output": "NO" }, { "input": "26\nxKwzRMpunYaqsdfaBgJcVElTHo", "output": "NO" }, { "input": "26\nnRYUQsTwCPLZkgshfEXvBdoiMa", "output": "NO" }, { "input": "26\nHNCQPfJutyAlDGsvRxZWMEbIdO", "output": "NO" }, { "input": "26\nDaHJIpvKznQcmUyWsTGObXRFDe", "output": "NO" }, { "input": "26\nkqvAnFAiRhzlJbtyuWedXSPcOG", "output": "NO" }, { "input": "26\nhlrvgdwsIOyjcmUZXtAKEqoBpF", "output": "NO" }, { "input": "26\njLfXXiMhBTcAwQVReGnpKzdsYu", "output": "NO" }, { "input": "26\nlNMcVuwItjxRBGAekjhyDsQOzf", "output": "NO" }, { "input": "26\nRkSwbNoYldUGtAZvpFMcxhIJFE", "output": "NO" }, { "input": "26\nDqspXZJTuONYieKgaHLMBwfVSC", "output": "NO" }, { "input": "26\necOyUkqNljFHRVXtIpWabGMLDz", "output": "NO" }, { "input": "26\nEKAvqZhBnPmVCDRlgWJfOusxYI", "output": "NO" }, { "input": "26\naLbgqeYchKdMrsZxIPFvTOWNjA", "output": "NO" }, { "input": "26\nxfpBLsndiqtacOCHGmeWUjRkYz", "output": "NO" }, { "input": "26\nXsbRKtqleZPNIVCdfUhyagAomJ", "output": "NO" }, { "input": "26\nAmVtbrwquEthZcjKPLiyDgSoNF", "output": "NO" }, { "input": "26\nOhvXDcwqAUmSEPRZGnjFLiKtNB", "output": "NO" }, { "input": "26\nEKWJqCFLRmstxVBdYuinpbhaOg", "output": "NO" }, { "input": "26\nmnbvcxxlkjhgfdsapoiuytrewq", "output": "NO" }, { "input": "26\naAbcdefghijklmnopqrstuvwxy", "output": "NO" }, { "input": "30\nABCDEFGHTYRIOPLabcdefghtyriopl", "output": "NO" }, { "input": "25\nabcdefghijklmnopqrstuvwxy", "output": "NO" }, { "input": "26\nabcdefhijklmnopqrstVxyzABC", "output": "NO" }, { "input": "25\nqwertyuiopasdfghjklxcvbnm", "output": "NO" }, { "input": "34\nTheQuickBrownFoxJumpsOverTheLayDog", "output": "NO" }, { "input": "26\nabcdefghigklmnopqrstuvwxyz", "output": "NO" }, { "input": "26\nabcdefghijklmnopqrstuvwxyA", "output": "NO" }, { "input": "50\nqazwsxedcrfvtgbyhnujmikolQWERTYUIOASDFGHJKLZXCVBNM", "output": "NO" }, { "input": "35\nTheQuickBrownFoxJumpsOverTheLasyDog", "output": "NO" }, { "input": "25\nbcdefghijklmnopqrstuvwxyz", "output": "NO" }, { "input": "38\nAbCdEfGhIjKlMnOpQrStVwXyZzzzzzzaaaaaaa", "output": "NO" }, { "input": "26\nabcdefghiklmnopqrstvxyzABC", "output": "NO" }, { "input": "26\nabcdefghijklmnopqrstuvwxzZ", "output": "NO" }, { "input": "50\nabcdefghijklmnopqrstuvwxyABCDEFGHIJKLMNOPQRSTUVWXY", "output": "NO" } ]
1,696,589,196
2,147,483,647
Python 3
OK
TESTS
59
46
0
n = int(input()) print(('NO', 'YES')[len({x for x in input().lower()}) == 26])
Title: Pangram Time Limit: None seconds Memory Limit: None megabytes Problem Description: A word or a sentence in some language is called a pangram if all the characters of the alphabet of this language appear in it at least once. Pangrams are often used to demonstrate fonts in printing or test the output devices. You are given a string consisting of lowercase and uppercase Latin letters. Check whether this string is a pangram. We say that the string contains a letter of the Latin alphabet if this letter occurs in the string in uppercase or lowercase. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of characters in the string. The second line contains the string. The string consists only of uppercase and lowercase Latin letters. Output Specification: Output "YES", if the string is a pangram and "NO" otherwise. Demo Input: ['12\ntoosmallword\n', '35\nTheQuickBrownFoxJumpsOverTheLazyDog\n'] Demo Output: ['NO\n', 'YES\n'] Note: none
```python n = int(input()) print(('NO', 'YES')[len({x for x in input().lower()}) == 26]) ```
3
56
A
Bar
PROGRAMMING
1,000
[ "implementation" ]
A. Bar
2
256
According to Berland laws it is only allowed to sell alcohol to people not younger than 18 years. Vasya's job is to monitor the law's enforcement. Tonight he entered a bar and saw *n* people sitting there. For every one of them Vasya happened to determine either the age or the drink the person is having. Vasya can check any person, i.e. learn his age and the drink he is having at the same time. What minimal number of people should Vasya check additionally to make sure that there are no clients under 18 having alcohol drinks? The list of all alcohol drinks in Berland is: ABSINTH, BEER, BRANDY, CHAMPAGNE, GIN, RUM, SAKE, TEQUILA, VODKA, WHISKEY, WINE
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) which is the number of the bar's clients. Then follow *n* lines, each describing one visitor. A line either contains his age (an integer from 0 to 1000) or his drink (a string of capital Latin letters from 1 to 100 in length). It is guaranteed that the input data does not contain spaces and other unnecessary separators. Only the drinks from the list given above should be considered alcohol.
Print a single number which is the number of people Vasya should check to guarantee the law enforcement.
[ "5\n18\nVODKA\nCOKE\n19\n17\n" ]
[ "2\n" ]
In the sample test the second and fifth clients should be checked.
500
[ { "input": "5\n18\nVODKA\nCOKE\n19\n17", "output": "2" }, { "input": "2\n2\nGIN", "output": "2" }, { "input": "3\nWHISKEY\n3\nGIN", "output": "3" }, { "input": "4\n813\nIORBQITQXMPTFAEMEQDQIKFGKGOTNKTOSZCBRPXJLUKVLVHJYNRUJXK\nRUM\nRHVRWGODYWWTYZFLFYKCVUFFRTQDINKNWPKFHZBFWBHWINWJW", "output": "1" }, { "input": "4\nSAKE\nSAKE\n13\n2", "output": "4" }, { "input": "2\n0\n17", "output": "2" }, { "input": "1\n0", "output": "1" } ]
1,544,429,792
2,147,483,647
Python 3
OK
TESTS
28
216
0
alc = ['ABSINTH', 'BEER', 'BRANDY', 'CHAMPAGNE', 'GIN', 'RUM', 'SAKE', 'TEQUILA', 'VODKA', 'WHISKEY', 'WINE'] numb = [] for i in range(1001): numb.append(str(i)) n = int(input()) ans = [] count = 0 for i in range(n): z = input() if z in alc: count+=1 if z in numb: if int(z)<18: count+=1 print(count)
Title: Bar Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: According to Berland laws it is only allowed to sell alcohol to people not younger than 18 years. Vasya's job is to monitor the law's enforcement. Tonight he entered a bar and saw *n* people sitting there. For every one of them Vasya happened to determine either the age or the drink the person is having. Vasya can check any person, i.e. learn his age and the drink he is having at the same time. What minimal number of people should Vasya check additionally to make sure that there are no clients under 18 having alcohol drinks? The list of all alcohol drinks in Berland is: ABSINTH, BEER, BRANDY, CHAMPAGNE, GIN, RUM, SAKE, TEQUILA, VODKA, WHISKEY, WINE Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) which is the number of the bar's clients. Then follow *n* lines, each describing one visitor. A line either contains his age (an integer from 0 to 1000) or his drink (a string of capital Latin letters from 1 to 100 in length). It is guaranteed that the input data does not contain spaces and other unnecessary separators. Only the drinks from the list given above should be considered alcohol. Output Specification: Print a single number which is the number of people Vasya should check to guarantee the law enforcement. Demo Input: ['5\n18\nVODKA\nCOKE\n19\n17\n'] Demo Output: ['2\n'] Note: In the sample test the second and fifth clients should be checked.
```python alc = ['ABSINTH', 'BEER', 'BRANDY', 'CHAMPAGNE', 'GIN', 'RUM', 'SAKE', 'TEQUILA', 'VODKA', 'WHISKEY', 'WINE'] numb = [] for i in range(1001): numb.append(str(i)) n = int(input()) ans = [] count = 0 for i in range(n): z = input() if z in alc: count+=1 if z in numb: if int(z)<18: count+=1 print(count) ```
3.946
465
A
inc ARG
PROGRAMMING
900
[ "implementation" ]
null
null
Sergey is testing a next-generation processor. Instead of bytes the processor works with memory cells consisting of *n* bits. These bits are numbered from 1 to *n*. An integer is stored in the cell in the following way: the least significant bit is stored in the first bit of the cell, the next significant bit is stored in the second bit, and so on; the most significant bit is stored in the *n*-th bit. Now Sergey wants to test the following instruction: "add 1 to the value of the cell". As a result of the instruction, the integer that is written in the cell must be increased by one; if some of the most significant bits of the resulting number do not fit into the cell, they must be discarded. Sergey wrote certain values ​​of the bits in the cell and is going to add one to its value. How many bits of the cell will change after the operation?
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of bits in the cell. The second line contains a string consisting of *n* characters — the initial state of the cell. The first character denotes the state of the first bit of the cell. The second character denotes the second least significant bit and so on. The last character denotes the state of the most significant bit.
Print a single integer — the number of bits in the cell which change their state after we add 1 to the cell.
[ "4\n1100\n", "4\n1111\n" ]
[ "3\n", "4\n" ]
In the first sample the cell ends up with value 0010, in the second sample — with 0000.
500
[ { "input": "4\n1100", "output": "3" }, { "input": "4\n1111", "output": "4" }, { "input": "1\n0", "output": "1" }, { "input": "1\n1", "output": "1" }, { "input": "2\n00", "output": "1" }, { "input": "2\n01", "output": "1" }, { "input": "2\n10", "output": "2" }, { "input": "2\n11", "output": "2" }, { "input": "10\n0000000000", "output": "1" }, { "input": "20\n11111111110110001100", "output": "11" }, { "input": "50\n01011110100010000001010000100001001101001101101011", "output": "1" }, { "input": "60\n111111111101111111111111111111111111111111111111111111111111", "output": "11" }, { "input": "60\n111111111111111111111111111111111111111111111111111111111111", "output": "60" }, { "input": "66\n111111010010011001110011000111000100011110011001111110011111111101", "output": "7" }, { "input": "90\n000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "1" }, { "input": "91\n1011111111111111111111111111111111111111111111111111111111111111111111111111111111111111111", "output": "2" }, { "input": "92\n11111111101011111011111111111111111111111011101111111111011111111111111101111111101011111101", "output": "10" }, { "input": "100\n0001011110100011001100100010111001000001111101101001001001001011110100101101010000000110100101110010", "output": "1" }, { "input": "100\n0111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111", "output": "1" }, { "input": "100\n0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "1" }, { "input": "100\n0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "1" }, { "input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111", "output": "100" }, { "input": "100\n1011001110001000011111110011000100001110010110111101110110011011011000010100110001111100000010110010", "output": "2" }, { "input": "100\n1101111011001111111111110011110111101110111111111111111111111111111111011111111111110111111111111111", "output": "3" }, { "input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111", "output": "100" }, { "input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110", "output": "100" }, { "input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111101", "output": "99" }, { "input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111100000", "output": "96" }, { "input": "100\n1111111111111111111111111111111110011000110110001010101100100100001000010010010010000100110000010101", "output": "34" } ]
1,586,939,779
2,147,483,647
PyPy 3
OK
TESTS
29
155
0
t=int(input()) s=input() l=int(s[::-1],2)+1 h=bin(l)[::-1] w=h[:-2] p=0 q=len(w) for k in range(t): if k<= q-1: if w[k]!= s[k]: p+=1 else: pass if k< t-1: print(p+ t-q) else: print(p)
Title: inc ARG Time Limit: None seconds Memory Limit: None megabytes Problem Description: Sergey is testing a next-generation processor. Instead of bytes the processor works with memory cells consisting of *n* bits. These bits are numbered from 1 to *n*. An integer is stored in the cell in the following way: the least significant bit is stored in the first bit of the cell, the next significant bit is stored in the second bit, and so on; the most significant bit is stored in the *n*-th bit. Now Sergey wants to test the following instruction: "add 1 to the value of the cell". As a result of the instruction, the integer that is written in the cell must be increased by one; if some of the most significant bits of the resulting number do not fit into the cell, they must be discarded. Sergey wrote certain values ​​of the bits in the cell and is going to add one to its value. How many bits of the cell will change after the operation? Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of bits in the cell. The second line contains a string consisting of *n* characters — the initial state of the cell. The first character denotes the state of the first bit of the cell. The second character denotes the second least significant bit and so on. The last character denotes the state of the most significant bit. Output Specification: Print a single integer — the number of bits in the cell which change their state after we add 1 to the cell. Demo Input: ['4\n1100\n', '4\n1111\n'] Demo Output: ['3\n', '4\n'] Note: In the first sample the cell ends up with value 0010, in the second sample — with 0000.
```python t=int(input()) s=input() l=int(s[::-1],2)+1 h=bin(l)[::-1] w=h[:-2] p=0 q=len(w) for k in range(t): if k<= q-1: if w[k]!= s[k]: p+=1 else: pass if k< t-1: print(p+ t-q) else: print(p) ```
3
366
B
Dima and To-do List
PROGRAMMING
1,200
[ "brute force", "implementation" ]
null
null
You helped Dima to have a great weekend, but it's time to work. Naturally, Dima, as all other men who have girlfriends, does everything wrong. Inna and Dima are now in one room. Inna tells Dima off for everything he does in her presence. After Inna tells him off for something, she goes to another room, walks there in circles muttering about how useless her sweetheart is. During that time Dima has time to peacefully complete *k*<=-<=1 tasks. Then Inna returns and tells Dima off for the next task he does in her presence and goes to another room again. It continues until Dima is through with his tasks. Overall, Dima has *n* tasks to do, each task has a unique number from 1 to *n*. Dima loves order, so he does tasks consecutively, starting from some task. For example, if Dima has 6 tasks to do in total, then, if he starts from the 5-th task, the order is like that: first Dima does the 5-th task, then the 6-th one, then the 1-st one, then the 2-nd one, then the 3-rd one, then the 4-th one. Inna tells Dima off (only lovingly and appropriately!) so often and systematically that he's very well learned the power with which she tells him off for each task. Help Dima choose the first task so that in total he gets told off with as little power as possible.
The first line of the input contains two integers *n*,<=*k* (1<=≤<=*k*<=≤<=*n*<=≤<=105). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103), where *a**i* is the power Inna tells Dima off with if she is present in the room while he is doing the *i*-th task. It is guaranteed that *n* is divisible by *k*.
In a single line print the number of the task Dima should start with to get told off with as little power as possible. If there are multiple solutions, print the one with the minimum number of the first task to do.
[ "6 2\n3 2 1 6 5 4\n", "10 5\n1 3 5 7 9 9 4 1 8 5\n" ]
[ "1\n", "3\n" ]
Explanation of the first example. If Dima starts from the first task, Inna tells him off with power 3, then Dima can do one more task (as *k* = 2), then Inna tells him off for the third task with power 1, then she tells him off for the fifth task with power 5. Thus, Dima gets told off with total power 3 + 1 + 5 = 9. If Dima started from the second task, for example, then Inna would tell him off for tasks 2, 4 and 6 with power 2 + 6 + 4 = 12. Explanation of the second example. In the second example *k* = 5, thus, Dima manages to complete 4 tasks in-between the telling off sessions. Thus, Inna tells Dima off for tasks number 1 and 6 (if he starts from 1 or 6), 2 and 7 (if he starts from 2 or 7) and so on. The optimal answer is to start from task 3 or 8, 3 has a smaller number, so the answer is 3.
1,000
[ { "input": "6 2\n3 2 1 6 5 4", "output": "1" }, { "input": "10 5\n1 3 5 7 9 9 4 1 8 5", "output": "3" }, { "input": "20 4\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1" }, { "input": "10 10\n8 4 5 7 6 9 2 2 3 5", "output": "7" }, { "input": "50 10\n1 2 3 4 5 6 7 8 9 10 10 1 1 1 1 1 1 1 1 1 10 1 1 1 1 1 1 1 1 1 10 1 1 1 1 1 1 1 1 1 10 1 1 1 1 1 1 1 1 1", "output": "2" }, { "input": "1 1\n1", "output": "1" }, { "input": "2 1\n1 1", "output": "1" }, { "input": "4 2\n2 1 1 3", "output": "1" }, { "input": "15 5\n5 5 5 5 5 1 2 3 4 5 1 2 3 4 5", "output": "1" }, { "input": "20 10\n3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 3 3 6 4", "output": "1" } ]
1,690,638,526
2,147,483,647
PyPy 3-64
OK
TESTS
36
77
13,414,400
def main(): n, k = map(int, input().split()) a = [0] * k l=list(map(int,input().split())) for i in range(n): a[i % k] += l[i] m = 0 for i in range(1, k): if a[i] < a[m]: m = i print(m + 1) if __name__ == "__main__": main()
Title: Dima and To-do List Time Limit: None seconds Memory Limit: None megabytes Problem Description: You helped Dima to have a great weekend, but it's time to work. Naturally, Dima, as all other men who have girlfriends, does everything wrong. Inna and Dima are now in one room. Inna tells Dima off for everything he does in her presence. After Inna tells him off for something, she goes to another room, walks there in circles muttering about how useless her sweetheart is. During that time Dima has time to peacefully complete *k*<=-<=1 tasks. Then Inna returns and tells Dima off for the next task he does in her presence and goes to another room again. It continues until Dima is through with his tasks. Overall, Dima has *n* tasks to do, each task has a unique number from 1 to *n*. Dima loves order, so he does tasks consecutively, starting from some task. For example, if Dima has 6 tasks to do in total, then, if he starts from the 5-th task, the order is like that: first Dima does the 5-th task, then the 6-th one, then the 1-st one, then the 2-nd one, then the 3-rd one, then the 4-th one. Inna tells Dima off (only lovingly and appropriately!) so often and systematically that he's very well learned the power with which she tells him off for each task. Help Dima choose the first task so that in total he gets told off with as little power as possible. Input Specification: The first line of the input contains two integers *n*,<=*k* (1<=≤<=*k*<=≤<=*n*<=≤<=105). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103), where *a**i* is the power Inna tells Dima off with if she is present in the room while he is doing the *i*-th task. It is guaranteed that *n* is divisible by *k*. Output Specification: In a single line print the number of the task Dima should start with to get told off with as little power as possible. If there are multiple solutions, print the one with the minimum number of the first task to do. Demo Input: ['6 2\n3 2 1 6 5 4\n', '10 5\n1 3 5 7 9 9 4 1 8 5\n'] Demo Output: ['1\n', '3\n'] Note: Explanation of the first example. If Dima starts from the first task, Inna tells him off with power 3, then Dima can do one more task (as *k* = 2), then Inna tells him off for the third task with power 1, then she tells him off for the fifth task with power 5. Thus, Dima gets told off with total power 3 + 1 + 5 = 9. If Dima started from the second task, for example, then Inna would tell him off for tasks 2, 4 and 6 with power 2 + 6 + 4 = 12. Explanation of the second example. In the second example *k* = 5, thus, Dima manages to complete 4 tasks in-between the telling off sessions. Thus, Inna tells Dima off for tasks number 1 and 6 (if he starts from 1 or 6), 2 and 7 (if he starts from 2 or 7) and so on. The optimal answer is to start from task 3 or 8, 3 has a smaller number, so the answer is 3.
```python def main(): n, k = map(int, input().split()) a = [0] * k l=list(map(int,input().split())) for i in range(n): a[i % k] += l[i] m = 0 for i in range(1, k): if a[i] < a[m]: m = i print(m + 1) if __name__ == "__main__": main() ```
3
61
A
Ultra-Fast Mathematician
PROGRAMMING
800
[ "implementation" ]
A. Ultra-Fast Mathematician
2
256
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Write one line — the corresponding answer. Do not omit the leading 0s.
[ "1010100\n0100101\n", "000\n111\n", "1110\n1010\n", "01110\n01100\n" ]
[ "1110001\n", "111\n", "0100\n", "00010\n" ]
none
500
[ { "input": "1010100\n0100101", "output": "1110001" }, { "input": "000\n111", "output": "111" }, { "input": "1110\n1010", "output": "0100" }, { "input": "01110\n01100", "output": "00010" }, { "input": "011101\n000001", "output": "011100" }, { "input": "10\n01", "output": "11" }, { "input": "00111111\n11011101", "output": "11100010" }, { "input": "011001100\n101001010", "output": "110000110" }, { "input": "1100100001\n0110101100", "output": "1010001101" }, { "input": "00011101010\n10010100101", "output": "10001001111" }, { "input": "100000101101\n111010100011", "output": "011010001110" }, { "input": "1000001111010\n1101100110001", "output": "0101101001011" }, { "input": "01011111010111\n10001110111010", "output": "11010001101101" }, { "input": "110010000111100\n001100101011010", "output": "111110101100110" }, { "input": "0010010111110000\n0000000011010110", "output": "0010010100100110" }, { "input": "00111110111110000\n01111100001100000", "output": "01000010110010000" }, { "input": "101010101111010001\n001001111101111101", "output": "100011010010101100" }, { "input": "0110010101111100000\n0011000101000000110", "output": "0101010000111100110" }, { "input": "11110100011101010111\n00001000011011000000", "output": "11111100000110010111" }, { "input": "101010101111101101001\n111010010010000011111", "output": "010000111101101110110" }, { "input": "0000111111100011000010\n1110110110110000001010", "output": "1110001001010011001000" }, { "input": "10010010101000110111000\n00101110100110111000111", "output": "10111100001110001111111" }, { "input": "010010010010111100000111\n100100111111100011001110", "output": "110110101101011111001001" }, { "input": "0101110100100111011010010\n0101100011010111001010001", "output": "0000010111110000010000011" }, { "input": "10010010100011110111111011\n10000110101100000001000100", "output": "00010100001111110110111111" }, { "input": "000001111000000100001000000\n011100111101111001110110001", "output": "011101000101111101111110001" }, { "input": "0011110010001001011001011100\n0000101101000011101011001010", "output": "0011011111001010110010010110" }, { "input": "11111000000000010011001101111\n11101110011001010100010000000", "output": "00010110011001000111011101111" }, { "input": "011001110000110100001100101100\n001010000011110000001000101001", "output": "010011110011000100000100000101" }, { "input": "1011111010001100011010110101111\n1011001110010000000101100010101", "output": "0000110100011100011111010111010" }, { "input": "10111000100001000001010110000001\n10111000001100101011011001011000", "output": "00000000101101101010001111011001" }, { "input": "000001010000100001000000011011100\n111111111001010100100001100000111", "output": "111110101001110101100001111011011" }, { "input": "1101000000000010011011101100000110\n1110000001100010011010000011011110", "output": "0011000001100000000001101111011000" }, { "input": "01011011000010100001100100011110001\n01011010111000001010010100001110000", "output": "00000001111010101011110000010000001" }, { "input": "000011111000011001000110111100000100\n011011000110000111101011100111000111", "output": "011000111110011110101101011011000011" }, { "input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000", "output": "1011001001111001001011101010101000010" }, { "input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011", "output": "10001110000010101110000111000011111110" }, { "input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100", "output": "000100001011110000011101110111010001110" }, { "input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001", "output": "1101110101010110000011000000101011110011" }, { "input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100", "output": "11001011110010010000010111001100001001110" }, { "input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110", "output": "001100101000011111111101111011101010111001" }, { "input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001", "output": "0111010010100110110101100010000100010100000" }, { "input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100", "output": "11111110000000100101000100110111001100011001" }, { "input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011", "output": "101011011100100010100011011001101010100100010" }, { "input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001", "output": "1101001100111011010111110110101111001011110111" }, { "input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001", "output": "10010101000101000000011010011110011110011110001" }, { "input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100", "output": "011011011100000000010101110010000000101000111101" }, { "input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100", "output": "0101010111101001011011110110011101010101010100011" }, { "input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011", "output": "11001011010010111000010110011101100100001110111111" }, { "input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011", "output": "111011101010011100001111101001101011110010010110001" }, { "input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001", "output": "0100111110110011111110010010010000110111100101101101" }, { "input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100", "output": "01011001110111010111001100010011010100010000111011000" }, { "input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111", "output": "100011101001001000011011011001111000100000010100100100" }, { "input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110", "output": "1100110010000101101010111111101001001001110101110010110" }, { "input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110", "output": "01000111100111001011110010100011111111110010101100001101" }, { "input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010", "output": "110001010001000011000101110101000100001011111001011001001" }, { "input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111", "output": "1110100010111000101001001011101110011111100111000011011011" }, { "input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110", "output": "01110110101110100100110011010000001000101100101111000111011" }, { "input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011", "output": "111100101000000011101011011001110010101111000110010010000000" }, { "input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111", "output": "0100100010111110010011101010000011111110001110010110010111001" }, { "input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111", "output": "00110100000011001101101100100010110010001100000001100110011101" }, { "input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011", "output": "000000011000111011110011101000010000010100101000000011010110010" }, { "input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010", "output": "0010100110110100111100100100101101010100100111011010001001010101" }, { "input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111", "output": "11010110111100101111101001100001110100010110010110110111100110100" }, { "input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111", "output": "111111010011011100101110100110111111111001111110011010111111110000" }, { "input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110", "output": "1010101010100010001001001001100000111000010010010100010011000100000" }, { "input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000", "output": "00011111011111001000011100010011100011010100101011011000001001111110" }, { "input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111", "output": "001111000011001110100111010101111111011100110011001010010010000111011" }, { "input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101", "output": "0110001100110100010000110111000010011010011000011001010011010100010100" }, { "input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010", "output": "00010000000110110101000011001000000100100110111010011111101010001010000" }, { "input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001", "output": "000100100000000110011100100001010110101001100101110010010011111001110111" }, { "input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000", "output": "1000111100010011010110011101000000101010101100011111100001101111001010010" }, { "input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011", "output": "01000010011110111001011011110000001011000111101101101010010110001010100100" }, { "input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101", "output": "101101110110110010011100001011111100100001110000101100110000100011011100110" }, { "input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001", "output": "1110111111110010111000001100101010101011010100101010100101100011001001111111" }, { "input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111", "output": "10111011000111000101110100101000100111011011100011110110000101010001111010111" }, { "input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110", "output": "110100100110000101010010011010011001100110000111010000010100001011110111111101" }, { "input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111", "output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111" }, { "input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001", "output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001" }, { "input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110", "output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011" }, { "input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111", "output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101" }, { "input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010", "output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101" }, { "input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000", "output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001" }, { "input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011", "output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110" }, { "input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011", "output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011" }, { "input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011", "output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011" }, { "input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010", "output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011" }, { "input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001", "output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110" }, { "input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111", "output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010" }, { "input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011", "output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011" }, { "input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100", "output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000" }, { "input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001", "output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101" }, { "input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110", "output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101" }, { "input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011", "output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110" }, { "input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111", "output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110" }, { "input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000", "output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001" }, { "input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010", "output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101" }, { "input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101", "output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011" }, { "input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011", "output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010" }, { "input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010", "output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011" }, { "input": "0\n0", "output": "0" }, { "input": "0\n1", "output": "1" } ]
1,636,648,206
2,147,483,647
Python 3
OK
TESTS
102
62
4,300,800
first_number = input() second_number = input() result_number = "" for i in range(len(first_number)): if(first_number[i] != second_number[i]): result_number+="1" elif(first_number[i] == second_number[i]): result_number+="0" print(result_number)
Title: Ultra-Fast Mathematician Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate. Input Specification: There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. Output Specification: Write one line — the corresponding answer. Do not omit the leading 0s. Demo Input: ['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n'] Demo Output: ['1110001\n', '111\n', '0100\n', '00010\n'] Note: none
```python first_number = input() second_number = input() result_number = "" for i in range(len(first_number)): if(first_number[i] != second_number[i]): result_number+="1" elif(first_number[i] == second_number[i]): result_number+="0" print(result_number) ```
3.976489
611
A
New Year and Days
PROGRAMMING
900
[ "implementation" ]
null
null
Today is Wednesday, the third day of the week. What's more interesting is that tomorrow is the last day of the year 2015. Limak is a little polar bear. He enjoyed this year a lot. Now, he is so eager to the coming year 2016. Limak wants to prove how responsible a bear he is. He is going to regularly save candies for the entire year 2016! He considers various saving plans. He can save one candy either on some fixed day of the week or on some fixed day of the month. Limak chose one particular plan. He isn't sure how many candies he will save in the 2016 with his plan. Please, calculate it and tell him.
The only line of the input is in one of the following two formats: - "*x* of week" where *x* (1<=≤<=*x*<=≤<=7) denotes the day of the week. The 1-st day is Monday and the 7-th one is Sunday. - "*x* of month" where *x* (1<=≤<=*x*<=≤<=31) denotes the day of the month.
Print one integer — the number of candies Limak will save in the year 2016.
[ "4 of week\n", "30 of month\n" ]
[ "52\n", "11\n" ]
Polar bears use the Gregorian calendar. It is the most common calendar and you likely use it too. You can read about it on Wikipedia if you want to – [https://en.wikipedia.org/wiki/Gregorian_calendar](https://en.wikipedia.org/wiki/Gregorian_calendar). The week starts with Monday. In the first sample Limak wants to save one candy on each Thursday (the 4-th day of the week). There are 52 Thursdays in the 2016. Thus, he will save 52 candies in total. In the second sample Limak wants to save one candy on the 30-th day of each month. There is the 30-th day in exactly 11 months in the 2016 — all months but February. It means that Limak will save 11 candies in total.
500
[ { "input": "4 of week", "output": "52" }, { "input": "30 of month", "output": "11" }, { "input": "17 of month", "output": "12" }, { "input": "31 of month", "output": "7" }, { "input": "6 of week", "output": "53" }, { "input": "1 of week", "output": "52" }, { "input": "2 of week", "output": "52" }, { "input": "3 of week", "output": "52" }, { "input": "5 of week", "output": "53" }, { "input": "7 of week", "output": "52" }, { "input": "1 of month", "output": "12" }, { "input": "2 of month", "output": "12" }, { "input": "3 of month", "output": "12" }, { "input": "4 of month", "output": "12" }, { "input": "5 of month", "output": "12" }, { "input": "6 of month", "output": "12" }, { "input": "7 of month", "output": "12" }, { "input": "8 of month", "output": "12" }, { "input": "9 of month", "output": "12" }, { "input": "10 of month", "output": "12" }, { "input": "11 of month", "output": "12" }, { "input": "12 of month", "output": "12" }, { "input": "13 of month", "output": "12" }, { "input": "14 of month", "output": "12" }, { "input": "15 of month", "output": "12" }, { "input": "16 of month", "output": "12" }, { "input": "18 of month", "output": "12" }, { "input": "19 of month", "output": "12" }, { "input": "20 of month", "output": "12" }, { "input": "21 of month", "output": "12" }, { "input": "22 of month", "output": "12" }, { "input": "23 of month", "output": "12" }, { "input": "24 of month", "output": "12" }, { "input": "25 of month", "output": "12" }, { "input": "26 of month", "output": "12" }, { "input": "27 of month", "output": "12" }, { "input": "28 of month", "output": "12" }, { "input": "29 of month", "output": "12" } ]
1,520,869,028
2,147,483,647
Python 3
OK
TESTS
38
77
6,348,800
l=[0,52,52,52,52,53,53,52] m=[31,29,31,30,31,30,31,31,30,31,30,31] a,b,c=map(str,input().split()) if c=='week': print(l[int(a)]) if c=='month': count=0 for i in range(len(m)): if int(a) in range(1,m[i]+1): count+=1 print(count)
Title: New Year and Days Time Limit: None seconds Memory Limit: None megabytes Problem Description: Today is Wednesday, the third day of the week. What's more interesting is that tomorrow is the last day of the year 2015. Limak is a little polar bear. He enjoyed this year a lot. Now, he is so eager to the coming year 2016. Limak wants to prove how responsible a bear he is. He is going to regularly save candies for the entire year 2016! He considers various saving plans. He can save one candy either on some fixed day of the week or on some fixed day of the month. Limak chose one particular plan. He isn't sure how many candies he will save in the 2016 with his plan. Please, calculate it and tell him. Input Specification: The only line of the input is in one of the following two formats: - "*x* of week" where *x* (1<=≤<=*x*<=≤<=7) denotes the day of the week. The 1-st day is Monday and the 7-th one is Sunday. - "*x* of month" where *x* (1<=≤<=*x*<=≤<=31) denotes the day of the month. Output Specification: Print one integer — the number of candies Limak will save in the year 2016. Demo Input: ['4 of week\n', '30 of month\n'] Demo Output: ['52\n', '11\n'] Note: Polar bears use the Gregorian calendar. It is the most common calendar and you likely use it too. You can read about it on Wikipedia if you want to – [https://en.wikipedia.org/wiki/Gregorian_calendar](https://en.wikipedia.org/wiki/Gregorian_calendar). The week starts with Monday. In the first sample Limak wants to save one candy on each Thursday (the 4-th day of the week). There are 52 Thursdays in the 2016. Thus, he will save 52 candies in total. In the second sample Limak wants to save one candy on the 30-th day of each month. There is the 30-th day in exactly 11 months in the 2016 — all months but February. It means that Limak will save 11 candies in total.
```python l=[0,52,52,52,52,53,53,52] m=[31,29,31,30,31,30,31,31,30,31,30,31] a,b,c=map(str,input().split()) if c=='week': print(l[int(a)]) if c=='month': count=0 for i in range(len(m)): if int(a) in range(1,m[i]+1): count+=1 print(count) ```
3
452
A
Eevee
PROGRAMMING
1,000
[ "brute force", "implementation", "strings" ]
null
null
You are solving the crossword problem K from IPSC 2014. You solved all the clues except for one: who does Eevee evolve into? You are not very into pokemons, but quick googling helped you find out, that Eevee can evolve into eight different pokemons: Vaporeon, Jolteon, Flareon, Espeon, Umbreon, Leafeon, Glaceon, and Sylveon. You know the length of the word in the crossword, and you already know some letters. Designers of the crossword made sure that the answer is unambiguous, so you can assume that exactly one pokemon out of the 8 that Eevee evolves into fits the length and the letters given. Your task is to find it.
First line contains an integer *n* (6<=≤<=*n*<=≤<=8) – the length of the string. Next line contains a string consisting of *n* characters, each of which is either a lower case english letter (indicating a known letter) or a dot character (indicating an empty cell in the crossword).
Print a name of the pokemon that Eevee can evolve into that matches the pattern in the input. Use lower case letters only to print the name (in particular, do not capitalize the first letter).
[ "7\nj......\n", "7\n...feon\n", "7\n.l.r.o.\n" ]
[ "jolteon\n", "leafeon\n", "flareon\n" ]
Here's a set of names in a form you can paste into your solution: ["vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"] {"vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"}
500
[ { "input": "7\n...feon", "output": "leafeon" }, { "input": "7\n.l.r.o.", "output": "flareon" }, { "input": "6\n.s..o.", "output": "espeon" }, { "input": "7\nglaceon", "output": "glaceon" }, { "input": "8\n.a.o.e.n", "output": "vaporeon" }, { "input": "7\n.laceon", "output": "glaceon" }, { "input": "7\n..lveon", "output": "sylveon" }, { "input": "7\n.l.ceon", "output": "glaceon" }, { "input": "7\n..areon", "output": "flareon" } ]
1,438,678,877
2,147,483,647
Python 3
OK
TESTS
20
62
0
a = ["vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"] n = input() s = input() res = "" for k in a: if len(k) == len(s): cnt = 0 for i in range(len(s)): if (k[i] == s[i]) or (s[i] == '.'): cnt+=1 if cnt == len(s): print(k)
Title: Eevee Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are solving the crossword problem K from IPSC 2014. You solved all the clues except for one: who does Eevee evolve into? You are not very into pokemons, but quick googling helped you find out, that Eevee can evolve into eight different pokemons: Vaporeon, Jolteon, Flareon, Espeon, Umbreon, Leafeon, Glaceon, and Sylveon. You know the length of the word in the crossword, and you already know some letters. Designers of the crossword made sure that the answer is unambiguous, so you can assume that exactly one pokemon out of the 8 that Eevee evolves into fits the length and the letters given. Your task is to find it. Input Specification: First line contains an integer *n* (6<=≤<=*n*<=≤<=8) – the length of the string. Next line contains a string consisting of *n* characters, each of which is either a lower case english letter (indicating a known letter) or a dot character (indicating an empty cell in the crossword). Output Specification: Print a name of the pokemon that Eevee can evolve into that matches the pattern in the input. Use lower case letters only to print the name (in particular, do not capitalize the first letter). Demo Input: ['7\nj......\n', '7\n...feon\n', '7\n.l.r.o.\n'] Demo Output: ['jolteon\n', 'leafeon\n', 'flareon\n'] Note: Here's a set of names in a form you can paste into your solution: ["vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"] {"vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"}
```python a = ["vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"] n = input() s = input() res = "" for k in a: if len(k) == len(s): cnt = 0 for i in range(len(s)): if (k[i] == s[i]) or (s[i] == '.'): cnt+=1 if cnt == len(s): print(k) ```
3
414
B
Mashmokh and ACM
PROGRAMMING
1,400
[ "combinatorics", "dp", "number theory" ]
null
null
Mashmokh's boss, Bimokh, didn't like Mashmokh. So he fired him. Mashmokh decided to go to university and participate in ACM instead of finding a new job. He wants to become a member of Bamokh's team. In order to join he was given some programming tasks and one week to solve them. Mashmokh is not a very experienced programmer. Actually he is not a programmer at all. So he wasn't able to solve them. That's why he asked you to help him with these tasks. One of these tasks is the following. A sequence of *l* integers *b*1,<=*b*2,<=...,<=*b**l* (1<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**l*<=≤<=*n*) is called good if each number divides (without a remainder) by the next number in the sequence. More formally for all *i* (1<=≤<=*i*<=≤<=*l*<=-<=1). Given *n* and *k* find the number of good sequences of length *k*. As the answer can be rather large print it modulo 1000000007 (109<=+<=7).
The first line of input contains two space-separated integers *n*,<=*k* (1<=≤<=*n*,<=*k*<=≤<=2000).
Output a single integer — the number of good sequences of length *k* modulo 1000000007 (109<=+<=7).
[ "3 2\n", "6 4\n", "2 1\n" ]
[ "5\n", "39\n", "2\n" ]
In the first sample the good sequences are: [1, 1], [2, 2], [3, 3], [1, 2], [1, 3].
1,000
[ { "input": "3 2", "output": "5" }, { "input": "6 4", "output": "39" }, { "input": "2 1", "output": "2" }, { "input": "1478 194", "output": "312087753" }, { "input": "1415 562", "output": "953558593" }, { "input": "1266 844", "output": "735042656" }, { "input": "680 1091", "output": "351905328" }, { "input": "1229 1315", "output": "100240813" }, { "input": "1766 1038", "output": "435768250" }, { "input": "1000 1", "output": "1000" }, { "input": "2000 100", "output": "983281065" }, { "input": "1 1", "output": "1" }, { "input": "2000 1000", "output": "228299266" }, { "input": "1928 1504", "output": "81660104" }, { "input": "2000 2000", "output": "585712681" }, { "input": "29 99", "output": "23125873" }, { "input": "56 48", "output": "20742237" }, { "input": "209 370", "output": "804680894" }, { "input": "83 37", "output": "22793555" }, { "input": "49 110", "output": "956247348" }, { "input": "217 3", "output": "4131" }, { "input": "162 161", "output": "591739753" }, { "input": "273 871", "output": "151578252" }, { "input": "43 1640", "output": "173064407" }, { "input": "1472 854", "output": "748682383" }, { "input": "1639 1056", "output": "467464129" }, { "input": "359 896", "output": "770361185" }, { "input": "1544 648", "output": "9278889" }, { "input": "436 1302", "output": "874366220" }, { "input": "1858 743", "output": "785912917" }, { "input": "991 1094", "output": "483493131" }, { "input": "1013 1550", "output": "613533467" }, { "input": "675 741", "output": "474968598" }, { "input": "1420 1223", "output": "922677437" }, { "input": "1544 1794", "output": "933285446" }, { "input": "1903 1612", "output": "620810276" }, { "input": "500 1304", "output": "706176027" }, { "input": "525 314", "output": "245394744" }, { "input": "39 1930", "output": "992125404" }, { "input": "1895 753", "output": "180474828" }, { "input": "1722 1474", "output": "742424590" }, { "input": "1153 1823", "output": "791493066" }, { "input": "1409 734", "output": "627413973" }, { "input": "478 1301", "output": "476483030" }, { "input": "1887 1729", "output": "730033374" }, { "input": "1610 774", "output": "50897314" }, { "input": "1770 679", "output": "235295539" }, { "input": "987 1292", "output": "560110556" }, { "input": "1707 1117", "output": "237674323" }, { "input": "1424 1431", "output": "184145444" }, { "input": "86 1078", "output": "252515343" }, { "input": "1066 995", "output": "180753612" }, { "input": "1024 133", "output": "392603027" }, { "input": "659 974", "output": "397026719" }, { "input": "1349 1606", "output": "522392901" }, { "input": "473 211", "output": "809550224" }, { "input": "634 1825", "output": "438513382" }, { "input": "22 373", "output": "907321755" }, { "input": "531 147", "output": "242883376" }, { "input": "1307 1247", "output": "21512331" }, { "input": "415 735", "output": "393705804" }, { "input": "1659 1501", "output": "225266660" }, { "input": "1454 296", "output": "750032659" }, { "input": "158 772", "output": "850911301" }, { "input": "2000 1", "output": "2000" } ]
1,628,088,947
2,147,483,647
PyPy 3
OK
TESTS
65
967
29,593,600
n,k=map(int,input().split())# se reciben los datos n y k lista=[] # se nombra la lista donde se guardaran en cada posicion el numero de combinaciones al ubicar en la primera posicion de la secuemcia el numero n for i in range(n+1): # inicialmente se guarda 1 que es el nunmero que genera al ubicar cadan en la primera posicion de la secuencia lista.append(1) for i in range(k-1): # pro cada iteracion de i se maneja el concepto de ubicar otro n en la secuencia hasta tener k posiciones for j in range(1,n+1): # por cada j se analiza el numero de combinaciones que se generan al ubicar j en la posicion i de la secuencia multiplo=2*j # se pasa al siguiente multiplo while (multiplo<=n): # mientras ese multiplo sea un numero valido o sea menor o igual que n lista[j]=lista[j]+lista[multiplo] # se suman el numero de combinaciones generadas al ubicar multiplo en la secuencia luego de j multiplo=multiplo+j # se salta al siguiente multiplo total=0 # variable a mostrar for i in range(1,n+1): # se suman todas las combinaciones al ubicar cada n en la posicion inicial total=total+lista[i] print(total%(10**9+7))
Title: Mashmokh and ACM Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mashmokh's boss, Bimokh, didn't like Mashmokh. So he fired him. Mashmokh decided to go to university and participate in ACM instead of finding a new job. He wants to become a member of Bamokh's team. In order to join he was given some programming tasks and one week to solve them. Mashmokh is not a very experienced programmer. Actually he is not a programmer at all. So he wasn't able to solve them. That's why he asked you to help him with these tasks. One of these tasks is the following. A sequence of *l* integers *b*1,<=*b*2,<=...,<=*b**l* (1<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**l*<=≤<=*n*) is called good if each number divides (without a remainder) by the next number in the sequence. More formally for all *i* (1<=≤<=*i*<=≤<=*l*<=-<=1). Given *n* and *k* find the number of good sequences of length *k*. As the answer can be rather large print it modulo 1000000007 (109<=+<=7). Input Specification: The first line of input contains two space-separated integers *n*,<=*k* (1<=≤<=*n*,<=*k*<=≤<=2000). Output Specification: Output a single integer — the number of good sequences of length *k* modulo 1000000007 (109<=+<=7). Demo Input: ['3 2\n', '6 4\n', '2 1\n'] Demo Output: ['5\n', '39\n', '2\n'] Note: In the first sample the good sequences are: [1, 1], [2, 2], [3, 3], [1, 2], [1, 3].
```python n,k=map(int,input().split())# se reciben los datos n y k lista=[] # se nombra la lista donde se guardaran en cada posicion el numero de combinaciones al ubicar en la primera posicion de la secuemcia el numero n for i in range(n+1): # inicialmente se guarda 1 que es el nunmero que genera al ubicar cadan en la primera posicion de la secuencia lista.append(1) for i in range(k-1): # pro cada iteracion de i se maneja el concepto de ubicar otro n en la secuencia hasta tener k posiciones for j in range(1,n+1): # por cada j se analiza el numero de combinaciones que se generan al ubicar j en la posicion i de la secuencia multiplo=2*j # se pasa al siguiente multiplo while (multiplo<=n): # mientras ese multiplo sea un numero valido o sea menor o igual que n lista[j]=lista[j]+lista[multiplo] # se suman el numero de combinaciones generadas al ubicar multiplo en la secuencia luego de j multiplo=multiplo+j # se salta al siguiente multiplo total=0 # variable a mostrar for i in range(1,n+1): # se suman todas las combinaciones al ubicar cada n en la posicion inicial total=total+lista[i] print(total%(10**9+7)) ```
3
583
B
Robot's Task
PROGRAMMING
1,200
[ "greedy", "implementation" ]
null
null
Robot Doc is located in the hall, with *n* computers stand in a line, numbered from left to right from 1 to *n*. Each computer contains exactly one piece of information, each of which Doc wants to get eventually. The computers are equipped with a security system, so to crack the *i*-th of them, the robot needs to collect at least *a**i* any pieces of information from the other computers. Doc can hack the computer only if he is right next to it. The robot is assembled using modern technologies and can move along the line of computers in either of the two possible directions, but the change of direction requires a large amount of resources from Doc. Tell the minimum number of changes of direction, which the robot will have to make to collect all *n* parts of information if initially it is next to computer with number 1. It is guaranteed that there exists at least one sequence of the robot's actions, which leads to the collection of all information. Initially Doc doesn't have any pieces of information.
The first line contains number *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* non-negative integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=&lt;<=*n*), separated by a space. It is guaranteed that there exists a way for robot to collect all pieces of the information.
Print a single number — the minimum number of changes in direction that the robot will have to make in order to collect all *n* parts of information.
[ "3\n0 2 0\n", "5\n4 2 3 0 1\n", "7\n0 3 1 0 5 2 6\n" ]
[ "1\n", "3\n", "2\n" ]
In the first sample you can assemble all the pieces of information in the optimal manner by assembling first the piece of information in the first computer, then in the third one, then change direction and move to the second one, and then, having 2 pieces of information, collect the last piece. In the second sample to collect all the pieces of information in the optimal manner, Doc can go to the fourth computer and get the piece of information, then go to the fifth computer with one piece and get another one, then go to the second computer in the same manner, then to the third one and finally, to the first one. Changes of direction will take place before moving from the fifth to the second computer, then from the second to the third computer, then from the third to the first computer. In the third sample the optimal order of collecting parts from computers can look like that: 1-&gt;3-&gt;4-&gt;6-&gt;2-&gt;5-&gt;7.
1,000
[ { "input": "3\n0 2 0", "output": "1" }, { "input": "5\n4 2 3 0 1", "output": "3" }, { "input": "7\n0 3 1 0 5 2 6", "output": "2" }, { "input": "1\n0", "output": "0" }, { "input": "2\n0 1", "output": "0" }, { "input": "10\n0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "3\n0 2 1", "output": "1" }, { "input": "10\n7 1 9 3 5 8 6 0 2 4", "output": "9" }, { "input": "10\n1 3 5 7 9 8 6 4 2 0", "output": "9" }, { "input": "10\n5 0 0 1 3 2 2 2 5 7", "output": "1" }, { "input": "10\n8 6 5 3 9 7 1 4 2 0", "output": "8" }, { "input": "10\n1 2 4 5 0 1 3 7 1 4", "output": "2" }, { "input": "10\n3 4 8 9 5 1 2 0 6 7", "output": "6" }, { "input": "10\n2 2 0 0 6 2 9 0 2 0", "output": "2" }, { "input": "10\n1 7 5 3 2 6 0 8 4 9", "output": "8" }, { "input": "9\n1 3 8 6 2 4 5 0 7", "output": "7" }, { "input": "9\n1 3 5 7 8 6 4 2 0", "output": "8" }, { "input": "9\n2 4 3 1 3 0 5 4 3", "output": "3" }, { "input": "9\n3 5 6 8 7 0 4 2 1", "output": "5" }, { "input": "9\n2 0 8 1 0 3 0 5 3", "output": "2" }, { "input": "9\n6 2 3 7 4 8 5 1 0", "output": "4" }, { "input": "9\n3 1 5 6 0 3 2 0 0", "output": "2" }, { "input": "9\n2 6 4 1 0 8 5 3 7", "output": "7" }, { "input": "100\n27 20 18 78 93 38 56 2 48 75 36 88 96 57 69 10 25 74 68 86 65 85 66 14 22 12 43 80 99 34 42 63 61 71 77 15 37 54 21 59 23 94 28 30 50 84 62 76 47 16 26 64 82 92 72 53 17 11 41 91 35 83 79 95 67 13 1 7 3 4 73 90 8 19 33 58 98 32 39 45 87 52 60 46 6 44 49 70 51 9 5 29 31 24 40 97 81 0 89 55", "output": "69" }, { "input": "100\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 98 96 94 92 90 88 86 84 82 80 78 76 74 72 70 68 66 64 62 60 58 56 54 52 50 48 46 44 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 0", "output": "99" }, { "input": "100\n13 89 81 0 62 1 59 92 29 13 1 37 2 8 53 15 20 34 12 70 0 85 97 55 84 60 37 54 14 65 22 69 30 22 95 44 59 85 50 80 9 71 91 93 74 21 11 78 28 21 40 81 76 24 26 60 48 85 61 68 89 76 46 73 34 52 98 29 4 38 94 51 5 55 6 27 74 27 38 37 82 70 44 89 51 59 30 37 15 55 63 78 42 39 71 43 4 10 2 13", "output": "21" }, { "input": "100\n1 3 5 7 58 11 13 15 17 19 45 23 25 27 29 31 33 35 37 39 41 43 21 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 81 79 83 85 87 89 91 93 95 97 48 98 96 94 92 90 88 44 84 82 80 78 76 74 72 70 68 66 64 62 60 9 56 54 52 50 99 46 86 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 0", "output": "96" }, { "input": "100\n32 47 74 8 14 4 12 68 18 0 44 80 14 38 6 57 4 72 69 3 21 78 74 22 39 32 58 63 34 33 23 6 39 11 6 12 18 4 0 11 20 28 16 1 22 12 57 55 13 48 43 1 50 18 87 6 11 45 38 67 37 14 7 56 6 41 1 55 5 73 78 64 38 18 38 8 37 0 18 61 37 58 58 62 86 5 0 2 15 43 34 61 2 21 15 9 69 1 11 24", "output": "4" }, { "input": "100\n40 3 55 7 6 77 13 46 17 64 21 54 25 27 91 41 1 15 37 82 23 43 42 47 26 95 53 5 11 59 61 9 78 67 69 58 73 0 36 79 60 83 2 87 63 33 71 89 97 99 98 93 56 92 19 88 86 84 39 28 65 20 34 76 51 94 66 12 62 49 96 72 24 52 48 50 44 35 74 31 38 57 81 32 22 80 70 29 30 18 68 16 14 90 10 8 85 4 45 75", "output": "75" }, { "input": "100\n34 16 42 21 84 27 11 7 82 16 95 39 36 64 26 0 38 37 2 2 16 56 16 61 55 42 26 5 61 8 30 20 19 15 9 78 5 34 15 0 3 17 36 36 1 5 4 26 18 0 14 25 7 5 91 7 43 26 79 37 17 27 40 55 66 7 0 2 16 23 68 35 2 5 9 21 1 7 2 9 4 3 22 15 27 6 0 47 5 0 12 9 20 55 36 10 6 8 5 1", "output": "3" }, { "input": "100\n35 53 87 49 13 24 93 20 5 11 31 32 40 52 96 46 1 25 66 69 28 88 84 82 70 9 75 39 26 21 18 29 23 57 90 16 48 22 95 0 58 43 7 73 8 62 63 30 64 92 79 3 6 94 34 12 76 99 67 55 56 97 14 91 68 36 44 78 41 71 86 89 47 74 4 45 98 37 80 33 83 27 42 59 72 54 17 60 51 81 15 77 65 50 10 85 61 19 38 2", "output": "67" }, { "input": "99\n89 96 56 31 32 14 9 66 87 34 69 5 92 54 41 52 46 30 22 26 16 18 20 68 62 73 90 43 79 33 58 98 37 45 10 78 94 51 19 0 91 39 28 47 17 86 3 61 77 7 15 64 55 83 65 71 97 88 6 48 24 11 8 42 81 4 63 93 50 74 35 12 95 27 53 82 29 85 84 60 72 40 36 57 23 13 38 59 49 1 75 44 76 2 21 25 70 80 67", "output": "75" }, { "input": "99\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 98 96 94 92 90 88 86 84 82 80 78 76 74 72 70 68 66 64 62 60 58 56 54 52 50 48 46 44 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 0", "output": "98" }, { "input": "99\n82 7 6 77 17 28 90 3 68 12 63 60 24 20 4 81 71 85 57 45 11 84 3 91 49 34 89 82 0 50 48 88 36 76 36 5 62 48 20 2 20 45 69 27 37 62 42 31 57 51 92 84 89 25 7 62 12 23 23 56 30 90 27 10 77 58 48 38 56 68 57 15 33 1 34 67 16 47 75 70 69 28 38 16 5 61 85 76 44 90 37 22 77 94 55 1 97 8 69", "output": "22" }, { "input": "99\n1 51 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 42 43 45 47 49 3 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 98 96 94 92 90 88 86 84 82 80 8 76 74 72 70 68 66 22 62 60 58 56 54 52 0 48 46 44 41 40 38 36 34 32 30 28 26 24 64 20 18 16 14 12 10 78 6 4 2 50", "output": "96" }, { "input": "99\n22 3 19 13 65 87 28 17 41 40 31 21 8 37 29 65 65 53 16 33 13 5 76 4 72 9 2 76 57 72 50 15 75 0 30 13 83 36 12 31 49 51 65 22 48 31 60 15 2 17 6 1 8 0 1 63 3 16 7 7 2 1 47 28 26 21 2 36 1 5 20 25 44 0 2 39 46 30 33 11 15 34 34 4 84 52 0 39 7 3 17 15 6 38 52 64 26 1 0", "output": "3" }, { "input": "99\n24 87 25 82 97 11 37 15 23 19 34 17 76 13 45 89 33 1 27 78 63 43 54 47 49 2 42 41 75 83 61 90 65 67 21 71 60 57 77 62 81 58 85 69 3 91 68 55 72 93 29 94 66 16 88 86 84 53 14 39 35 44 9 70 80 92 56 79 74 5 64 31 52 50 48 46 51 59 40 38 36 96 32 30 28 95 7 22 20 18 26 73 12 10 8 6 4 98 0", "output": "74" }, { "input": "99\n22 14 0 44 6 17 6 6 37 45 0 48 19 8 57 8 10 0 3 12 25 2 5 53 9 49 15 6 38 14 9 40 38 22 27 12 64 10 11 35 89 19 46 39 12 24 48 0 52 1 27 27 24 4 64 24 5 0 67 3 5 39 0 1 13 37 2 8 46 1 28 70 6 79 14 15 33 6 7 34 6 18 4 71 1 55 33 71 18 11 47 23 72 53 65 32 2 7 28", "output": "3" }, { "input": "99\n28 59 73 89 52 27 0 20 36 12 83 95 31 24 54 94 49 14 51 34 50 93 13 1 2 68 63 48 41 81 23 43 18 9 16 38 33 60 62 3 40 85 72 69 90 98 11 37 22 44 35 6 21 39 82 10 64 66 96 42 74 30 8 67 97 46 84 32 17 57 75 71 5 26 4 55 58 29 7 15 45 19 92 91 78 65 88 25 86 80 77 87 79 53 47 70 56 76 61", "output": "63" } ]
1,590,215,416
2,147,483,647
Python 3
OK
TESTS
56
280
307,200
n=int(input()) a=list(map(int,input().split())) info=0; i=0; di=0 while 1: for i in range(n): if a[i]==-69: continue if a[i]<=info: info+=1 a[i]=-69 if info==n: break a.reverse() di+=1 print(di)
Title: Robot's Task Time Limit: None seconds Memory Limit: None megabytes Problem Description: Robot Doc is located in the hall, with *n* computers stand in a line, numbered from left to right from 1 to *n*. Each computer contains exactly one piece of information, each of which Doc wants to get eventually. The computers are equipped with a security system, so to crack the *i*-th of them, the robot needs to collect at least *a**i* any pieces of information from the other computers. Doc can hack the computer only if he is right next to it. The robot is assembled using modern technologies and can move along the line of computers in either of the two possible directions, but the change of direction requires a large amount of resources from Doc. Tell the minimum number of changes of direction, which the robot will have to make to collect all *n* parts of information if initially it is next to computer with number 1. It is guaranteed that there exists at least one sequence of the robot's actions, which leads to the collection of all information. Initially Doc doesn't have any pieces of information. Input Specification: The first line contains number *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* non-negative integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=&lt;<=*n*), separated by a space. It is guaranteed that there exists a way for robot to collect all pieces of the information. Output Specification: Print a single number — the minimum number of changes in direction that the robot will have to make in order to collect all *n* parts of information. Demo Input: ['3\n0 2 0\n', '5\n4 2 3 0 1\n', '7\n0 3 1 0 5 2 6\n'] Demo Output: ['1\n', '3\n', '2\n'] Note: In the first sample you can assemble all the pieces of information in the optimal manner by assembling first the piece of information in the first computer, then in the third one, then change direction and move to the second one, and then, having 2 pieces of information, collect the last piece. In the second sample to collect all the pieces of information in the optimal manner, Doc can go to the fourth computer and get the piece of information, then go to the fifth computer with one piece and get another one, then go to the second computer in the same manner, then to the third one and finally, to the first one. Changes of direction will take place before moving from the fifth to the second computer, then from the second to the third computer, then from the third to the first computer. In the third sample the optimal order of collecting parts from computers can look like that: 1-&gt;3-&gt;4-&gt;6-&gt;2-&gt;5-&gt;7.
```python n=int(input()) a=list(map(int,input().split())) info=0; i=0; di=0 while 1: for i in range(n): if a[i]==-69: continue if a[i]<=info: info+=1 a[i]=-69 if info==n: break a.reverse() di+=1 print(di) ```
3
43
A
Football
PROGRAMMING
1,000
[ "strings" ]
A. Football
2
256
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
[ "1\nABC\n", "5\nA\nABA\nABA\nA\nA\n" ]
[ "ABC\n", "A\n" ]
none
500
[ { "input": "1\nABC", "output": "ABC" }, { "input": "5\nA\nABA\nABA\nA\nA", "output": "A" }, { "input": "2\nXTSJEP\nXTSJEP", "output": "XTSJEP" }, { "input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ", "output": "XZYDJAEDZ" }, { "input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD", "output": "QCCYXL" }, { "input": "3\nAZID\nEERWBC\nEERWBC", "output": "EERWBC" }, { "input": "3\nHNCGYL\nHNCGYL\nHNCGYL", "output": "HNCGYL" }, { "input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG", "output": "ZZWZTG" }, { "input": "4\nA\nA\nKUDLJMXCSE\nA", "output": "A" }, { "input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW", "output": "PHBTW" }, { "input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN", "output": "PKUZYTFYWN" }, { "input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH", "output": "HH" }, { "input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW", "output": "W" }, { "input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP", "output": "XBCP" }, { "input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS", "output": "PYPAS" }, { "input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC", "output": "NC" }, { "input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI", "output": "VOCI" }, { "input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA", "output": "HA" }, { "input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS", "output": "G" }, { "input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL", "output": "WL" } ]
1,511,090,494
2,147,483,647
Python 3
OK
TESTS
34
124
5,529,600
n = int(input()) i = 1 team = [] while i <= n: team.append(input()) i += 1 print(max(set(team),key = team.count))
Title: Football Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie. Input Specification: The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams. Output Specification: Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner. Demo Input: ['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n'] Demo Output: ['ABC\n', 'A\n'] Note: none
```python n = int(input()) i = 1 team = [] while i <= n: team.append(input()) i += 1 print(max(set(team),key = team.count)) ```
3.9587
620
A
Professor GukiZ's Robot
PROGRAMMING
800
[ "implementation", "math" ]
null
null
Professor GukiZ makes a new robot. The robot are in the point with coordinates (*x*1,<=*y*1) and should go to the point (*x*2,<=*y*2). In a single step the robot can change any of its coordinates (maybe both of them) by one (decrease or increase). So the robot can move in one of the 8 directions. Find the minimal number of steps the robot should make to get the finish position.
The first line contains two integers *x*1,<=*y*1 (<=-<=109<=≤<=*x*1,<=*y*1<=≤<=109) — the start position of the robot. The second line contains two integers *x*2,<=*y*2 (<=-<=109<=≤<=*x*2,<=*y*2<=≤<=109) — the finish position of the robot.
Print the only integer *d* — the minimal number of steps to get the finish position.
[ "0 0\n4 5\n", "3 4\n6 1\n" ]
[ "5\n", "3\n" ]
In the first example robot should increase both of its coordinates by one four times, so it will be in position (4, 4). After that robot should simply increase its *y* coordinate and get the finish position. In the second example robot should simultaneously increase *x* coordinate and decrease *y* coordinate by one three times.
0
[ { "input": "0 0\n4 5", "output": "5" }, { "input": "3 4\n6 1", "output": "3" }, { "input": "0 0\n4 6", "output": "6" }, { "input": "1 1\n-3 -5", "output": "6" }, { "input": "-1 -1\n-10 100", "output": "101" }, { "input": "1 -1\n100 -100", "output": "99" }, { "input": "-1000000000 -1000000000\n1000000000 1000000000", "output": "2000000000" }, { "input": "-1000000000 -1000000000\n0 999999999", "output": "1999999999" }, { "input": "0 0\n2 1", "output": "2" }, { "input": "10 0\n100 0", "output": "90" }, { "input": "1 5\n6 4", "output": "5" }, { "input": "0 0\n5 4", "output": "5" }, { "input": "10 1\n20 1", "output": "10" }, { "input": "1 1\n-3 4", "output": "4" }, { "input": "-863407280 504312726\n786535210 -661703810", "output": "1649942490" }, { "input": "-588306085 -741137832\n341385643 152943311", "output": "929691728" }, { "input": "0 0\n4 0", "output": "4" }, { "input": "93097194 -48405232\n-716984003 -428596062", "output": "810081197" }, { "input": "9 1\n1 1", "output": "8" }, { "input": "4 6\n0 4", "output": "4" }, { "input": "2 4\n5 2", "output": "3" }, { "input": "-100000000 -100000000\n100000000 100000123", "output": "200000123" }, { "input": "5 6\n5 7", "output": "1" }, { "input": "12 16\n12 1", "output": "15" }, { "input": "0 0\n5 1", "output": "5" }, { "input": "0 1\n1 1", "output": "1" }, { "input": "-44602634 913365223\n-572368780 933284951", "output": "527766146" }, { "input": "-2 0\n2 -2", "output": "4" }, { "input": "0 0\n3 1", "output": "3" }, { "input": "-458 2\n1255 4548", "output": "4546" }, { "input": "-5 -4\n-3 -3", "output": "2" }, { "input": "4 5\n7 3", "output": "3" }, { "input": "-1000000000 -999999999\n1000000000 999999998", "output": "2000000000" }, { "input": "-1000000000 -1000000000\n1000000000 -1000000000", "output": "2000000000" }, { "input": "-464122675 -898521847\n656107323 -625340409", "output": "1120229998" }, { "input": "-463154699 -654742385\n-699179052 -789004997", "output": "236024353" }, { "input": "982747270 -593488945\n342286841 -593604186", "output": "640460429" }, { "input": "-80625246 708958515\n468950878 574646184", "output": "549576124" }, { "input": "0 0\n1 0", "output": "1" }, { "input": "109810 1\n2 3", "output": "109808" }, { "input": "-9 0\n9 9", "output": "18" }, { "input": "9 9\n9 9", "output": "0" }, { "input": "1 1\n4 3", "output": "3" }, { "input": "1 2\n45 1", "output": "44" }, { "input": "207558188 -313753260\n-211535387 -721675423", "output": "419093575" }, { "input": "-11 0\n0 0", "output": "11" }, { "input": "-1000000000 1000000000\n1000000000 -1000000000", "output": "2000000000" }, { "input": "0 0\n1 1", "output": "1" }, { "input": "0 0\n0 1", "output": "1" }, { "input": "0 0\n-1 1", "output": "1" }, { "input": "0 0\n-1 0", "output": "1" }, { "input": "0 0\n-1 -1", "output": "1" }, { "input": "0 0\n0 -1", "output": "1" }, { "input": "0 0\n1 -1", "output": "1" }, { "input": "10 90\n90 10", "output": "80" }, { "input": "851016864 573579544\n-761410925 -380746263", "output": "1612427789" }, { "input": "1 9\n9 9", "output": "8" }, { "input": "1000 1000\n1000 1000", "output": "0" }, { "input": "1 9\n9 1", "output": "8" }, { "input": "1 90\n90 90", "output": "89" }, { "input": "100 100\n1000 1000", "output": "900" }, { "input": "-1 0\n0 0", "output": "1" }, { "input": "-750595959 -2984043\n649569876 -749608783", "output": "1400165835" }, { "input": "958048496 712083589\n423286949 810566863", "output": "534761547" }, { "input": "146316710 53945094\n-523054748 147499505", "output": "669371458" }, { "input": "50383856 -596516251\n-802950224 -557916272", "output": "853334080" }, { "input": "-637204864 -280290367\n-119020929 153679771", "output": "518183935" }, { "input": "-100 -100\n-60 -91", "output": "40" }, { "input": "337537326 74909428\n-765558776 167951547", "output": "1103096102" }, { "input": "0 81\n18 90", "output": "18" }, { "input": "283722202 -902633305\n-831696497 -160868946", "output": "1115418699" }, { "input": "1000 1000\n-1000 1000", "output": "2000" }, { "input": "5 6\n4 8", "output": "2" }, { "input": "40572000 597493595\n-935051731 368493185", "output": "975623731" }, { "input": "-5 5\n5 5", "output": "10" } ]
1,620,991,295
2,147,483,647
Python 3
OK
TESTS
75
77
6,758,400
x1,y1=input().split() x2,y2=input().split() x1=int(x1) y1=int(y1) x2=int(x2) y2=int(y2) print(max(abs(y2-y1),abs(x2-x1)))
Title: Professor GukiZ's Robot Time Limit: None seconds Memory Limit: None megabytes Problem Description: Professor GukiZ makes a new robot. The robot are in the point with coordinates (*x*1,<=*y*1) and should go to the point (*x*2,<=*y*2). In a single step the robot can change any of its coordinates (maybe both of them) by one (decrease or increase). So the robot can move in one of the 8 directions. Find the minimal number of steps the robot should make to get the finish position. Input Specification: The first line contains two integers *x*1,<=*y*1 (<=-<=109<=≤<=*x*1,<=*y*1<=≤<=109) — the start position of the robot. The second line contains two integers *x*2,<=*y*2 (<=-<=109<=≤<=*x*2,<=*y*2<=≤<=109) — the finish position of the robot. Output Specification: Print the only integer *d* — the minimal number of steps to get the finish position. Demo Input: ['0 0\n4 5\n', '3 4\n6 1\n'] Demo Output: ['5\n', '3\n'] Note: In the first example robot should increase both of its coordinates by one four times, so it will be in position (4, 4). After that robot should simply increase its *y* coordinate and get the finish position. In the second example robot should simultaneously increase *x* coordinate and decrease *y* coordinate by one three times.
```python x1,y1=input().split() x2,y2=input().split() x1=int(x1) y1=int(y1) x2=int(x2) y2=int(y2) print(max(abs(y2-y1),abs(x2-x1))) ```
3
581
A
Vasya the Hipster
PROGRAMMING
800
[ "implementation", "math" ]
null
null
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks. According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot. Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them. Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Can you help him?
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
[ "3 1\n", "2 3\n", "7 3\n" ]
[ "1 1\n", "2 0\n", "3 2\n" ]
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
500
[ { "input": "3 1", "output": "1 1" }, { "input": "2 3", "output": "2 0" }, { "input": "7 3", "output": "3 2" }, { "input": "100 100", "output": "100 0" }, { "input": "4 10", "output": "4 3" }, { "input": "6 10", "output": "6 2" }, { "input": "6 11", "output": "6 2" }, { "input": "10 40", "output": "10 15" }, { "input": "11 56", "output": "11 22" }, { "input": "34 30", "output": "30 2" }, { "input": "33 33", "output": "33 0" }, { "input": "100 45", "output": "45 27" }, { "input": "100 23", "output": "23 38" }, { "input": "45 12", "output": "12 16" }, { "input": "1 1", "output": "1 0" }, { "input": "1 100", "output": "1 49" }, { "input": "100 1", "output": "1 49" }, { "input": "68 59", "output": "59 4" }, { "input": "45 99", "output": "45 27" }, { "input": "99 100", "output": "99 0" }, { "input": "100 98", "output": "98 1" }, { "input": "59 12", "output": "12 23" }, { "input": "86 4", "output": "4 41" }, { "input": "68 21", "output": "21 23" }, { "input": "100 11", "output": "11 44" }, { "input": "100 10", "output": "10 45" }, { "input": "15 45", "output": "15 15" }, { "input": "11 32", "output": "11 10" }, { "input": "34 96", "output": "34 31" }, { "input": "89 89", "output": "89 0" } ]
1,675,449,489
2,147,483,647
Python 3
OK
TESTS
30
46
4,300,800
a, b = map(int, input().split()) n = min(a, b) m = (max(a, b) - n) // 2 print(n, m)
Title: Vasya the Hipster Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks. According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot. Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them. Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Can you help him? Input Specification: The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got. Output Specification: Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day. Demo Input: ['3 1\n', '2 3\n', '7 3\n'] Demo Output: ['1 1\n', '2 0\n', '3 2\n'] Note: In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
```python a, b = map(int, input().split()) n = min(a, b) m = (max(a, b) - n) // 2 print(n, m) ```
3
231
A
Team
PROGRAMMING
800
[ "brute force", "greedy" ]
null
null
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution. This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
Print a single integer — the number of problems the friends will implement on the contest.
[ "3\n1 1 0\n1 1 1\n1 0 0\n", "2\n1 0 0\n0 1 1\n" ]
[ "2\n", "1\n" ]
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it. In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
500
[ { "input": "3\n1 1 0\n1 1 1\n1 0 0", "output": "2" }, { "input": "2\n1 0 0\n0 1 1", "output": "1" }, { "input": "1\n1 0 0", "output": "0" }, { "input": "2\n1 0 0\n1 1 1", "output": "1" }, { "input": "5\n1 0 0\n0 1 0\n1 1 1\n0 0 1\n0 0 0", "output": "1" }, { "input": "10\n0 1 0\n0 1 0\n1 1 0\n1 0 0\n0 0 1\n0 1 1\n1 1 1\n1 1 0\n0 0 0\n0 0 0", "output": "4" }, { "input": "15\n0 1 0\n1 0 0\n1 1 0\n1 1 1\n0 1 0\n0 0 1\n1 0 1\n1 0 1\n1 0 1\n0 0 0\n1 1 1\n1 1 0\n0 1 1\n1 1 0\n1 1 1", "output": "10" }, { "input": "50\n0 0 0\n0 1 1\n1 1 1\n0 1 0\n1 0 1\n1 1 1\n0 0 1\n1 0 0\n1 1 0\n1 0 1\n0 1 0\n0 0 1\n1 1 0\n0 1 0\n1 1 0\n0 0 0\n1 1 1\n1 0 1\n0 0 1\n1 1 0\n1 1 1\n0 1 1\n1 1 0\n0 0 0\n0 0 0\n1 1 1\n0 0 0\n1 1 1\n0 1 1\n0 0 1\n0 0 0\n0 0 0\n1 1 0\n1 1 0\n1 0 1\n1 0 0\n1 0 1\n1 0 1\n0 1 1\n1 1 0\n1 1 0\n0 1 0\n1 0 1\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n1 1 1\n0 1 1\n1 0 1", "output": "29" }, { "input": "1\n1 1 1", "output": "1" }, { "input": "8\n0 0 0\n0 0 1\n0 0 0\n0 1 1\n1 0 0\n1 0 1\n1 1 0\n1 1 1", "output": "4" }, { "input": "16\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1", "output": "16" } ]
1,697,699,029
2,147,483,647
Python 3
OK
TESTS
21
92
0
probs = [] nprobs = int(input()) for i in range(nprobs): assurance = input() probs.append(assurance) n = 0 for j in probs: if j.count("1") >= 2: n += 1 print(n)
Title: Team Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution. This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution. Input Specification: The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces. Output Specification: Print a single integer — the number of problems the friends will implement on the contest. Demo Input: ['3\n1 1 0\n1 1 1\n1 0 0\n', '2\n1 0 0\n0 1 1\n'] Demo Output: ['2\n', '1\n'] Note: In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it. In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
```python probs = [] nprobs = int(input()) for i in range(nprobs): assurance = input() probs.append(assurance) n = 0 for j in probs: if j.count("1") >= 2: n += 1 print(n) ```
3
810
A
Straight <<A>>
PROGRAMMING
900
[ "implementation", "math" ]
null
null
Noora is a student of one famous high school. It's her final year in school — she is going to study in university next year. However, she has to get an «A» graduation certificate in order to apply to a prestigious one. In school, where Noora is studying, teachers are putting down marks to the online class register, which are integers from 1 to *k*. The worst mark is 1, the best is *k*. Mark that is going to the certificate, is calculated as an average of all the marks, rounded to the closest integer. If several answers are possible, rounding up is produced. For example, 7.3 is rounded to 7, but 7.5 and 7.8784 — to 8. For instance, if Noora has marks [8,<=9], then the mark to the certificate is 9, because the average is equal to 8.5 and rounded to 9, but if the marks are [8,<=8,<=9], Noora will have graduation certificate with 8. To graduate with «A» certificate, Noora has to have mark *k*. Noora got *n* marks in register this year. However, she is afraid that her marks are not enough to get final mark *k*. Noora decided to ask for help in the internet, where hacker Leha immediately responded to her request. He is ready to hack class register for Noora and to add Noora any number of additional marks from 1 to *k*. At the same time, Leha want his hack be unseen to everyone, so he decided to add as less as possible additional marks. Please help Leha to calculate the minimal number of marks he has to add, so that final Noora's mark will become equal to *k*.
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*k*<=≤<=100) denoting the number of marks, received by Noora and the value of highest possible mark. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*k*) denoting marks received by Noora before Leha's hack.
Print a single integer — minimal number of additional marks, that Leha has to add in order to change Noora's final mark to *k*.
[ "2 10\n8 9\n", "3 5\n4 4 4\n" ]
[ "4", "3" ]
Consider the first example testcase. Maximal mark is 10, Noora received two marks — 8 and 9, so current final mark is 9. To fix it, Leha can add marks [10, 10, 10, 10] (4 marks in total) to the registry, achieving Noora having average mark equal to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1b961585522f76271546da990a6228e7c666277f.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Consequently, new final mark is 10. Less number of marks won't fix the situation. In the second example Leha can add [5, 5, 5] to the registry, so that making average mark equal to 4.5, which is enough to have 5 in the certificate.
500
[ { "input": "2 10\n8 9", "output": "4" }, { "input": "3 5\n4 4 4", "output": "3" }, { "input": "3 10\n10 8 9", "output": "3" }, { "input": "2 23\n21 23", "output": "2" }, { "input": "5 10\n5 10 10 9 10", "output": "7" }, { "input": "12 50\n18 10 26 22 22 23 14 21 27 18 25 12", "output": "712" }, { "input": "38 12\n2 7 10 8 5 3 5 6 3 6 5 1 9 7 7 8 3 4 4 4 5 2 3 6 6 1 6 7 4 4 8 7 4 5 3 6 6 6", "output": "482" }, { "input": "63 86\n32 31 36 29 36 26 28 38 39 32 29 26 33 38 36 38 36 28 43 48 28 33 25 39 39 27 34 25 37 28 40 26 30 31 42 32 36 44 29 36 30 35 48 40 26 34 30 33 33 46 42 24 36 38 33 51 33 41 38 29 29 32 28", "output": "6469" }, { "input": "100 38\n30 24 38 31 31 33 32 32 29 34 29 22 27 23 34 25 32 30 30 26 16 27 38 33 38 38 37 34 32 27 33 23 33 32 24 24 30 36 29 30 33 30 29 30 36 33 33 35 28 24 30 32 38 29 30 36 31 30 27 38 31 36 15 37 32 27 29 24 38 33 28 29 34 21 37 35 32 31 27 25 27 28 31 31 36 38 35 35 36 29 35 22 38 31 38 28 31 27 34 31", "output": "1340" }, { "input": "33 69\n60 69 68 69 69 60 64 60 62 59 54 47 60 62 69 69 69 58 67 69 62 69 68 53 69 69 66 66 57 58 65 69 61", "output": "329" }, { "input": "39 92\n19 17 16 19 15 30 21 25 14 17 19 19 23 16 14 15 17 19 29 15 11 25 19 14 18 20 10 16 11 15 18 20 20 17 18 16 12 17 16", "output": "5753" }, { "input": "68 29\n29 29 29 29 29 28 29 29 29 27 29 29 29 29 29 29 29 23 29 29 26 29 29 29 29 29 29 29 29 29 29 29 29 29 29 29 26 29 29 29 29 29 29 29 29 29 29 29 29 22 29 29 29 29 29 29 29 29 29 29 29 29 29 28 29 29 29 29", "output": "0" }, { "input": "75 30\n22 18 21 26 23 18 28 30 24 24 19 25 28 30 23 29 18 23 23 30 26 30 17 30 18 19 25 26 26 15 27 23 30 21 19 26 25 30 25 28 20 22 22 21 26 17 23 23 24 15 25 19 18 22 30 30 29 21 30 28 28 30 27 25 24 15 22 19 30 21 20 30 18 20 25", "output": "851" }, { "input": "78 43\n2 7 6 5 5 6 4 5 3 4 6 8 4 5 5 4 3 1 2 4 4 6 5 6 4 4 6 4 8 4 6 5 6 1 4 5 6 3 2 5 2 5 3 4 8 8 3 3 4 4 6 6 5 4 5 5 7 9 3 9 6 4 7 3 6 9 6 5 1 7 2 5 6 3 6 2 5 4", "output": "5884" }, { "input": "82 88\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 2 1 1 2 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1", "output": "14170" }, { "input": "84 77\n28 26 36 38 37 44 48 34 40 22 42 35 40 37 30 31 33 35 36 55 47 36 33 47 40 38 27 38 36 33 35 31 47 33 30 38 38 47 49 24 38 37 28 43 39 36 34 33 29 38 36 43 48 38 36 34 33 34 35 31 26 33 39 37 37 37 35 52 47 30 24 46 38 26 43 46 41 50 33 40 36 41 37 30", "output": "6650" }, { "input": "94 80\n21 19 15 16 27 16 20 18 19 19 15 15 20 19 19 21 20 19 13 17 15 9 17 15 23 15 12 18 12 13 15 12 14 13 14 17 20 20 14 21 15 6 10 23 24 8 18 18 13 23 17 22 17 19 19 18 17 24 8 16 18 20 24 19 10 19 15 10 13 14 19 15 16 19 20 15 14 21 16 16 14 14 22 19 12 11 14 13 19 32 16 16 13 20", "output": "11786" }, { "input": "96 41\n13 32 27 34 28 34 30 26 21 24 29 20 25 34 25 16 27 15 22 22 34 22 25 19 23 17 17 22 26 24 23 20 21 27 19 33 13 24 22 18 30 30 27 14 26 24 20 20 22 11 19 31 19 29 18 28 30 22 17 15 28 32 17 24 17 24 24 19 26 23 22 29 18 22 23 29 19 32 26 23 22 22 24 23 27 30 24 25 21 21 33 19 35 27 34 28", "output": "3182" }, { "input": "1 26\n26", "output": "0" }, { "input": "99 39\n25 28 30 28 32 34 31 28 29 28 29 30 33 19 33 31 27 33 29 24 27 30 25 38 28 34 35 31 34 37 30 22 21 24 34 27 34 33 34 33 26 26 36 19 30 22 35 30 21 28 23 35 33 29 21 22 36 31 34 32 34 32 30 32 27 33 38 25 35 26 39 27 29 29 19 33 28 29 34 38 26 30 36 26 29 30 26 34 22 32 29 38 25 27 24 17 25 28 26", "output": "1807" }, { "input": "100 12\n7 6 6 3 5 5 9 8 7 7 4 7 12 6 9 5 6 3 4 7 9 10 7 7 5 3 9 6 9 9 6 7 4 10 4 8 8 6 9 8 6 5 7 4 10 7 5 6 8 9 3 4 8 5 4 8 6 10 5 8 7 5 9 8 5 8 5 6 9 11 4 9 5 5 11 4 6 6 7 3 8 9 6 7 10 4 7 6 9 4 8 11 5 4 10 8 5 10 11 4", "output": "946" }, { "input": "100 18\n1 2 2 2 2 2 1 1 1 2 3 1 3 1 1 4 2 4 1 2 1 2 1 3 2 1 2 1 1 1 2 1 2 2 1 1 4 3 1 1 2 1 3 3 2 1 2 2 1 1 1 1 3 1 1 2 2 1 1 1 5 1 2 1 3 2 2 1 4 2 2 1 1 1 1 1 1 1 1 2 2 1 2 1 1 1 2 1 2 2 2 1 1 3 1 1 2 1 1 2", "output": "3164" }, { "input": "100 27\n16 20 21 10 16 17 18 25 19 18 20 12 11 21 21 23 20 26 20 21 27 16 25 18 25 21 27 12 20 27 18 17 27 13 21 26 12 22 15 21 25 21 18 27 24 15 16 18 23 21 24 27 19 17 24 14 21 16 24 26 13 14 25 18 27 26 22 16 27 27 17 25 17 12 22 10 19 27 19 20 23 22 25 23 17 25 14 20 22 10 22 27 21 20 15 26 24 27 12 16", "output": "1262" }, { "input": "100 29\n20 18 23 24 14 14 16 23 22 17 18 22 21 21 19 19 14 11 18 19 16 22 25 20 14 13 21 24 18 16 18 29 17 25 12 10 18 28 11 16 17 14 15 20 17 20 18 22 10 16 16 20 18 19 29 18 25 27 17 19 24 15 24 25 16 23 19 16 16 20 19 15 12 21 20 13 21 15 15 23 16 23 17 13 17 21 13 18 17 18 18 20 16 12 19 15 27 14 11 18", "output": "2024" }, { "input": "100 30\n16 10 20 11 14 27 15 17 22 26 24 17 15 18 19 22 22 15 21 22 14 21 22 22 21 22 15 17 17 22 18 19 26 18 22 20 22 25 18 18 17 23 18 18 20 13 19 30 17 24 22 19 29 20 20 21 17 18 26 25 22 19 15 18 18 20 19 19 18 18 24 16 19 17 12 21 20 16 23 21 16 17 26 23 25 28 22 20 9 21 17 24 15 19 17 21 29 13 18 15", "output": "1984" }, { "input": "100 59\n56 58 53 59 59 48 59 54 46 59 59 58 48 59 55 59 59 50 59 56 59 59 59 59 59 59 59 57 59 53 45 53 50 59 50 55 58 54 59 56 54 59 59 59 59 48 56 59 59 57 59 59 48 43 55 57 39 59 46 55 55 52 58 57 51 59 59 59 59 53 59 43 51 54 46 59 57 43 50 59 47 58 59 59 59 55 46 56 55 59 56 47 56 56 46 51 47 48 59 55", "output": "740" }, { "input": "100 81\n6 7 6 6 7 6 6 6 3 9 4 5 4 3 4 6 6 6 1 3 9 5 2 3 8 5 6 9 6 6 6 5 4 4 7 7 3 6 11 7 6 4 8 7 12 6 4 10 2 4 9 11 7 4 7 7 8 8 6 7 9 8 4 5 8 13 6 6 6 8 6 2 5 6 7 5 4 4 4 4 2 6 4 8 3 4 7 7 6 7 7 10 5 10 6 7 4 11 8 4", "output": "14888" }, { "input": "100 100\n30 35 23 43 28 49 31 32 30 44 32 37 33 34 38 28 43 32 33 32 50 32 41 38 33 20 40 36 29 21 42 25 23 34 43 32 37 31 30 27 36 32 45 37 33 29 38 34 35 33 28 19 37 33 28 41 31 29 41 27 32 39 30 34 37 40 33 38 35 32 32 34 35 34 28 39 28 34 40 45 31 25 42 28 29 31 33 21 36 33 34 37 40 42 39 30 36 34 34 40", "output": "13118" }, { "input": "100 100\n71 87 100 85 89 98 90 90 71 65 76 75 85 100 81 100 91 80 73 89 86 78 82 89 77 92 78 90 100 81 85 89 73 100 66 60 72 88 91 73 93 76 88 81 86 78 83 77 74 93 97 94 85 78 82 78 91 91 100 78 89 76 78 82 81 78 83 88 87 83 78 98 85 97 98 89 88 75 76 86 74 81 70 76 86 84 99 100 89 94 72 84 82 88 83 89 78 99 87 76", "output": "3030" }, { "input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "19700" }, { "input": "100 100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "0" }, { "input": "100 100\n1 1 2 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "19696" }, { "input": "100 100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99", "output": "0" }, { "input": "100 100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 98 100 100 100 100 98 100 100 100 100 100 100 99 98 100 100 93 100 100 98 100 100 100 100 93 100 96 100 100 100 94 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 95 88 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "0" }, { "input": "100 100\n95 100 100 100 100 100 100 100 100 100 100 100 100 100 87 100 100 100 94 100 100 100 100 100 100 100 100 100 100 100 100 99 100 100 100 100 100 100 100 100 100 100 90 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 97 100 100 100 96 100 98 100 100 100 100 100 96 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 97 100 100 100 100", "output": "2" }, { "input": "100 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "100 2\n2 1 1 2 1 1 1 1 2 2 2 2 1 1 1 2 1 1 1 2 2 2 2 1 1 1 1 2 2 2 1 2 2 2 2 1 2 2 1 1 1 1 1 1 2 2 1 2 1 1 1 2 1 2 2 2 2 1 1 1 2 2 1 2 1 1 1 2 1 2 2 1 1 1 2 2 1 1 2 1 1 2 1 1 1 2 1 1 1 1 2 1 1 1 1 2 1 2 1 1", "output": "16" }, { "input": "3 5\n5 5 5", "output": "0" }, { "input": "7 7\n1 1 1 1 1 1 1", "output": "77" }, { "input": "1 1\n1", "output": "0" }, { "input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "19700" }, { "input": "4 10\n10 10 10 10", "output": "0" }, { "input": "1 10\n10", "output": "0" }, { "input": "10 1\n1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "3 10\n10 10 10", "output": "0" }, { "input": "2 4\n3 4", "output": "0" }, { "input": "1 2\n2", "output": "0" }, { "input": "3 4\n4 4 4", "output": "0" }, { "input": "3 2\n2 2 1", "output": "0" }, { "input": "5 5\n5 5 5 5 5", "output": "0" }, { "input": "3 3\n3 3 3", "output": "0" }, { "input": "2 9\n8 9", "output": "0" }, { "input": "3 10\n9 10 10", "output": "0" }, { "input": "1 3\n3", "output": "0" }, { "input": "2 2\n1 2", "output": "0" }, { "input": "2 10\n10 10", "output": "0" }, { "input": "23 14\n7 11 13 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14", "output": "0" }, { "input": "2 10\n9 10", "output": "0" }, { "input": "2 2\n2 2", "output": "0" }, { "input": "10 5\n5 5 5 5 5 5 5 5 5 4", "output": "0" }, { "input": "3 5\n4 5 5", "output": "0" }, { "input": "5 4\n4 4 4 4 4", "output": "0" }, { "input": "2 10\n10 9", "output": "0" }, { "input": "4 5\n3 5 5 5", "output": "0" }, { "input": "10 5\n5 5 5 5 5 5 5 5 5 5", "output": "0" }, { "input": "3 10\n10 10 9", "output": "0" }, { "input": "5 1\n1 1 1 1 1", "output": "0" }, { "input": "2 1\n1 1", "output": "0" }, { "input": "4 10\n9 10 10 10", "output": "0" }, { "input": "5 2\n2 2 2 2 2", "output": "0" }, { "input": "2 5\n4 5", "output": "0" }, { "input": "5 10\n10 10 10 10 10", "output": "0" }, { "input": "2 6\n6 6", "output": "0" }, { "input": "2 9\n9 9", "output": "0" }, { "input": "3 10\n10 9 10", "output": "0" }, { "input": "4 40\n39 40 40 40", "output": "0" }, { "input": "3 4\n3 4 4", "output": "0" }, { "input": "9 9\n9 9 9 9 9 9 9 9 9", "output": "0" }, { "input": "1 4\n4", "output": "0" }, { "input": "4 7\n1 1 1 1", "output": "44" }, { "input": "1 5\n5", "output": "0" }, { "input": "3 1\n1 1 1", "output": "0" }, { "input": "1 100\n100", "output": "0" }, { "input": "2 7\n3 5", "output": "10" }, { "input": "3 6\n6 6 6", "output": "0" }, { "input": "4 2\n1 2 2 2", "output": "0" }, { "input": "4 5\n4 5 5 5", "output": "0" }, { "input": "5 5\n1 1 1 1 1", "output": "35" }, { "input": "66 2\n1 2 2 2 2 1 1 2 1 2 2 2 2 2 2 1 2 1 2 1 2 1 2 1 2 1 1 1 1 2 2 1 2 2 1 1 2 1 2 2 1 1 1 2 1 2 1 2 1 2 1 2 2 2 2 1 2 2 1 2 1 1 1 2 2 1", "output": "0" }, { "input": "2 2\n2 1", "output": "0" }, { "input": "5 5\n5 5 5 4 5", "output": "0" }, { "input": "3 7\n1 1 1", "output": "33" }, { "input": "2 5\n5 5", "output": "0" }, { "input": "1 7\n1", "output": "11" }, { "input": "6 7\n1 1 1 1 1 1", "output": "66" }, { "input": "99 97\n15 80 78 69 12 84 36 51 89 77 88 10 1 19 67 85 6 36 8 70 14 45 88 97 22 13 75 57 83 27 13 97 9 90 68 51 76 37 5 2 16 92 11 48 13 77 35 19 15 74 22 29 21 12 28 42 56 5 32 41 62 75 71 71 68 72 24 77 11 28 78 27 53 88 74 66 1 42 18 16 18 39 75 38 81 5 13 39 40 75 13 36 53 83 9 54 57 63 64", "output": "10077" }, { "input": "8 7\n1 1 1 1 1 1 1 1", "output": "88" }, { "input": "3 2\n2 2 2", "output": "0" }, { "input": "6 5\n5 5 5 5 5 5", "output": "0" }, { "input": "10 5\n5 5 5 5 5 5 5 4 1 1", "output": "8" }, { "input": "1 5\n1", "output": "7" }, { "input": "10 10\n10 10 10 10 10 10 10 10 10 10", "output": "0" }, { "input": "2 3\n2 3", "output": "0" }, { "input": "1 9\n9", "output": "0" }, { "input": "74 2\n2 2 2 2 1 2 2 1 1 1 2 2 1 2 2 2 2 1 2 1 1 1 2 1 1 2 2 1 2 1 1 2 1 1 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 1 1 2 1 1 1 1 1 1 2 2 2 1 1 1 1 1 2 2 2 2 2 2 1 2", "output": "0" }, { "input": "5 5\n5 5 5 5 4", "output": "0" } ]
1,604,367,277
2,147,483,647
Python 3
OK
TESTS
106
109
307,200
n, k = map(int, input().split()) a = [int(i)for i in input().split()] a = sum(a) x = 0 i = 0 while k-a/(n+x) > 0.5: i+=1 a+=k*i x+=i if k-a/(n+x) <= 0.5: a-=k*i x-=i break while k-a/(n+x) > 0.5: a+=k x+=1 print(x)
Title: Straight <<A>> Time Limit: None seconds Memory Limit: None megabytes Problem Description: Noora is a student of one famous high school. It's her final year in school — she is going to study in university next year. However, she has to get an «A» graduation certificate in order to apply to a prestigious one. In school, where Noora is studying, teachers are putting down marks to the online class register, which are integers from 1 to *k*. The worst mark is 1, the best is *k*. Mark that is going to the certificate, is calculated as an average of all the marks, rounded to the closest integer. If several answers are possible, rounding up is produced. For example, 7.3 is rounded to 7, but 7.5 and 7.8784 — to 8. For instance, if Noora has marks [8,<=9], then the mark to the certificate is 9, because the average is equal to 8.5 and rounded to 9, but if the marks are [8,<=8,<=9], Noora will have graduation certificate with 8. To graduate with «A» certificate, Noora has to have mark *k*. Noora got *n* marks in register this year. However, she is afraid that her marks are not enough to get final mark *k*. Noora decided to ask for help in the internet, where hacker Leha immediately responded to her request. He is ready to hack class register for Noora and to add Noora any number of additional marks from 1 to *k*. At the same time, Leha want his hack be unseen to everyone, so he decided to add as less as possible additional marks. Please help Leha to calculate the minimal number of marks he has to add, so that final Noora's mark will become equal to *k*. Input Specification: The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*k*<=≤<=100) denoting the number of marks, received by Noora and the value of highest possible mark. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*k*) denoting marks received by Noora before Leha's hack. Output Specification: Print a single integer — minimal number of additional marks, that Leha has to add in order to change Noora's final mark to *k*. Demo Input: ['2 10\n8 9\n', '3 5\n4 4 4\n'] Demo Output: ['4', '3'] Note: Consider the first example testcase. Maximal mark is 10, Noora received two marks — 8 and 9, so current final mark is 9. To fix it, Leha can add marks [10, 10, 10, 10] (4 marks in total) to the registry, achieving Noora having average mark equal to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1b961585522f76271546da990a6228e7c666277f.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Consequently, new final mark is 10. Less number of marks won't fix the situation. In the second example Leha can add [5, 5, 5] to the registry, so that making average mark equal to 4.5, which is enough to have 5 in the certificate.
```python n, k = map(int, input().split()) a = [int(i)for i in input().split()] a = sum(a) x = 0 i = 0 while k-a/(n+x) > 0.5: i+=1 a+=k*i x+=i if k-a/(n+x) <= 0.5: a-=k*i x-=i break while k-a/(n+x) > 0.5: a+=k x+=1 print(x) ```
3
106
B
Choosing Laptop
PROGRAMMING
1,000
[ "brute force", "implementation" ]
B. Choosing Laptop
2
256
Vasya is choosing a laptop. The shop has *n* laptops to all tastes. Vasya is interested in the following properties: processor speed, ram and hdd. Vasya is a programmer and not a gamer which is why he is not interested in all other properties. If all three properties of a laptop are strictly less than those properties of some other laptop, then the first laptop is considered outdated by Vasya. Among all laptops Vasya does not consider outdated, he chooses the cheapest one. There are very many laptops, which is why Vasya decided to write a program that chooses the suitable laptop. However, Vasya doesn't have his own laptop yet and he asks you to help him.
The first line contains number *n* (1<=≤<=*n*<=≤<=100). Then follow *n* lines. Each describes a laptop as *speed* *ram* *hdd* *cost*. Besides, - *speed*, *ram*, *hdd* and *cost* are integers - 1000<=≤<=*speed*<=≤<=4200 is the processor's speed in megahertz - 256<=≤<=*ram*<=≤<=4096 the RAM volume in megabytes - 1<=≤<=*hdd*<=≤<=500 is the HDD in gigabytes - 100<=≤<=*cost*<=≤<=1000 is price in tugriks All laptops have different prices.
Print a single number — the number of a laptop Vasya will choose. The laptops are numbered with positive integers from 1 to *n* in the order in which they are given in the input data.
[ "5\n2100 512 150 200\n2000 2048 240 350\n2300 1024 200 320\n2500 2048 80 300\n2000 512 180 150\n" ]
[ "4" ]
In the third sample Vasya considers the first and fifth laptops outdated as all of their properties cannot match those of the third laptop. The fourth one is the cheapest among the laptops that are left. Thus, Vasya chooses the fourth laptop.
1,000
[ { "input": "5\n2100 512 150 200\n2000 2048 240 350\n2300 1024 200 320\n2500 2048 80 300\n2000 512 180 150", "output": "4" }, { "input": "2\n1500 500 50 755\n1600 600 80 700", "output": "2" }, { "input": "2\n1500 512 50 567\n1600 400 70 789", "output": "1" }, { "input": "4\n1000 300 5 700\n1100 400 10 600\n1200 500 15 500\n1300 600 20 400", "output": "4" }, { "input": "10\n2123 389 397 747\n2705 3497 413 241\n3640 984 470 250\n3013 2004 276 905\n3658 3213 353 602\n1428 626 188 523\n2435 1140 459 824\n2927 2586 237 860\n2361 4004 386 719\n2863 2429 476 310", "output": "2" }, { "input": "25\n2123 389 397 747\n2705 3497 413 241\n3640 984 470 250\n3013 2004 276 905\n3658 3213 353 602\n1428 626 188 523\n2435 1140 459 824\n2927 2586 237 860\n2361 4004 386 719\n2863 2429 476 310\n3447 3875 1 306\n3950 1901 31 526\n4130 1886 152 535\n1951 1840 122 814\n1798 3722 474 106\n2305 3979 82 971\n3656 3148 349 992\n1062 1648 320 491\n3113 3706 302 542\n3545 1317 184 853\n1277 2153 95 492\n2189 3495 427 655\n4014 3030 22 963\n1455 3840 155 485\n2760 717 309 891", "output": "15" }, { "input": "1\n1200 512 300 700", "output": "1" }, { "input": "1\n4200 4096 500 1000", "output": "1" }, { "input": "1\n1000 256 1 100", "output": "1" }, { "input": "2\n2000 500 200 100\n3000 600 100 200", "output": "1" }, { "input": "2\n2000 500 200 200\n3000 600 100 100", "output": "2" }, { "input": "2\n2000 600 100 100\n3000 500 200 200", "output": "1" }, { "input": "2\n2000 700 100 200\n3000 500 200 100", "output": "2" }, { "input": "2\n3000 500 100 100\n1500 600 200 200", "output": "1" }, { "input": "2\n3000 500 100 300\n1500 600 200 200", "output": "2" }, { "input": "3\n3467 1566 191 888\n3047 3917 3 849\n1795 1251 97 281", "output": "2" }, { "input": "4\n3835 1035 5 848\n2222 3172 190 370\n2634 2698 437 742\n1748 3112 159 546", "output": "2" }, { "input": "5\n3511 981 276 808\n3317 2320 354 878\n3089 702 20 732\n1088 2913 327 756\n3837 691 173 933", "output": "4" }, { "input": "6\n1185 894 287 455\n2465 3317 102 240\n2390 2353 81 615\n2884 603 170 826\n3202 2070 320 184\n3074 3776 497 466", "output": "5" }, { "input": "7\n3987 1611 470 720\n1254 4048 226 626\n1747 630 25 996\n2336 2170 402 123\n1902 3952 337 663\n1416 271 77 499\n1802 1399 419 929", "output": "4" }, { "input": "10\n3888 1084 420 278\n2033 277 304 447\n1774 514 61 663\n2055 3437 67 144\n1237 1590 145 599\n3648 663 244 525\n3691 2276 332 504\n1496 2655 324 313\n2462 1930 13 644\n1811 331 390 284", "output": "4" }, { "input": "13\n3684 543 70 227\n3953 1650 151 681\n2452 655 102 946\n3003 990 121 411\n2896 1936 158 155\n1972 717 366 754\n3989 2237 32 521\n2738 2140 445 965\n2884 1772 251 369\n2240 741 465 209\n4073 2812 494 414\n3392 955 425 133\n4028 717 90 123", "output": "11" }, { "input": "17\n3868 2323 290 182\n1253 3599 38 217\n2372 354 332 897\n1286 649 332 495\n1642 1643 301 216\n1578 792 140 299\n3329 3039 359 525\n1362 2006 172 183\n1058 3961 423 591\n3196 914 484 675\n3032 3752 217 954\n2391 2853 171 579\n4102 3170 349 516\n1218 1661 451 354\n3375 1997 196 404\n1030 918 198 893\n2546 2029 399 647", "output": "14" }, { "input": "22\n1601 1091 249 107\n2918 3830 312 767\n4140 409 393 202\n3485 2409 446 291\n2787 530 272 147\n2303 3400 265 206\n2164 1088 143 667\n1575 2439 278 863\n2874 699 369 568\n4017 1625 368 641\n3446 916 53 509\n3627 3229 328 256\n1004 2525 109 670\n2369 3299 57 351\n4147 3038 73 309\n3510 3391 390 470\n3308 3139 268 736\n3733 1054 98 809\n3967 2992 408 873\n2104 3191 83 687\n2223 2910 209 563\n1406 2428 147 673", "output": "3" }, { "input": "27\n1689 1927 40 270\n3833 2570 167 134\n2580 3589 390 300\n1898 2587 407 316\n1841 2772 411 187\n1296 288 407 506\n1215 263 236 307\n2737 1427 84 992\n1107 1879 284 866\n3311 2507 475 147\n2951 2214 209 375\n1352 2582 110 324\n2082 747 289 521\n2226 1617 209 108\n2253 1993 109 835\n2866 2360 29 206\n1431 3581 185 918\n3800 1167 463 943\n4136 1156 266 490\n3511 1396 478 169\n3498 1419 493 792\n2660 2165 204 172\n3509 2358 178 469\n1568 3564 276 319\n3871 2660 472 366\n3569 2829 146 761\n1365 2943 460 611", "output": "10" }, { "input": "2\n1000 2000 300 120\n1000 2000 300 130", "output": "1" }, { "input": "10\n2883 1110 230 501\n2662 821 163 215\n2776 1131 276 870\n2776 1131 276 596\n2776 1131 276 981\n2662 821 163 892\n2662 821 163 997\n2883 1110 230 132\n2776 1131 276 317\n2883 1110 230 481", "output": "8" }, { "input": "23\n1578 3681 380 163\n2640 3990 180 576\n3278 2311 131 386\n3900 513 443 873\n1230 1143 267 313\n2640 3990 180 501\n1230 1143 267 428\n1578 3681 380 199\n1578 3681 380 490\n3900 513 443 980\n3900 513 443 882\n3278 2311 131 951\n3278 2311 131 863\n2640 3990 180 916\n3278 2311 131 406\n3278 2311 131 455\n3278 2311 131 239\n1230 1143 267 439\n3900 513 443 438\n3900 513 443 514\n3278 2311 131 526\n1578 3681 380 123\n1578 3681 380 263", "output": "22" }, { "input": "6\n2100 512 150 200\n2000 2048 240 350\n2300 1024 200 320\n2500 2048 80 300\n2000 512 180 150\n1000 256 1 100", "output": "4" }, { "input": "2\n1000 256 1 100\n1000 256 1 101", "output": "1" }, { "input": "2\n1500 500 300 1000\n1500 500 300 900", "output": "2" }, { "input": "4\n1000 256 1 500\n1000 256 1 400\n1000 256 1 300\n1000 256 1 200", "output": "4" }, { "input": "3\n1500 1024 300 150\n1200 512 150 100\n1000 256 50 200", "output": "1" } ]
1,636,217,466
2,147,483,647
Python 3
OK
TESTS
55
122
4,505,600
def compare(l1, l2): for i in range(3): if l1[i]>=l2[i]: return False return True n = int(input()) laptop = [] outdated = [False]*n for i in range(n): laptop.append(list(map(int, input().split()))) for i in range(n): for j in range(n): if compare(laptop[i], laptop[j]): outdated[i] = True minCost, idx = 1001, -1 for i in range(n): if (not outdated[i]) and laptop[i][3]<minCost: minCost, idx = laptop[i][3], i+1 print(idx)
Title: Choosing Laptop Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is choosing a laptop. The shop has *n* laptops to all tastes. Vasya is interested in the following properties: processor speed, ram and hdd. Vasya is a programmer and not a gamer which is why he is not interested in all other properties. If all three properties of a laptop are strictly less than those properties of some other laptop, then the first laptop is considered outdated by Vasya. Among all laptops Vasya does not consider outdated, he chooses the cheapest one. There are very many laptops, which is why Vasya decided to write a program that chooses the suitable laptop. However, Vasya doesn't have his own laptop yet and he asks you to help him. Input Specification: The first line contains number *n* (1<=≤<=*n*<=≤<=100). Then follow *n* lines. Each describes a laptop as *speed* *ram* *hdd* *cost*. Besides, - *speed*, *ram*, *hdd* and *cost* are integers - 1000<=≤<=*speed*<=≤<=4200 is the processor's speed in megahertz - 256<=≤<=*ram*<=≤<=4096 the RAM volume in megabytes - 1<=≤<=*hdd*<=≤<=500 is the HDD in gigabytes - 100<=≤<=*cost*<=≤<=1000 is price in tugriks All laptops have different prices. Output Specification: Print a single number — the number of a laptop Vasya will choose. The laptops are numbered with positive integers from 1 to *n* in the order in which they are given in the input data. Demo Input: ['5\n2100 512 150 200\n2000 2048 240 350\n2300 1024 200 320\n2500 2048 80 300\n2000 512 180 150\n'] Demo Output: ['4'] Note: In the third sample Vasya considers the first and fifth laptops outdated as all of their properties cannot match those of the third laptop. The fourth one is the cheapest among the laptops that are left. Thus, Vasya chooses the fourth laptop.
```python def compare(l1, l2): for i in range(3): if l1[i]>=l2[i]: return False return True n = int(input()) laptop = [] outdated = [False]*n for i in range(n): laptop.append(list(map(int, input().split()))) for i in range(n): for j in range(n): if compare(laptop[i], laptop[j]): outdated[i] = True minCost, idx = 1001, -1 for i in range(n): if (not outdated[i]) and laptop[i][3]<minCost: minCost, idx = laptop[i][3], i+1 print(idx) ```
3.961108
141
A
Amusing Joke
PROGRAMMING
800
[ "implementation", "sortings", "strings" ]
null
null
So, the New Year holidays are over. Santa Claus and his colleagues can take a rest and have guests at last. When two "New Year and Christmas Men" meet, thear assistants cut out of cardboard the letters from the guest's name and the host's name in honor of this event. Then the hung the letters above the main entrance. One night, when everyone went to bed, someone took all the letters of our characters' names. Then he may have shuffled the letters and put them in one pile in front of the door. The next morning it was impossible to find the culprit who had made the disorder. But everybody wondered whether it is possible to restore the names of the host and his guests from the letters lying at the door? That is, we need to verify that there are no extra letters, and that nobody will need to cut more letters. Help the "New Year and Christmas Men" and their friends to cope with this problem. You are given both inscriptions that hung over the front door the previous night, and a pile of letters that were found at the front door next morning.
The input file consists of three lines: the first line contains the guest's name, the second line contains the name of the residence host and the third line contains letters in a pile that were found at the door in the morning. All lines are not empty and contain only uppercase Latin letters. The length of each line does not exceed 100.
Print "YES" without the quotes, if the letters in the pile could be permuted to make the names of the "New Year and Christmas Men". Otherwise, print "NO" without the quotes.
[ "SANTACLAUS\nDEDMOROZ\nSANTAMOROZDEDCLAUS\n", "PAPAINOEL\nJOULUPUKKI\nJOULNAPAOILELUPUKKI\n", "BABBONATALE\nFATHERCHRISTMAS\nBABCHRISTMASBONATALLEFATHER\n" ]
[ "YES\n", "NO\n", "NO\n" ]
In the first sample the letters written in the last line can be used to write the names and there won't be any extra letters left. In the second sample letter "P" is missing from the pile and there's an extra letter "L". In the third sample there's an extra letter "L".
500
[ { "input": "SANTACLAUS\nDEDMOROZ\nSANTAMOROZDEDCLAUS", "output": "YES" }, { "input": "PAPAINOEL\nJOULUPUKKI\nJOULNAPAOILELUPUKKI", "output": "NO" }, { "input": "BABBONATALE\nFATHERCHRISTMAS\nBABCHRISTMASBONATALLEFATHER", "output": "NO" }, { "input": "B\nA\nAB", "output": "YES" }, { "input": "ONDOL\nJNPB\nONLNJBODP", "output": "YES" }, { "input": "Y\nW\nYW", "output": "YES" }, { "input": "OI\nM\nIMO", "output": "YES" }, { "input": "VFQRWWWACX\nGHZJPOQUSXRAQDGOGMR\nOPAWDOUSGWWCGQXXQAZJRQRGHRMVF", "output": "YES" }, { "input": "JUTCN\nPIGMZOPMEUFADQBW\nNWQGZMAIPUPOMCDUB", "output": "NO" }, { "input": "Z\nO\nZOCNDOLTBZKQLTBOLDEGXRHZGTTPBJBLSJCVSVXISQZCSFDEBXRCSGBGTHWOVIXYHACAGBRYBKBJAEPIQZHVEGLYH", "output": "NO" }, { "input": "IQ\nOQ\nQOQIGGKFNHJSGCGM", "output": "NO" }, { "input": "ROUWANOPNIGTVMIITVMZ\nOQTUPZMTKUGY\nVTVNGZITGPUNPMQOOATUUIYIWMMKZOTR", "output": "YES" }, { "input": "OVQELLOGFIOLEHXMEMBJDIGBPGEYFG\nJNKFPFFIJOFHRIFHXEWYZOPDJBZTJZKBWQTECNHRFSJPJOAPQT\nYAIPFFFEXJJNEJPLREIGODEGQZVMCOBDFKWTMWJSBEBTOFFQOHIQJLHFNXIGOHEZRZLFOKJBJPTPHPGY", "output": "YES" }, { "input": "NBJGVNGUISUXQTBOBKYHQCOOVQWUXWPXBUDLXPKX\nNSFQDFUMQDQWQ\nWXKKVNTDQQFXCUQBIMQGQHSLVGWSBFYBUPOWPBDUUJUXQNOQDNXOX", "output": "YES" }, { "input": "IJHHGKCXWDBRWJUPRDBZJLNTTNWKXLUGJSBWBOAUKWRAQWGFNL\nNJMWRMBCNPHXTDQQNZ\nWDNJRCLILNQRHWBANLTXWMJBPKUPGKJDJZAQWKTZFBRCTXHHBNXRGUQUNBNMWODGSJWW", "output": "YES" }, { "input": "SRROWANGUGZHCIEFYMQVTWVOMDWPUZJFRDUMVFHYNHNTTGNXCJ\nDJYWGLBFCCECXFHOLORDGDCNRHPWXNHXFCXQCEZUHRRNAEKUIX\nWCUJDNYHNHYOPWMHLDCDYRWBVOGHFFUKOZTXJRXJHRGWICCMRNEVNEGQWTZPNFCSHDRFCFQDCXMHTLUGZAXOFNXNVGUEXIACRERU", "output": "YES" }, { "input": "H\nJKFGHMIAHNDBMFXWYQLZRSVNOTEGCQSVUBYUOZBTNKTXPFQDCMKAGFITEUGOYDFIYQIORMFJEOJDNTFVIQEBICSNGKOSNLNXJWC\nBQSVDOGIHCHXSYNYTQFCHNJGYFIXTSOQINZOKSVQJMTKNTGFNXAVTUYEONMBQMGJLEWJOFGEARIOPKFUFCEMUBRBDNIIDFZDCLWK", "output": "YES" }, { "input": "DSWNZRFVXQ\nPVULCZGOOU\nUOLVZXNUPOQRZGWFVDSCANQTCLEIE", "output": "NO" }, { "input": "EUHTSCENIPXLTSBMLFHD\nIZAVSZPDLXOAGESUSE\nLXAELAZ", "output": "NO" }, { "input": "WYSJFEREGELSKRQRXDXCGBODEFZVSI\nPEJKMGFLBFFDWRCRFSHVEFLEBTJCVCHRJTLDTISHPOGFWPLEWNYJLMXWIAOTYOXMV\nHXERTZWLEXTPIOTFRVMEJVYFFJLRPFMXDEBNSGCEOFFCWTKIDDGCFYSJKGLHBORWEPLDRXRSJYBGASSVCMHEEJFLVI", "output": "NO" }, { "input": "EPBMDIUQAAUGLBIETKOKFLMTCVEPETWJRHHYKCKU\nHGMAETVPCFZYNNKDQXVXUALHYLOTCHM\nECGXACVKEYMCEDOTMKAUFHLHOMT", "output": "NO" }, { "input": "NUBKQEJHALANSHEIFUZHYEZKKDRFHQKAJHLAOWTZIMOCWOVVDW\nEFVOBIGAUAUSQGVSNBKNOBDMINODMFSHDL\nKLAMKNTHBFFOHVKWICHBKNDDQNEISODUSDNLUSIOAVWY", "output": "NO" }, { "input": "VXINHOMEQCATZUGAJEIUIZZLPYFGUTVLNBNWCUVMEENUXKBWBGZTMRJJVJDLVSLBABVCEUDDSQFHOYPYQTWVAGTWOLKYISAGHBMC\nZMRGXPZSHOGCSAECAPGVOIGCWEOWWOJXLGYRDMPXBLOKZVRACPYQLEQGFQCVYXAGBEBELUTDAYEAGPFKXRULZCKFHZCHVCWIRGPK\nRCVUXGQVNWFGRUDLLENNDQEJHYYVWMKTLOVIPELKPWCLSQPTAXAYEMGWCBXEVAIZGGDDRBRT", "output": "NO" }, { "input": "PHBDHHWUUTZAHELGSGGOPOQXSXEZIXHZTOKYFBQLBDYWPVCNQSXHEAXRRPVHFJBVBYCJIFOTQTWSUOWXLKMVJJBNLGTVITWTCZZ\nFUPDLNVIHRWTEEEHOOEC\nLOUSUUSZCHJBPEWIILUOXEXRQNCJEGTOBRVZLTTZAHTKVEJSNGHFTAYGY", "output": "NO" }, { "input": "GDSLNIIKTO\nJF\nPDQYFKDTNOLI", "output": "NO" }, { "input": "AHOKHEKKPJLJIIWJRCGY\nORELJCSIX\nZVWPXVFWFSWOXXLIHJKPXIOKRELYE", "output": "NO" }, { "input": "ZWCOJFORBPHXCOVJIDPKVECMHVHCOC\nTEV\nJVGTBFTLFVIEPCCHODOFOMCVZHWXVCPEH", "output": "NO" }, { "input": "AGFIGYWJLVMYZGNQHEHWKJIAWBPUAQFERMCDROFN\nPMJNHMVNRGCYZAVRWNDSMLSZHFNYIUWFPUSKKIGU\nMCDVPPRXGUAYLSDRHRURZASXUWZSIIEZCPXUVEONKNGNWRYGOSFMCKESMVJZHWWUCHWDQMLASLNNMHAU", "output": "NO" }, { "input": "XLOWVFCZSSXCSYQTIIDKHNTKNKEEDFMDZKXSPVLBIDIREDUAIN\nZKIWNDGBISDB\nSLPKLYFYSRNRMOSWYLJJDGFFENPOXYLPZFTQDANKBDNZDIIEWSUTTKYBKVICLG", "output": "NO" }, { "input": "PMUKBTRKFIAYVGBKHZHUSJYSSEPEOEWPOSPJLWLOCTUYZODLTUAFCMVKGQKRRUSOMPAYOTBTFPXYAZXLOADDEJBDLYOTXJCJYTHA\nTWRRAJLCQJTKOKWCGUH\nEWDPNXVCXWCDQCOYKKSOYTFSZTOOPKPRDKFJDETKSRAJRVCPDOBWUGPYRJPUWJYWCBLKOOTUPBESTOFXZHTYLLMCAXDYAEBUTAHM", "output": "NO" }, { "input": "QMIMGQRQDMJDPNFEFXSXQMCHEJKTWCTCVZPUAYICOIRYOWKUSIWXJLHDYWSBOITHTMINXFKBKAWZTXXBJIVYCRWKXNKIYKLDDXL\nV\nFWACCXBVDOJFIUAVYRALBYJKXXWIIFORRUHKHCXLDBZMXIYJWISFEAWTIQFIZSBXMKNOCQKVKRWDNDAMQSTKYLDNYVTUCGOJXJTW", "output": "NO" }, { "input": "XJXPVOOQODELPPWUISSYVVXRJTYBPDHJNENQEVQNVFIXSESKXVYPVVHPMOSX\nLEXOPFPVPSZK\nZVXVPYEYOYXVOISVLXPOVHEQVXPNQJIOPFDTXEUNMPEPPHELNXKKWSVSOXSBPSJDPVJVSRFQ", "output": "YES" }, { "input": "OSKFHGYNQLSRFSAHPXKGPXUHXTRBJNAQRBSSWJVEENLJCDDHFXVCUNPZAIVVO\nFNUOCXAGRRHNDJAHVVLGGEZQHWARYHENBKHP\nUOEFNWVXCUNERLKVTHAGPSHKHDYFPYWZHJKHQLSNFBJHVJANRXCNSDUGVDABGHVAOVHBJZXGRACHRXEGNRPQEAPORQSILNXFS", "output": "YES" }, { "input": "VYXYVVACMLPDHONBUTQFZTRREERBLKUJYKAHZRCTRLRCLOZYWVPBRGDQPFPQIF\nFE\nRNRPEVDRLYUQFYRZBCQLCYZEABKLRXCJLKVZBVFUEYRATOMDRTHFPGOWQVTIFPPH", "output": "YES" }, { "input": "WYXUZQJQNLASEGLHPMSARWMTTQMQLVAZLGHPIZTRVTCXDXBOLNXZPOFCTEHCXBZ\nBLQZRRWP\nGIQZXPLTTMNHQVWPPEAPLOCDMBSTHRCFLCQRRZXLVAOQEGZBRUZJXXZTMAWLZHSLWNQTYXB", "output": "YES" }, { "input": "MKVJTSSTDGKPVVDPYSRJJYEVGKBMSIOKHLZQAEWLRIBINVRDAJIBCEITKDHUCCVY\nPUJJQFHOGZKTAVNUGKQUHMKTNHCCTI\nQVJKUSIGTSVYUMOMLEGHWYKSKQTGATTKBNTKCJKJPCAIRJIRMHKBIZISEGFHVUVQZBDERJCVAKDLNTHUDCHONDCVVJIYPP", "output": "YES" }, { "input": "OKNJOEYVMZXJMLVJHCSPLUCNYGTDASKSGKKCRVIDGEIBEWRVBVRVZZTLMCJLXHJIA\nDJBFVRTARTFZOWN\nAGHNVUNJVCPLWSVYBJKZSVTFGLELZASLWTIXDDJXCZDICTVIJOTMVEYOVRNMJGRKKHRMEBORAKFCZJBR", "output": "YES" }, { "input": "OQZACLPSAGYDWHFXDFYFRRXWGIEJGSXWUONAFWNFXDTGVNDEWNQPHUXUJNZWWLBPYL\nOHBKWRFDRQUAFRCMT\nWIQRYXRJQWWRUWCYXNXALKFZGXFTLOODWRDPGURFUFUQOHPWBASZNVWXNCAGHWEHFYESJNFBMNFDDAPLDGT", "output": "YES" }, { "input": "OVIRQRFQOOWVDEPLCJETWQSINIOPLTLXHSQWUYUJNFBMKDNOSHNJQQCDHZOJVPRYVSV\nMYYDQKOOYPOOUELCRIT\nNZSOTVLJTTVQLFHDQEJONEOUOFOLYVSOIYUDNOSIQVIRMVOERCLMYSHPCQKIDRDOQPCUPQBWWRYYOXJWJQPNKH", "output": "YES" }, { "input": "WGMBZWNMSJXNGDUQUJTCNXDSJJLYRDOPEGPQXYUGBESDLFTJRZDDCAAFGCOCYCQMDBWK\nYOBMOVYTUATTFGJLYUQD\nDYXVTLQCYFJUNJTUXPUYOPCBCLBWNSDUJRJGWDOJDSQAAMUOJWSYERDYDXYTMTOTMQCGQZDCGNFBALGGDFKZMEBG", "output": "YES" }, { "input": "CWLRBPMEZCXAPUUQFXCUHAQTLPBTXUUKWVXKBHKNSSJFEXLZMXGVFHHVTPYAQYTIKXJJE\nMUFOSEUEXEQTOVLGDSCWM\nJUKEQCXOXWEHCGKFPBIGMWVJLXUONFXBYTUAXERYTXKCESKLXAEHVPZMMUFTHLXTTZSDMBJLQPEUWCVUHSQQVUASPF", "output": "YES" }, { "input": "IDQRX\nWETHO\nODPDGBHVUVSSISROHQJTUKPUCLXABIZQQPPBPKOSEWGEHRSRRNBAVLYEMZISMWWGKHVTXKUGUXEFBSWOIWUHRJGMWBMHQLDZHBWA", "output": "NO" }, { "input": "IXFDY\nJRMOU\nDF", "output": "NO" }, { "input": "JPSPZ\nUGCUB\nJMZZZZZZZZ", "output": "NO" }, { "input": "AC\nA\nBBA", "output": "NO" }, { "input": "UIKWWKXLSHTOOZOVGXKYSOJEHAUEEG\nKZXQDWJJWRXFHKJDQHJK\nXMZHTFOGEXAUJXXJUYVJIFOTKLZHDKELJWERHMGAWGKWAQKEKHIDWGGZVYOHKXRPWSJDPESFJUMKQYWBYUTHQYEFZUGKQOBHYDWB", "output": "NO" }, { "input": "PXWRXRPFLR\nPJRWWXIVHODV\nXW", "output": "NO" }, { "input": "CHTAZVHGSHCVIBK\nEQINEBKXEPYJSAZIMLDF\nZCZZZZDZMCZZEZDZZEZZZZQZZBZZZOZZCZE", "output": "NO" }, { "input": "GXPZFSELJJNDAXYRV\nUYBKPMVBSOVOJWMONLTJOJCNQKMTAHEWLHOWIIBH\nHCWNFWJPEJIWOVPTBMVCRJLSISSVNOHCKLBFMIUAIMASQWPXEYXBOXQGFEMYJLBKDCZIMJNHOJEDGGANIVYKQTUOSOVOPWHVJGXH", "output": "NO" }, { "input": "LFGJCJJDUTUP\nOVSBILTIYCJCRHKCIXCETJQJJ\nGIJJTJCLTJJJ", "output": "NO" }, { "input": "GIO\nPRL\nPRL", "output": "NO" }, { "input": "A\nB\nABC", "output": "NO" }, { "input": "KKK\nKKK\nZZZZZ", "output": "NO" }, { "input": "ZMYGQLDBLAPN\nZFJBKWHROVNPSJQUDFTHOCGREUFLYIWYICD\nZMJZZEDAZANKZZZZZZEZZBZDZZZZZZKHZZFZZZDZNZMDZZA", "output": "NO" } ]
1,691,585,138
2,147,483,647
Python 3
OK
TESTS
54
92
0
def main(): alpha_length = 26 first = [0] * alpha_length second = [0] * alpha_length line = input().strip() for char in line: first[ord(char) - ord('A')] += 1 line = input().strip() for char in line: first[ord(char) - ord('A')] += 1 line = input().strip() for char in line: second[ord(char) - ord('A')] += 1 output = "YES" for k in range(alpha_length): if first[k] != second[k]: output = "NO" break print(output) if __name__ == "__main__": main()
Title: Amusing Joke Time Limit: None seconds Memory Limit: None megabytes Problem Description: So, the New Year holidays are over. Santa Claus and his colleagues can take a rest and have guests at last. When two "New Year and Christmas Men" meet, thear assistants cut out of cardboard the letters from the guest's name and the host's name in honor of this event. Then the hung the letters above the main entrance. One night, when everyone went to bed, someone took all the letters of our characters' names. Then he may have shuffled the letters and put them in one pile in front of the door. The next morning it was impossible to find the culprit who had made the disorder. But everybody wondered whether it is possible to restore the names of the host and his guests from the letters lying at the door? That is, we need to verify that there are no extra letters, and that nobody will need to cut more letters. Help the "New Year and Christmas Men" and their friends to cope with this problem. You are given both inscriptions that hung over the front door the previous night, and a pile of letters that were found at the front door next morning. Input Specification: The input file consists of three lines: the first line contains the guest's name, the second line contains the name of the residence host and the third line contains letters in a pile that were found at the door in the morning. All lines are not empty and contain only uppercase Latin letters. The length of each line does not exceed 100. Output Specification: Print "YES" without the quotes, if the letters in the pile could be permuted to make the names of the "New Year and Christmas Men". Otherwise, print "NO" without the quotes. Demo Input: ['SANTACLAUS\nDEDMOROZ\nSANTAMOROZDEDCLAUS\n', 'PAPAINOEL\nJOULUPUKKI\nJOULNAPAOILELUPUKKI\n', 'BABBONATALE\nFATHERCHRISTMAS\nBABCHRISTMASBONATALLEFATHER\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: In the first sample the letters written in the last line can be used to write the names and there won't be any extra letters left. In the second sample letter "P" is missing from the pile and there's an extra letter "L". In the third sample there's an extra letter "L".
```python def main(): alpha_length = 26 first = [0] * alpha_length second = [0] * alpha_length line = input().strip() for char in line: first[ord(char) - ord('A')] += 1 line = input().strip() for char in line: first[ord(char) - ord('A')] += 1 line = input().strip() for char in line: second[ord(char) - ord('A')] += 1 output = "YES" for k in range(alpha_length): if first[k] != second[k]: output = "NO" break print(output) if __name__ == "__main__": main() ```
3
877
B
Nikita and string
PROGRAMMING
1,500
[ "brute force", "dp" ]
null
null
One day Nikita found the string containing letters "a" and "b" only. Nikita thinks that string is beautiful if it can be cut into 3 strings (possibly empty) without changing the order of the letters, where the 1-st and the 3-rd one contain only letters "a" and the 2-nd contains only letters "b". Nikita wants to make the string beautiful by removing some (possibly none) of its characters, but without changing their order. What is the maximum length of the string he can get?
The first line contains a non-empty string of length not greater than 5<=000 containing only lowercase English letters "a" and "b".
Print a single integer — the maximum possible size of beautiful string Nikita can get.
[ "abba\n", "bab\n" ]
[ "4", "2" ]
It the first sample the string is already beautiful. In the second sample he needs to delete one of "b" to make it beautiful.
1,000
[ { "input": "abba", "output": "4" }, { "input": "bab", "output": "2" }, { "input": "bbabbbaabbbb", "output": "9" }, { "input": "bbabbbbbaaba", "output": "10" }, { "input": "bbabbbababaa", "output": "9" }, { "input": "aabbaababbab", "output": "8" }, { "input": "a", "output": "1" }, { "input": "b", "output": "1" }, { "input": "ab", "output": "2" }, { "input": "ba", "output": "2" }, { "input": "bb", "output": "2" }, { "input": "aa", "output": "2" }, { "input": "babbbaab", "output": "6" }, { "input": "abaaaa", "output": "6" }, { "input": "aaa", "output": "3" } ]
1,604,178,349
1,549
PyPy 3
OK
TESTS
46
170
2,355,200
s = input() n = len(s) dp = [] dp.append((0, 0, 0)) for i in range(n): if s[i] == 'a': dp.append((dp[-1][0] + 1, dp[-1][1], max(dp[-1][1:]) + 1)) elif s[i] == 'b': dp.append((dp[-1][0], max(dp[-1][1], dp[-1][0]) + 1, dp[-1][-1])) print(max(dp[-1]))
Title: Nikita and string Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Nikita found the string containing letters "a" and "b" only. Nikita thinks that string is beautiful if it can be cut into 3 strings (possibly empty) without changing the order of the letters, where the 1-st and the 3-rd one contain only letters "a" and the 2-nd contains only letters "b". Nikita wants to make the string beautiful by removing some (possibly none) of its characters, but without changing their order. What is the maximum length of the string he can get? Input Specification: The first line contains a non-empty string of length not greater than 5<=000 containing only lowercase English letters "a" and "b". Output Specification: Print a single integer — the maximum possible size of beautiful string Nikita can get. Demo Input: ['abba\n', 'bab\n'] Demo Output: ['4', '2'] Note: It the first sample the string is already beautiful. In the second sample he needs to delete one of "b" to make it beautiful.
```python s = input() n = len(s) dp = [] dp.append((0, 0, 0)) for i in range(n): if s[i] == 'a': dp.append((dp[-1][0] + 1, dp[-1][1], max(dp[-1][1:]) + 1)) elif s[i] == 'b': dp.append((dp[-1][0], max(dp[-1][1], dp[-1][0]) + 1, dp[-1][-1])) print(max(dp[-1])) ```
3
579
A
Raising Bacteria
PROGRAMMING
1,000
[ "bitmasks" ]
null
null
You are a lover of bacteria. You want to raise some bacteria in a box. Initially, the box is empty. Each morning, you can put any number of bacteria into the box. And each night, every bacterium in the box will split into two bacteria. You hope to see exactly *x* bacteria in the box at some moment. What is the minimum number of bacteria you need to put into the box across those days?
The only line containing one integer *x* (1<=≤<=*x*<=≤<=109).
The only line containing one integer: the answer.
[ "5\n", "8\n" ]
[ "2\n", "1\n" ]
For the first sample, we can add one bacterium in the box in the first day morning and at the third morning there will be 4 bacteria in the box. Now we put one more resulting 5 in the box. We added 2 bacteria in the process so the answer is 2. For the second sample, we can put one in the first morning and in the 4-th morning there will be 8 in the box. So the answer is 1.
250
[ { "input": "5", "output": "2" }, { "input": "8", "output": "1" }, { "input": "536870911", "output": "29" }, { "input": "1", "output": "1" }, { "input": "343000816", "output": "14" }, { "input": "559980448", "output": "12" }, { "input": "697681824", "output": "14" }, { "input": "41313494", "output": "14" }, { "input": "673935585", "output": "13" }, { "input": "117422204", "output": "19" }, { "input": "954746654", "output": "15" }, { "input": "536838144", "output": "14" }, { "input": "1000000000", "output": "13" }, { "input": "2", "output": "1" }, { "input": "3", "output": "2" }, { "input": "4", "output": "1" }, { "input": "6", "output": "2" }, { "input": "7", "output": "3" }, { "input": "9", "output": "2" }, { "input": "10", "output": "2" }, { "input": "999999999", "output": "21" }, { "input": "999999998", "output": "20" }, { "input": "999999997", "output": "20" }, { "input": "999999996", "output": "19" }, { "input": "999999995", "output": "20" }, { "input": "999999994", "output": "19" }, { "input": "999999993", "output": "19" }, { "input": "999999992", "output": "18" }, { "input": "999999991", "output": "20" }, { "input": "999999990", "output": "19" }, { "input": "536870910", "output": "28" }, { "input": "536870912", "output": "1" }, { "input": "536870913", "output": "2" }, { "input": "536870914", "output": "2" }, { "input": "22", "output": "3" }, { "input": "14", "output": "3" } ]
1,698,396,637
2,147,483,647
PyPy 3-64
OK
TESTS
36
61
0
x = int(input()) i = 1 while x//2 > 0: if x % 2 == 1: i += 1 x = x // 2 print(i)
Title: Raising Bacteria Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are a lover of bacteria. You want to raise some bacteria in a box. Initially, the box is empty. Each morning, you can put any number of bacteria into the box. And each night, every bacterium in the box will split into two bacteria. You hope to see exactly *x* bacteria in the box at some moment. What is the minimum number of bacteria you need to put into the box across those days? Input Specification: The only line containing one integer *x* (1<=≤<=*x*<=≤<=109). Output Specification: The only line containing one integer: the answer. Demo Input: ['5\n', '8\n'] Demo Output: ['2\n', '1\n'] Note: For the first sample, we can add one bacterium in the box in the first day morning and at the third morning there will be 4 bacteria in the box. Now we put one more resulting 5 in the box. We added 2 bacteria in the process so the answer is 2. For the second sample, we can put one in the first morning and in the 4-th morning there will be 8 in the box. So the answer is 1.
```python x = int(input()) i = 1 while x//2 > 0: if x % 2 == 1: i += 1 x = x // 2 print(i) ```
3
230
B
T-primes
PROGRAMMING
1,300
[ "binary search", "implementation", "math", "number theory" ]
null
null
We know that prime numbers are positive integers that have exactly two distinct positive divisors. Similarly, we'll call a positive integer *t* Т-prime, if *t* has exactly three distinct positive divisors. You are given an array of *n* positive integers. For each of them determine whether it is Т-prime or not.
The first line contains a single positive integer, *n* (1<=≤<=*n*<=≤<=105), showing how many numbers are in the array. The next line contains *n* space-separated integers *x**i* (1<=≤<=*x**i*<=≤<=1012). Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is advised to use the cin, cout streams or the %I64d specifier.
Print *n* lines: the *i*-th line should contain "YES" (without the quotes), if number *x**i* is Т-prime, and "NO" (without the quotes), if it isn't.
[ "3\n4 5 6\n" ]
[ "YES\nNO\nNO\n" ]
The given test has three numbers. The first number 4 has exactly three divisors — 1, 2 and 4, thus the answer for this number is "YES". The second number 5 has two divisors (1 and 5), and the third number 6 has four divisors (1, 2, 3, 6), hence the answer for them is "NO".
500
[ { "input": "3\n4 5 6", "output": "YES\nNO\nNO" }, { "input": "2\n48 49", "output": "NO\nYES" }, { "input": "10\n10 9 8 7 6 5 4 3 2 1", "output": "NO\nYES\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nNO" }, { "input": "1\n36", "output": "NO" }, { "input": "1\n999966000289", "output": "YES" }, { "input": "1\n999993399999", "output": "NO" }, { "input": "9\n111 121 131 111 121 131 111 121 131", "output": "NO\nYES\nNO\nNO\nYES\nNO\nNO\nYES\nNO" }, { "input": "1\n1", "output": "NO" }, { "input": "1\n10", "output": "NO" }, { "input": "1\n976197352729", "output": "NO" }, { "input": "1\n1000000000000", "output": "NO" }, { "input": "1\n9", "output": "YES" }, { "input": "6\n549755813888 847288609443 762939453125 678223072849 285311670611 137858491849", "output": "NO\nNO\nNO\nNO\nNO\nNO" }, { "input": "3\n223092870 6469693230 200560490130", "output": "NO\nNO\nNO" }, { "input": "2\n81 25", "output": "NO\nYES" }, { "input": "1\n16", "output": "NO" }, { "input": "22\n1 2 3 4 5 6 7 8 9 10 12752041 64 121 144 27550356289 124 24657 23756 135153365 25235235235 42351351 81", "output": "NO\nNO\nNO\nYES\nNO\nNO\nNO\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nNO\nNO" }, { "input": "1\n225", "output": "NO" }, { "input": "1\n1521", "output": "NO" }, { "input": "1\n81", "output": "NO" } ]
1,697,542,610
2,147,483,647
Python 3
OK
TESTS
68
1,560
22,323,200
import math n1 = 1000005 pa = [1]*(n1+1) pa[0]= pa[1]= 0 for i in range(2, int(math.sqrt(n1)+1)): if pa[i] == 1: j =i while i*j <= n1: pa[i*j] = 0 j+=1 n = int(input()) arr = list(map(int, input().split())) for i in range(n): s = int(math.sqrt(arr[i])) if s*s == arr[i] and pa[s] ==1: print("YES") else: print("NO")
Title: T-primes Time Limit: None seconds Memory Limit: None megabytes Problem Description: We know that prime numbers are positive integers that have exactly two distinct positive divisors. Similarly, we'll call a positive integer *t* Т-prime, if *t* has exactly three distinct positive divisors. You are given an array of *n* positive integers. For each of them determine whether it is Т-prime or not. Input Specification: The first line contains a single positive integer, *n* (1<=≤<=*n*<=≤<=105), showing how many numbers are in the array. The next line contains *n* space-separated integers *x**i* (1<=≤<=*x**i*<=≤<=1012). Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is advised to use the cin, cout streams or the %I64d specifier. Output Specification: Print *n* lines: the *i*-th line should contain "YES" (without the quotes), if number *x**i* is Т-prime, and "NO" (without the quotes), if it isn't. Demo Input: ['3\n4 5 6\n'] Demo Output: ['YES\nNO\nNO\n'] Note: The given test has three numbers. The first number 4 has exactly three divisors — 1, 2 and 4, thus the answer for this number is "YES". The second number 5 has two divisors (1 and 5), and the third number 6 has four divisors (1, 2, 3, 6), hence the answer for them is "NO".
```python import math n1 = 1000005 pa = [1]*(n1+1) pa[0]= pa[1]= 0 for i in range(2, int(math.sqrt(n1)+1)): if pa[i] == 1: j =i while i*j <= n1: pa[i*j] = 0 j+=1 n = int(input()) arr = list(map(int, input().split())) for i in range(n): s = int(math.sqrt(arr[i])) if s*s == arr[i] and pa[s] ==1: print("YES") else: print("NO") ```
3
281
A
Word Capitalization
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word. Note, that during capitalization all the letters except the first one remains unchanged.
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
Output the given word after capitalization.
[ "ApPLe\n", "konjac\n" ]
[ "ApPLe\n", "Konjac\n" ]
none
500
[ { "input": "ApPLe", "output": "ApPLe" }, { "input": "konjac", "output": "Konjac" }, { "input": "a", "output": "A" }, { "input": "A", "output": "A" }, { "input": "z", "output": "Z" }, { "input": "ABACABA", "output": "ABACABA" }, { "input": "xYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX", "output": "XYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX" }, { "input": "rZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO", "output": "RZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO" }, { "input": "hDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD", "output": "HDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD" }, { "input": "qUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW", "output": "QUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW" }, { "input": "kHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL", "output": "KHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL" }, { "input": "aHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC", "output": "AHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC" }, { "input": "sLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN", "output": "SLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN" }, { "input": "iRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE", "output": "IRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE" }, { "input": "cRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP", "output": "CRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP" }, { "input": "wVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG", "output": "WVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG" }, { "input": "kEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV", "output": "KEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV" }, { "input": "eIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI", "output": "EIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI" }, { "input": "uOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX", "output": "UOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX" }, { "input": "lZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ", "output": "LZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ" }, { "input": "P", "output": "P" }, { "input": "Xyzzy", "output": "Xyzzy" }, { "input": "Zzz", "output": "Zzz" }, { "input": "Zp", "output": "Zp" } ]
1,696,104,366
2,147,483,647
PyPy 3-64
OK
TESTS
25
92
0
word = input() if word[0] >= 'a': print(chr(ord(word[0]) - 32) + word[1:]) else: print(word)
Title: Word Capitalization Time Limit: None seconds Memory Limit: None megabytes Problem Description: Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word. Note, that during capitalization all the letters except the first one remains unchanged. Input Specification: A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103. Output Specification: Output the given word after capitalization. Demo Input: ['ApPLe\n', 'konjac\n'] Demo Output: ['ApPLe\n', 'Konjac\n'] Note: none
```python word = input() if word[0] >= 'a': print(chr(ord(word[0]) - 32) + word[1:]) else: print(word) ```
3
888
B
Buggy Robot
PROGRAMMING
1,000
[ "greedy" ]
null
null
Ivan has a robot which is situated on an infinite grid. Initially the robot is standing in the starting cell (0,<=0). The robot can process commands. There are four types of commands it can perform: - U — move from the cell (*x*,<=*y*) to (*x*,<=*y*<=+<=1); - D — move from (*x*,<=*y*) to (*x*,<=*y*<=-<=1); - L — move from (*x*,<=*y*) to (*x*<=-<=1,<=*y*); - R — move from (*x*,<=*y*) to (*x*<=+<=1,<=*y*). Ivan entered a sequence of *n* commands, and the robot processed it. After this sequence the robot ended up in the starting cell (0,<=0), but Ivan doubts that the sequence is such that after performing it correctly the robot ends up in the same cell. He thinks that some commands were ignored by robot. To acknowledge whether the robot is severely bugged, he needs to calculate the maximum possible number of commands that were performed correctly. Help Ivan to do the calculations!
The first line contains one number *n* — the length of sequence of commands entered by Ivan (1<=≤<=*n*<=≤<=100). The second line contains the sequence itself — a string consisting of *n* characters. Each character can be U, D, L or R.
Print the maximum possible number of commands from the sequence the robot could perform to end up in the starting cell.
[ "4\nLDUR\n", "5\nRRRUU\n", "6\nLLRRRR\n" ]
[ "4\n", "0\n", "4\n" ]
none
0
[ { "input": "4\nLDUR", "output": "4" }, { "input": "5\nRRRUU", "output": "0" }, { "input": "6\nLLRRRR", "output": "4" }, { "input": "88\nLLUUULRDRRURDDLURRLRDRLLRULRUUDDLLLLRRDDURDURRLDURRLDRRRUULDDLRRRDDRRLUULLURDURUDDDDDLDR", "output": "76" }, { "input": "89\nLDLLLDRDUDURRRRRUDULDDDLLUDLRLRLRLDLDUULRDUDLRRDLUDLURRDDRRDLDUDUUURUUUDRLUDUDLURDLDLLDDU", "output": "80" }, { "input": "90\nRRRDUULLLRDUUDDRLDLRLUDURDRDUUURUURDDRRRURLDDDUUDRLLLULURDRDRURLDRRRRUULDULDDLLLRRLRDLLLLR", "output": "84" }, { "input": "91\nRLDRLRRLLDLULULLURULLRRULUDUULLUDULDUULURUDRUDUURDULDUDDUUUDRRUUDLLRULRULURLDRDLDRURLLLRDDD", "output": "76" }, { "input": "92\nRLRDDLULRLLUURRDDDLDDDLDDUURRRULLRDULDULLLUUULDUDLRLRRDRDRDDULDRLUDRDULDRURUDUULLRDRRLLDRLRR", "output": "86" }, { "input": "93\nRLLURLULRURDDLUURLUDDRDLUURLRDLRRRDUULLRDRRLRLDURRDLLRDDLLLDDDLDRRURLLDRUDULDDRRULRRULRLDRDLR", "output": "84" }, { "input": "94\nRDULDDDLULRDRUDRUUDUUDRRRULDRRUDURUULRDUUDLULLLUDURRDRDLUDRULRRRULUURUDDDDDUDLLRDLDRLLRUUURLUL", "output": "86" }, { "input": "95\nRDLUUULLUURDDRLDLLRRRULRLRDULULRULRUDURLULDDDRLURLDRULDUDUUULLRDDURUULULLDDLDRDRLLLURLRDLLDDDDU", "output": "86" }, { "input": "96\nRDDRLRLLDDULRLRURUDLRLDUDRURLLUUDLLURDLRRUURDRRUDRURLLDLLRDURDURLRLUDURULLLRDUURULUUULRRURRDLURL", "output": "84" }, { "input": "97\nRURDDLRLLRULUDURDLRLLUUDURRLLUDLLLDUDRUULDRUUURURULRDLDRRLLUUUDLLLDDLLLLRLLDUDRRDLLUDLRURUDULRLUR", "output": "82" }, { "input": "98\nRUDURLULLDDLLRDLLRDDLLLLRLDDDDRRRDDRRURLDRLLRUUUDLUUUDDDUDRUURLURUUDUUDRULRRULLRRLRULLULDLUURLULRD", "output": "92" }, { "input": "99\nRRULLDULRRDRULLDUDRUDDDRLLUUDRDDUDURLDDRUUDRRUUURRRURDDLDUURDLRLURRDDLUDDLUDURDRUDDURLURURLRUDRURLD", "output": "86" }, { "input": "100\nUDRLRRLLRRLRRRDDLLDDDLULLDDLURUURUULUDDDRDDLLRDLLUURLRDRLRRLRLLLULDUDDUURRLRDULDRDURRRRRRULDRRDLDRRL", "output": "88" }, { "input": "1\nU", "output": "0" }, { "input": "5\nUUULD", "output": "2" }, { "input": "1\nD", "output": "0" }, { "input": "5\nURLUL", "output": "2" }, { "input": "5\nDDDRU", "output": "2" }, { "input": "2\nLR", "output": "2" }, { "input": "8\nDDRDLDUR", "output": "4" }, { "input": "6\nLLLLUD", "output": "2" }, { "input": "13\nRRRLLLLLLLLLL", "output": "6" } ]
1,604,055,830
2,147,483,647
Python 3
OK
TESTS
25
108
0
n = int(input()) a = list(input()) x = y = 0 count = {} for c in a: if c not in count: count[c] = 0 count[c] += 1 print(2*(min(count.get('L', 0), count.get('R', 0)) + min(count.get('U', 0), count.get('D', 0))))
Title: Buggy Robot Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ivan has a robot which is situated on an infinite grid. Initially the robot is standing in the starting cell (0,<=0). The robot can process commands. There are four types of commands it can perform: - U — move from the cell (*x*,<=*y*) to (*x*,<=*y*<=+<=1); - D — move from (*x*,<=*y*) to (*x*,<=*y*<=-<=1); - L — move from (*x*,<=*y*) to (*x*<=-<=1,<=*y*); - R — move from (*x*,<=*y*) to (*x*<=+<=1,<=*y*). Ivan entered a sequence of *n* commands, and the robot processed it. After this sequence the robot ended up in the starting cell (0,<=0), but Ivan doubts that the sequence is such that after performing it correctly the robot ends up in the same cell. He thinks that some commands were ignored by robot. To acknowledge whether the robot is severely bugged, he needs to calculate the maximum possible number of commands that were performed correctly. Help Ivan to do the calculations! Input Specification: The first line contains one number *n* — the length of sequence of commands entered by Ivan (1<=≤<=*n*<=≤<=100). The second line contains the sequence itself — a string consisting of *n* characters. Each character can be U, D, L or R. Output Specification: Print the maximum possible number of commands from the sequence the robot could perform to end up in the starting cell. Demo Input: ['4\nLDUR\n', '5\nRRRUU\n', '6\nLLRRRR\n'] Demo Output: ['4\n', '0\n', '4\n'] Note: none
```python n = int(input()) a = list(input()) x = y = 0 count = {} for c in a: if c not in count: count[c] = 0 count[c] += 1 print(2*(min(count.get('L', 0), count.get('R', 0)) + min(count.get('U', 0), count.get('D', 0)))) ```
3
176
B
Word Cut
PROGRAMMING
1,700
[ "dp" ]
null
null
Let's consider one interesting word game. In this game you should transform one word into another through special operations. Let's say we have word *w*, let's split this word into two non-empty parts *x* and *y* so, that *w*<==<=*xy*. A split operation is transforming word *w*<==<=*xy* into word *u*<==<=*yx*. For example, a split operation can transform word "wordcut" into word "cutword". You are given two words *start* and *end*. Count in how many ways we can transform word *start* into word *end*, if we apply exactly *k* split operations consecutively to word *start*. Two ways are considered different if the sequences of applied operations differ. Two operation sequences are different if exists such number *i* (1<=≤<=*i*<=≤<=*k*), that in the *i*-th operation of the first sequence the word splits into parts *x* and *y*, in the *i*-th operation of the second sequence the word splits into parts *a* and *b*, and additionally *x*<=≠<=*a* holds.
The first line contains a non-empty word *start*, the second line contains a non-empty word *end*. The words consist of lowercase Latin letters. The number of letters in word *start* equals the number of letters in word *end* and is at least 2 and doesn't exceed 1000 letters. The third line contains integer *k* (0<=≤<=*k*<=≤<=105) — the required number of operations.
Print a single number — the answer to the problem. As this number can be rather large, print it modulo 1000000007 (109<=+<=7).
[ "ab\nab\n2\n", "ababab\nababab\n1\n", "ab\nba\n2\n" ]
[ "1\n", "2\n", "0\n" ]
The sought way in the first sample is: ab  →  a|b  →  ba  →  b|a  →  ab In the second sample the two sought ways are: - ababab  →  abab|ab  →  ababab - ababab  →  ab|abab  →  ababab
1,000
[ { "input": "ab\nab\n2", "output": "1" }, { "input": "ababab\nababab\n1", "output": "2" }, { "input": "ab\nba\n2", "output": "0" }, { "input": "aaa\naaa\n0", "output": "1" }, { "input": "hi\nhi\n1", "output": "0" }, { "input": "abcd\ncbad\n5", "output": "0" }, { "input": "ab\nba\n10", "output": "0" }, { "input": "voodoo\ndoovoo\n100000", "output": "792428974" }, { "input": "ababab\nbababa\n100000", "output": "377286908" }, { "input": "abcdefgh\ncdefghab\n666", "output": "83913683" }, { "input": "aaaabaaaaaaaaaaabaaaaaaa\naaaaaaaaaabaaaaaaaaabaaa\n7477", "output": "0" }, { "input": "ssgqcodnqgfbhqsgineioafkkhcmmmihbiefialidgkffrhaiekebpieqgpplmsgmghphjsfgpscrbcgrssbccqroffnfgkfohljdarbpqmkolldcjcfhpodeqmgbdddlgoolesecdqsochdfgjsmorbnmiinjlpda\nljdarbpqmkolldcjcfhpodeqmgbdddlgoolesecdqsochdfgjsmorbnmiinjlpdassgqcodnqgfbhqsgineioafkkhcmmmihbiefialidgkffrhaiekebpieqgpplmsgmghphjsfgpscrbcgrssbccqroffnfgkfoh\n50897", "output": "222669762" }, { "input": "jfemedqrsqaopiekdosgjnhbshanggdqqpkhepjfrkgkshepbmkdnidmpgfojjjbeddkelccoqapnpkqbimlbgagllioqbdgnsejqcbicjbbijjlrjmkkarjdoganmfsmfohlspbsoldfspdacasgsrcndlhg\nhepbmkdnidmpgfojjjbeddkelccoqapnpkqbimlbgagllioqbdgnsejqcbicjbbijjlrjmkkarjdoganmfsmfohlspbsoldfspdacasgsrcndlhgjfemedqrsqaopiekdosgjnhbshanggdqqpkhepjfrkgks\n6178", "output": "568786732" }, { "input": "aaeddddadbcacbdccaeeeddecadbecbbcebdcdbcddcadcadccecccecdbabd\nadbecbbcebdcdbcddcadcadccecccecdbabdaaeddddadbcacbdccaeeeddec\n55400", "output": "471327413" }, { "input": "chajciihijjbjcgaedebdcjaaeaiffiggfdfbdjhikhbiijhbjciebgkadbbekijadafhjhgiidfjkjbgcdfdgjjfficbagghkdgdhdedihifcfkedcefcdfjaagiehccjbjhihcbdakbjfjdgakkfagddhekccbdjhejhakfccgghkdc\ndafhjhgiidfjkjbgcdfdgjjfficbagghkdgdhdedihifcfkedcefcdfjaagiehccjbjhihcbdakbjfjdgakkfagddhekccbdjhejhakfccgghkdcchajciihijjbjcgaedebdcjaaeaiffiggfdfbdjhikhbiijhbjciebgkadbbekija\n67572", "output": "18146811" }, { "input": "dkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjij\ndddkikjjidkkidijjjjkkjjikjdikiidijjikikjijjiijdikkjjjiddjjijkkkjkiijijkijdjjikikdjjjijdddjkjjdijjjjjjjddkjjkjjjdjjdkijjkijkkjkkkiiijdjijkkdjdjjjkkjkdddjidjjijdddkijididjdddidijjjjjdkidijjkkjiijkjjjjjjdjkkdddkjj\n31328", "output": "0" }, { "input": "lnxjsxjjfbrhijshlptgogxstvaybbueilocmaqwhlauulubpwtjtsdktgrowgbkhdotemhstqtxnpspmxjxrqymonnpcvrendrfxbwqxeedyamwvyyytxtmorkovoeklkabyexrfseimlaqlibaoaaeae\nalxckgrkneuqrqstpxormswxsyhaaoebqhfspyqjbxgytrpdoybxmmenllxxrrjtxtvhaoidjmaekiflxykmpnwageytemoewalwihbunbnvomqbututijjvdsbelrxestajokwysctfptalvegdahlboo\n44031", "output": "0" }, { "input": "cfacacbfaeadfdbedfdccdccdddaaa\ncbfaeadfdbedfdccdccdddaaacfaca\n15215", "output": "668863397" }, { "input": "xxx\nyyy\n0", "output": "0" }, { "input": "abc\ncba\n0", "output": "0" }, { "input": "ab\nba\n0", "output": "0" }, { "input": "abc\nabc\n1", "output": "0" }, { "input": "ab\nba\n9", "output": "1" }, { "input": "ab\nba\n10", "output": "0" }, { "input": "aa\naa\n1", "output": "1" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\n100000", "output": "486606280" }, { "input": "aaaba\naaaad\n0", "output": "0" } ]
1,687,496,487
2,147,483,647
PyPy 3-64
OK
TESTS
90
810
2,662,400
import sys input = lambda:sys.stdin.readline().strip() M = lambda:map(int,input().split()) from collections import deque inf = float('inf') mod = 10**9+7 a = input() a += a b = input() n = len(b) k = int(input()) bo = [0]*n for i in range(n): if a[i:i+n] == b: bo[i] = 1 res = [0]*n res[0] = 1 for i in range(k): sm = sum(res)%mod for j in range(n): res[j] = (sm-res[j])%mod ans = 0 for i in range(n): ans += bo[i]*res[i] ans %= mod print(ans)
Title: Word Cut Time Limit: None seconds Memory Limit: None megabytes Problem Description: Let's consider one interesting word game. In this game you should transform one word into another through special operations. Let's say we have word *w*, let's split this word into two non-empty parts *x* and *y* so, that *w*<==<=*xy*. A split operation is transforming word *w*<==<=*xy* into word *u*<==<=*yx*. For example, a split operation can transform word "wordcut" into word "cutword". You are given two words *start* and *end*. Count in how many ways we can transform word *start* into word *end*, if we apply exactly *k* split operations consecutively to word *start*. Two ways are considered different if the sequences of applied operations differ. Two operation sequences are different if exists such number *i* (1<=≤<=*i*<=≤<=*k*), that in the *i*-th operation of the first sequence the word splits into parts *x* and *y*, in the *i*-th operation of the second sequence the word splits into parts *a* and *b*, and additionally *x*<=≠<=*a* holds. Input Specification: The first line contains a non-empty word *start*, the second line contains a non-empty word *end*. The words consist of lowercase Latin letters. The number of letters in word *start* equals the number of letters in word *end* and is at least 2 and doesn't exceed 1000 letters. The third line contains integer *k* (0<=≤<=*k*<=≤<=105) — the required number of operations. Output Specification: Print a single number — the answer to the problem. As this number can be rather large, print it modulo 1000000007 (109<=+<=7). Demo Input: ['ab\nab\n2\n', 'ababab\nababab\n1\n', 'ab\nba\n2\n'] Demo Output: ['1\n', '2\n', '0\n'] Note: The sought way in the first sample is: ab  →  a|b  →  ba  →  b|a  →  ab In the second sample the two sought ways are: - ababab  →  abab|ab  →  ababab - ababab  →  ab|abab  →  ababab
```python import sys input = lambda:sys.stdin.readline().strip() M = lambda:map(int,input().split()) from collections import deque inf = float('inf') mod = 10**9+7 a = input() a += a b = input() n = len(b) k = int(input()) bo = [0]*n for i in range(n): if a[i:i+n] == b: bo[i] = 1 res = [0]*n res[0] = 1 for i in range(k): sm = sum(res)%mod for j in range(n): res[j] = (sm-res[j])%mod ans = 0 for i in range(n): ans += bo[i]*res[i] ans %= mod print(ans) ```
3
734
A
Anton and Danik
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
Anton likes to play chess, and so does his friend Danik. Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie. Now Anton wonders, who won more games, he or Danik? Help him determine this.
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played. The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game.
If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output. If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output. If Anton and Danik won the same number of games, print "Friendship" (without quotes).
[ "6\nADAAAA\n", "7\nDDDAADA\n", "6\nDADADA\n" ]
[ "Anton\n", "Danik\n", "Friendship\n" ]
In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton". In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik". In the third sample, both Anton and Danik won 3 games and the answer is "Friendship".
500
[ { "input": "6\nADAAAA", "output": "Anton" }, { "input": "7\nDDDAADA", "output": "Danik" }, { "input": "6\nDADADA", "output": "Friendship" }, { "input": "10\nDDDDADDADD", "output": "Danik" }, { "input": "40\nAAAAAAAAADDAAAAAAAAAAADADDAAAAAAAAAAADAA", "output": "Anton" }, { "input": "200\nDDDDDDDADDDDDDAADADAADAAADAADADAAADDDADDDDDDADDDAADDDAADADDDDDADDDAAAADAAADDDDDAAADAADDDAAAADDADADDDAADDAADAAADAADAAAADDAADDADAAAADADDDAAAAAADDAADAADAADADDDAAADAAAADADDADAAAAAADADADDDADDDAADDADDDAAAAD", "output": "Friendship" }, { "input": "1\nA", "output": "Anton" }, { "input": "1\nD", "output": "Danik" }, { "input": "2\nDA", "output": "Friendship" }, { "input": "4\nDADA", "output": "Friendship" }, { "input": "4\nDAAD", "output": "Friendship" }, { "input": "3\nADD", "output": "Danik" }, { "input": "3\nDAD", "output": "Danik" }, { "input": "2\nDA", "output": "Friendship" }, { "input": "379\nAADAAAAAADDAAAAAADAADADADDAAAAADADDAADAAAADDDADAAAAAAADAADAAAAAAADAAAAAAAAADAAAAAAADAAAAAAAAAAADDDADAAAAAAAADAADADAAAADAAAAAAAAAAAAAAAAADAAAADDDAADAAAAAAADAAADAAADAADDDADDAAADAAAAAADDDADDDAAADAAAADAAAAAAAAADAAADAAAAAAAAADAAAAAAAAAAAAAAAAAADADAAAAAAAAAAADAAAAADAAAADAAAAAAAAAAAAADADAADAAAAAAAADAADAAAAAAAADAAAAAAAADDDAAAAAADAAADAAAAAADAADAAAAAADAAAADADAADAAAAAADAAAADAADDAADAADAAA", "output": "Anton" } ]
1,699,720,612
2,147,483,647
PyPy 3
OK
TESTS
25
93
512,000
n = int(input()) str = input().strip() a = str.count("A") d = str.count("D") if (a>d): print("Anton") elif(d>a): print("Danik") else: print("Friendship")
Title: Anton and Danik Time Limit: None seconds Memory Limit: None megabytes Problem Description: Anton likes to play chess, and so does his friend Danik. Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie. Now Anton wonders, who won more games, he or Danik? Help him determine this. Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played. The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game. Output Specification: If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output. If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output. If Anton and Danik won the same number of games, print "Friendship" (without quotes). Demo Input: ['6\nADAAAA\n', '7\nDDDAADA\n', '6\nDADADA\n'] Demo Output: ['Anton\n', 'Danik\n', 'Friendship\n'] Note: In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton". In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik". In the third sample, both Anton and Danik won 3 games and the answer is "Friendship".
```python n = int(input()) str = input().strip() a = str.count("A") d = str.count("D") if (a>d): print("Anton") elif(d>a): print("Danik") else: print("Friendship") ```
3
16
A
Flag
PROGRAMMING
800
[ "implementation" ]
A. Flag
2
64
According to a new ISO standard, a flag of every country should have a chequered field *n*<=×<=*m*, each square should be of one of 10 colours, and the flag should be «striped»: each horizontal row of the flag should contain squares of the same colour, and the colours of adjacent horizontal rows should be different. Berland's government asked you to find out whether their flag meets the new ISO standard.
The first line of the input contains numbers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), *n* — the amount of rows, *m* — the amount of columns on the flag of Berland. Then there follows the description of the flag: each of the following *n* lines contain *m* characters. Each character is a digit between 0 and 9, and stands for the colour of the corresponding square.
Output YES, if the flag meets the new ISO standard, and NO otherwise.
[ "3 3\n000\n111\n222\n", "3 3\n000\n000\n111\n", "3 3\n000\n111\n002\n" ]
[ "YES\n", "NO\n", "NO\n" ]
none
0
[ { "input": "3 3\n000\n111\n222", "output": "YES" }, { "input": "3 3\n000\n000\n111", "output": "NO" }, { "input": "3 3\n000\n111\n002", "output": "NO" }, { "input": "10 10\n2222222222\n5555555555\n0000000000\n4444444444\n1111111111\n3333333393\n3333333333\n5555555555\n0000000000\n8888888888", "output": "NO" }, { "input": "10 13\n4442444444444\n8888888888888\n6666666666666\n0000000000000\n3333333333333\n4444444444444\n7777777777777\n8388888888888\n1111111111111\n5555555555555", "output": "NO" }, { "input": "10 8\n33333333\n44444444\n11111115\n81888888\n44444444\n11111111\n66666666\n33330333\n33333333\n33333333", "output": "NO" }, { "input": "5 5\n88888\n44444\n66666\n55555\n88888", "output": "YES" }, { "input": "20 19\n1111111111111111111\n5555555555555555555\n0000000000000000000\n3333333333333333333\n1111111111111111111\n2222222222222222222\n4444444444444444444\n5555555555555555555\n0000000000000000000\n4444444444444444444\n0000000000000000000\n5555555555555555555\n7777777777777777777\n9999999999999999999\n2222222222222222222\n4444444444444444444\n1111111111111111111\n6666666666666666666\n7777777777777777777\n2222222222222222222", "output": "YES" }, { "input": "1 100\n8888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888", "output": "YES" }, { "input": "100 1\n5\n7\n9\n4\n7\n2\n5\n1\n6\n7\n2\n7\n6\n8\n7\n4\n0\n2\n9\n8\n9\n1\n6\n4\n3\n4\n7\n1\n9\n3\n0\n8\n3\n1\n7\n5\n3\n9\n5\n1\n3\n5\n8\n1\n9\n3\n9\n0\n6\n0\n7\n6\n5\n2\n8\n3\n7\n6\n5\n1\n8\n3\n6\n9\n6\n0\n5\n8\n5\n2\n9\n1\n0\n1\n8\n3\n2\n1\n0\n3\n9\n0\n5\n1\n0\n4\n9\n3\n0\n4\n8\n4\n8\n6\n3\n0\n4\n6\n8\n4", "output": "YES" }, { "input": "1 1\n2", "output": "YES" }, { "input": "1 100\n1111111111111111111111111111111111111111111111111111111111111111111111111111181111111111111111111111", "output": "NO" }, { "input": "100 1\n3\n6\n4\n3\n0\n2\n8\n7\n3\n2\n1\n7\n1\n3\n2\n3\n6\n9\n0\n8\n5\n9\n7\n9\n2\n1\n4\n5\n1\n9\n2\n5\n1\n4\n6\n4\n9\n1\n0\n2\n1\n4\n7\n1\n4\n8\n0\n9\n2\n1\n6\n2\n8\n6\n9\n5\n8\n6\n4\n5\n9\n2\n7\n4\n1\n5\n8\n0\n9\n5\n4\n6\n5\n0\n6\n3\n6\n9\n7\n2\n0\n9\n7\n3\n2\n4\n9\n4\n7\n1\n2\n3\n1\n7\n9\n1\n9\n0\n4\n0", "output": "YES" } ]
1,643,724,781
2,147,483,647
Python 3
OK
TESTS
35
92
0
def solve(): n, m = map(int,input().split()) arr = [set(input()) for x in range(n)] curr = '#' for x in arr: if len(x) != 1 or x == curr: return 'NO' curr = x return 'YES' print(solve())
Title: Flag Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: According to a new ISO standard, a flag of every country should have a chequered field *n*<=×<=*m*, each square should be of one of 10 colours, and the flag should be «striped»: each horizontal row of the flag should contain squares of the same colour, and the colours of adjacent horizontal rows should be different. Berland's government asked you to find out whether their flag meets the new ISO standard. Input Specification: The first line of the input contains numbers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), *n* — the amount of rows, *m* — the amount of columns on the flag of Berland. Then there follows the description of the flag: each of the following *n* lines contain *m* characters. Each character is a digit between 0 and 9, and stands for the colour of the corresponding square. Output Specification: Output YES, if the flag meets the new ISO standard, and NO otherwise. Demo Input: ['3 3\n000\n111\n222\n', '3 3\n000\n000\n111\n', '3 3\n000\n111\n002\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none
```python def solve(): n, m = map(int,input().split()) arr = [set(input()) for x in range(n)] curr = '#' for x in arr: if len(x) != 1 or x == curr: return 'NO' curr = x return 'YES' print(solve()) ```
3.977
142
B
Help General
PROGRAMMING
1,800
[ "constructive algorithms", "greedy", "implementation" ]
null
null
Once upon a time in the Kingdom of Far Far Away lived Sir Lancelot, the chief Royal General. He was very proud of his men and he liked to invite the King to come and watch drill exercises which demonstrated the fighting techniques and tactics of the squad he was in charge of. But time went by and one day Sir Lancelot had a major argument with the Fairy Godmother (there were rumors that the argument occurred after the general spoke badly of the Godmother's flying techniques. That seemed to hurt the Fairy Godmother very deeply). As the result of the argument, the Godmother put a rather strange curse upon the general. It sounded all complicated and quite harmless: "If the squared distance between some two soldiers equals to 5, then those soldiers will conflict with each other!" The drill exercises are held on a rectangular *n*<=×<=*m* field, split into *nm* square 1<=×<=1 segments for each soldier. Thus, the square of the distance between the soldiers that stand on squares (*x*1,<=*y*1) and (*x*2,<=*y*2) equals exactly (*x*1<=-<=*x*2)2<=+<=(*y*1<=-<=*y*2)2. Now not all *nm* squad soldiers can participate in the drill exercises as it was before the Fairy Godmother's curse. Unless, of course, the general wants the soldiers to fight with each other or even worse... For example, if he puts a soldier in the square (2,<=2), then he cannot put soldiers in the squares (1,<=4), (3,<=4), (4,<=1) and (4,<=3) — each of them will conflict with the soldier in the square (2,<=2). Your task is to help the general. You are given the size of the drill exercise field. You are asked to calculate the maximum number of soldiers that can be simultaneously positioned on this field, so that no two soldiers fall under the Fairy Godmother's curse.
The single line contains space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) that represent the size of the drill exercise field.
Print the desired maximum number of warriors.
[ "2 4\n", "3 4\n" ]
[ "4", "6" ]
In the first sample test Sir Lancelot can place his 4 soldiers on the 2 × 4 court as follows (the soldiers' locations are marked with gray circles on the scheme): In the second sample test he can place 6 soldiers on the 3 × 4 site in the following manner:
1,000
[ { "input": "2 4", "output": "4" }, { "input": "3 4", "output": "6" }, { "input": "4 4", "output": "8" }, { "input": "4 3", "output": "6" }, { "input": "4 2", "output": "4" }, { "input": "1 1", "output": "1" }, { "input": "3 5", "output": "8" }, { "input": "5 3", "output": "8" }, { "input": "506 44", "output": "11132" }, { "input": "555 349", "output": "96848" }, { "input": "757 210", "output": "79485" }, { "input": "419 503", "output": "105379" }, { "input": "515 19", "output": "4893" }, { "input": "204 718", "output": "73236" }, { "input": "862 330", "output": "142230" }, { "input": "494 982", "output": "242554" }, { "input": "967 4", "output": "1934" }, { "input": "449 838", "output": "188131" }, { "input": "635 458", "output": "145415" }, { "input": "156 911", "output": "71058" }, { "input": "409 295", "output": "60328" }, { "input": "755 458", "output": "172895" }, { "input": "936 759", "output": "355212" }, { "input": "771 460", "output": "177330" }, { "input": "563 802", "output": "225763" }, { "input": "953 874", "output": "416461" }, { "input": "354 720", "output": "127440" }, { "input": "915 72", "output": "32940" }, { "input": "860 762", "output": "327660" }, { "input": "396 387", "output": "76626" }, { "input": "675 710", "output": "239625" }, { "input": "728 174", "output": "63336" }, { "input": "883 312", "output": "137748" }, { "input": "701 600", "output": "210300" }, { "input": "824 729", "output": "300348" }, { "input": "886 80", "output": "35440" }, { "input": "762 742", "output": "282702" }, { "input": "781 586", "output": "228833" }, { "input": "44 343", "output": "7546" }, { "input": "847 237", "output": "100370" }, { "input": "169 291", "output": "24590" }, { "input": "961 61", "output": "29311" }, { "input": "695 305", "output": "105988" }, { "input": "854 503", "output": "214781" }, { "input": "1 744", "output": "744" }, { "input": "1 383", "output": "383" }, { "input": "1 166", "output": "166" }, { "input": "557 1", "output": "557" }, { "input": "650 1", "output": "650" }, { "input": "1 995", "output": "995" }, { "input": "1 865", "output": "865" }, { "input": "1 393", "output": "393" }, { "input": "363 1", "output": "363" }, { "input": "1 506", "output": "506" }, { "input": "2 348", "output": "348" }, { "input": "583 2", "output": "584" }, { "input": "2 89", "output": "90" }, { "input": "576 2", "output": "576" }, { "input": "180 2", "output": "180" }, { "input": "719 2", "output": "720" }, { "input": "2 951", "output": "952" }, { "input": "313 2", "output": "314" }, { "input": "433 2", "output": "434" }, { "input": "804 2", "output": "804" }, { "input": "1 991", "output": "991" }, { "input": "1 992", "output": "992" }, { "input": "1 993", "output": "993" }, { "input": "994 1", "output": "994" }, { "input": "995 1", "output": "995" }, { "input": "996 1", "output": "996" }, { "input": "997 1", "output": "997" }, { "input": "1 998", "output": "998" }, { "input": "1 999", "output": "999" }, { "input": "1 1000", "output": "1000" }, { "input": "991 2", "output": "992" }, { "input": "2 992", "output": "992" }, { "input": "993 2", "output": "994" }, { "input": "994 2", "output": "996" }, { "input": "995 2", "output": "996" }, { "input": "2 996", "output": "996" }, { "input": "997 2", "output": "998" }, { "input": "2 998", "output": "1000" }, { "input": "2 999", "output": "1000" }, { "input": "2 1000", "output": "1000" }, { "input": "997 997", "output": "497005" }, { "input": "997 998", "output": "497503" }, { "input": "997 999", "output": "498002" }, { "input": "997 1000", "output": "498500" }, { "input": "998 997", "output": "497503" }, { "input": "998 998", "output": "498002" }, { "input": "998 999", "output": "498501" }, { "input": "998 1000", "output": "499000" }, { "input": "999 997", "output": "498002" }, { "input": "999 998", "output": "498501" }, { "input": "999 999", "output": "499001" }, { "input": "999 1000", "output": "499500" }, { "input": "1000 997", "output": "498500" }, { "input": "1000 998", "output": "499000" }, { "input": "1000 999", "output": "499500" }, { "input": "1000 1000", "output": "500000" }, { "input": "3 3", "output": "5" }, { "input": "1 2", "output": "2" }, { "input": "2 2", "output": "4" } ]
1,514,028,752
2,147,483,647
PyPy 3
OK
TESTS
103
218
23,142,400
n, m = sorted(map(int, input().split())) k = 4 * (m >> 2) print(m if n == 1 else k + 2 * min(2, m - k) if n == 2 else (m * n + 1 >> 1))
Title: Help General Time Limit: None seconds Memory Limit: None megabytes Problem Description: Once upon a time in the Kingdom of Far Far Away lived Sir Lancelot, the chief Royal General. He was very proud of his men and he liked to invite the King to come and watch drill exercises which demonstrated the fighting techniques and tactics of the squad he was in charge of. But time went by and one day Sir Lancelot had a major argument with the Fairy Godmother (there were rumors that the argument occurred after the general spoke badly of the Godmother's flying techniques. That seemed to hurt the Fairy Godmother very deeply). As the result of the argument, the Godmother put a rather strange curse upon the general. It sounded all complicated and quite harmless: "If the squared distance between some two soldiers equals to 5, then those soldiers will conflict with each other!" The drill exercises are held on a rectangular *n*<=×<=*m* field, split into *nm* square 1<=×<=1 segments for each soldier. Thus, the square of the distance between the soldiers that stand on squares (*x*1,<=*y*1) and (*x*2,<=*y*2) equals exactly (*x*1<=-<=*x*2)2<=+<=(*y*1<=-<=*y*2)2. Now not all *nm* squad soldiers can participate in the drill exercises as it was before the Fairy Godmother's curse. Unless, of course, the general wants the soldiers to fight with each other or even worse... For example, if he puts a soldier in the square (2,<=2), then he cannot put soldiers in the squares (1,<=4), (3,<=4), (4,<=1) and (4,<=3) — each of them will conflict with the soldier in the square (2,<=2). Your task is to help the general. You are given the size of the drill exercise field. You are asked to calculate the maximum number of soldiers that can be simultaneously positioned on this field, so that no two soldiers fall under the Fairy Godmother's curse. Input Specification: The single line contains space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) that represent the size of the drill exercise field. Output Specification: Print the desired maximum number of warriors. Demo Input: ['2 4\n', '3 4\n'] Demo Output: ['4', '6'] Note: In the first sample test Sir Lancelot can place his 4 soldiers on the 2 × 4 court as follows (the soldiers' locations are marked with gray circles on the scheme): In the second sample test he can place 6 soldiers on the 3 × 4 site in the following manner:
```python n, m = sorted(map(int, input().split())) k = 4 * (m >> 2) print(m if n == 1 else k + 2 * min(2, m - k) if n == 2 else (m * n + 1 >> 1)) ```
3
851
A
Arpa and a research in Mexican wave
PROGRAMMING
800
[ "implementation", "math" ]
null
null
Arpa is researching the Mexican wave. There are *n* spectators in the stadium, labeled from 1 to *n*. They start the Mexican wave at time 0. - At time 1, the first spectator stands. - At time 2, the second spectator stands. - ... - At time *k*, the *k*-th spectator stands. - At time *k*<=+<=1, the (*k*<=+<=1)-th spectator stands and the first spectator sits. - At time *k*<=+<=2, the (*k*<=+<=2)-th spectator stands and the second spectator sits. - ... - At time *n*, the *n*-th spectator stands and the (*n*<=-<=*k*)-th spectator sits. - At time *n*<=+<=1, the (*n*<=+<=1<=-<=*k*)-th spectator sits. - ... - At time *n*<=+<=*k*, the *n*-th spectator sits. Arpa wants to know how many spectators are standing at time *t*.
The first line contains three integers *n*, *k*, *t* (1<=≤<=*n*<=≤<=109, 1<=≤<=*k*<=≤<=*n*, 1<=≤<=*t*<=&lt;<=*n*<=+<=*k*).
Print single integer: how many spectators are standing at time *t*.
[ "10 5 3\n", "10 5 7\n", "10 5 12\n" ]
[ "3\n", "5\n", "3\n" ]
In the following a sitting spectator is represented as -, a standing spectator is represented as ^. - At *t* = 0  ---------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 0. - At *t* = 1  ^--------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 1. - At *t* = 2  ^^-------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 2. - At *t* = 3  ^^^------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 3. - At *t* = 4  ^^^^------ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 4. - At *t* = 5  ^^^^^----- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 6  -^^^^^---- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 7  --^^^^^--- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 8  ---^^^^^-- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 9  ----^^^^^- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 10 -----^^^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 11 ------^^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 4. - At *t* = 12 -------^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 3. - At *t* = 13 --------^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 2. - At *t* = 14 ---------^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 1. - At *t* = 15 ---------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 0.
500
[ { "input": "10 5 3", "output": "3" }, { "input": "10 5 7", "output": "5" }, { "input": "10 5 12", "output": "3" }, { "input": "840585600 770678331 788528791", "output": "770678331" }, { "input": "25462281 23343504 8024619", "output": "8024619" }, { "input": "723717988 205757169 291917494", "output": "205757169" }, { "input": "27462087 20831796 15492397", "output": "15492397" }, { "input": "966696824 346707476 1196846860", "output": "116557440" }, { "input": "290274403 41153108 327683325", "output": "3744186" }, { "input": "170963478 151220598 222269210", "output": "99914866" }, { "input": "14264008 309456 11132789", "output": "309456" }, { "input": "886869816 281212106 52891064", "output": "52891064" }, { "input": "330543750 243917820 205522400", "output": "205522400" }, { "input": "457658451 18625039 157624558", "output": "18625039" }, { "input": "385908940 143313325 509731380", "output": "19490885" }, { "input": "241227633 220621961 10025257", "output": "10025257" }, { "input": "474139818 268918981 388282504", "output": "268918981" }, { "input": "25963410 3071034 820199", "output": "820199" }, { "input": "656346757 647995766 75748423", "output": "75748423" }, { "input": "588568132 411878522 521753621", "output": "411878522" }, { "input": "735788762 355228487 139602545", "output": "139602545" }, { "input": "860798593 463398487 506871376", "output": "463398487" }, { "input": "362624055 110824996 194551217", "output": "110824996" }, { "input": "211691721 195866131 313244576", "output": "94313276" }, { "input": "45661815 26072719 9643822", "output": "9643822" }, { "input": "757183104 590795077 709609355", "output": "590795077" }, { "input": "418386749 1915035 197248338", "output": "1915035" }, { "input": "763782282 297277890 246562421", "output": "246562421" }, { "input": "893323188 617630677 607049638", "output": "607049638" }, { "input": "506708261 356545583 296093684", "output": "296093684" }, { "input": "984295813 427551190 84113823", "output": "84113823" }, { "input": "774984967 61373612 96603505", "output": "61373612" }, { "input": "774578969 342441237 91492393", "output": "91492393" }, { "input": "76495801 8780305 56447339", "output": "8780305" }, { "input": "48538385 582843 16805978", "output": "582843" }, { "input": "325794610 238970909 553089099", "output": "11676420" }, { "input": "834925315 316928679 711068031", "output": "316928679" }, { "input": "932182199 454838315 267066713", "output": "267066713" }, { "input": "627793782 552043394 67061810", "output": "67061810" }, { "input": "24317170 17881607 218412", "output": "218412" }, { "input": "1000000000 1000 1", "output": "1" }, { "input": "1000000000 1000 2", "output": "2" }, { "input": "1000000000 1 1000", "output": "1" }, { "input": "100 100 100", "output": "100" }, { "input": "100 100 99", "output": "99" }, { "input": "100 100 101", "output": "99" }, { "input": "100 100 199", "output": "1" }, { "input": "1000000000 1000000000 1999999999", "output": "1" }, { "input": "10 5 5", "output": "5" }, { "input": "5 3 5", "output": "3" }, { "input": "10 3 3", "output": "3" }, { "input": "10 5 6", "output": "5" }, { "input": "3 2 4", "output": "1" }, { "input": "10 5 14", "output": "1" }, { "input": "6 1 4", "output": "1" }, { "input": "10 10 19", "output": "1" }, { "input": "10 4 11", "output": "3" }, { "input": "2 2 3", "output": "1" }, { "input": "10 5 11", "output": "4" }, { "input": "600 200 700", "output": "100" }, { "input": "2000 1000 2001", "output": "999" }, { "input": "1000 1000 1001", "output": "999" }, { "input": "5 4 6", "output": "3" }, { "input": "2 1 2", "output": "1" }, { "input": "10 3 10", "output": "3" }, { "input": "15 10 10", "output": "10" }, { "input": "10 5 13", "output": "2" }, { "input": "2 2 2", "output": "2" }, { "input": "5 5 6", "output": "4" }, { "input": "10 6 12", "output": "4" }, { "input": "7 5 8", "output": "4" }, { "input": "10 4 9", "output": "4" }, { "input": "9 2 6", "output": "2" }, { "input": "5 2 6", "output": "1" }, { "input": "6 2 6", "output": "2" }, { "input": "5 5 8", "output": "2" }, { "input": "3 3 5", "output": "1" }, { "input": "10 2 5", "output": "2" }, { "input": "5 3 7", "output": "1" }, { "input": "5 4 8", "output": "1" }, { "input": "10 6 11", "output": "5" }, { "input": "5 3 6", "output": "2" }, { "input": "10 6 14", "output": "2" }, { "input": "10 10 10", "output": "10" }, { "input": "1000000000 1 1000000000", "output": "1" }, { "input": "20 4 22", "output": "2" }, { "input": "5 4 4", "output": "4" }, { "input": "4 3 6", "output": "1" }, { "input": "12 8 18", "output": "2" }, { "input": "10 5 10", "output": "5" }, { "input": "100 50 149", "output": "1" }, { "input": "4 4 4", "output": "4" }, { "input": "7 6 9", "output": "4" }, { "input": "16 10 21", "output": "5" }, { "input": "10 2 11", "output": "1" }, { "input": "600 200 500", "output": "200" }, { "input": "100 30 102", "output": "28" }, { "input": "10 10 18", "output": "2" }, { "input": "15 3 10", "output": "3" }, { "input": "1000000000 1000000000 1000000000", "output": "1000000000" }, { "input": "5 5 5", "output": "5" }, { "input": "10 3 12", "output": "1" }, { "input": "747 457 789", "output": "415" }, { "input": "5 4 7", "output": "2" }, { "input": "15 5 11", "output": "5" }, { "input": "3 2 2", "output": "2" }, { "input": "7 6 8", "output": "5" }, { "input": "7 4 8", "output": "3" }, { "input": "10 4 13", "output": "1" }, { "input": "10 3 9", "output": "3" }, { "input": "20 2 21", "output": "1" }, { "input": "6 5 9", "output": "2" }, { "input": "10 9 18", "output": "1" }, { "input": "12 4 9", "output": "4" }, { "input": "10 7 15", "output": "2" }, { "input": "999999999 999999998 1500000000", "output": "499999997" }, { "input": "20 5 20", "output": "5" }, { "input": "4745 4574 4757", "output": "4562" }, { "input": "10 7 12", "output": "5" }, { "input": "17 15 18", "output": "14" }, { "input": "3 1 3", "output": "1" }, { "input": "100 3 7", "output": "3" }, { "input": "6 2 7", "output": "1" }, { "input": "8 5 10", "output": "3" }, { "input": "3 3 3", "output": "3" }, { "input": "9 5 10", "output": "4" }, { "input": "10 6 13", "output": "3" }, { "input": "13 10 14", "output": "9" }, { "input": "13 12 15", "output": "10" }, { "input": "10 4 12", "output": "2" }, { "input": "41 3 3", "output": "3" }, { "input": "1000000000 1000000000 1400000000", "output": "600000000" }, { "input": "10 3 11", "output": "2" }, { "input": "12 7 18", "output": "1" }, { "input": "15 3 17", "output": "1" }, { "input": "10 2 8", "output": "2" }, { "input": "1000000000 1000 1000000999", "output": "1" }, { "input": "5 5 9", "output": "1" }, { "input": "100 3 6", "output": "3" }, { "input": "100 5 50", "output": "5" }, { "input": "10000 10 10000", "output": "10" }, { "input": "1 1 1", "output": "1" }, { "input": "6 4 4", "output": "4" }, { "input": "9979797 555554 10101010", "output": "434341" }, { "input": "13 5 12", "output": "5" }, { "input": "9 4 10", "output": "3" }, { "input": "7 5 10", "output": "2" }, { "input": "100000000 10000000 100005000", "output": "9995000" }, { "input": "100000 50000 100001", "output": "49999" }, { "input": "15 10 20", "output": "5" }, { "input": "4 4 5", "output": "3" }, { "input": "5 3 3", "output": "3" }, { "input": "30 5 30", "output": "5" }, { "input": "200000 10 200005", "output": "5" }, { "input": "10 9 12", "output": "7" }, { "input": "10 6 15", "output": "1" }, { "input": "1000000000 10 1000000000", "output": "10" }, { "input": "7 5 11", "output": "1" }, { "input": "9 4 4", "output": "4" }, { "input": "14 3 15", "output": "2" }, { "input": "1000000000 100000000 1000000000", "output": "100000000" }, { "input": "40 10 22", "output": "10" }, { "input": "50 10 51", "output": "9" }, { "input": "999999997 999999995 1999999991", "output": "1" }, { "input": "92 79 144", "output": "27" }, { "input": "8 4 4", "output": "4" } ]
1,585,719,888
2,147,483,647
PyPy 3
OK
TESTS
166
140
0
#-------------Program-------------- #----Kuzlyaev-Nikita-Codeforces---- #-------------Training------------- #---------------------------------- n,k,t=map(int,input().split()) if t<=k:print(t) elif t>=n:print(n+k-t) else: print(k)
Title: Arpa and a research in Mexican wave Time Limit: None seconds Memory Limit: None megabytes Problem Description: Arpa is researching the Mexican wave. There are *n* spectators in the stadium, labeled from 1 to *n*. They start the Mexican wave at time 0. - At time 1, the first spectator stands. - At time 2, the second spectator stands. - ... - At time *k*, the *k*-th spectator stands. - At time *k*<=+<=1, the (*k*<=+<=1)-th spectator stands and the first spectator sits. - At time *k*<=+<=2, the (*k*<=+<=2)-th spectator stands and the second spectator sits. - ... - At time *n*, the *n*-th spectator stands and the (*n*<=-<=*k*)-th spectator sits. - At time *n*<=+<=1, the (*n*<=+<=1<=-<=*k*)-th spectator sits. - ... - At time *n*<=+<=*k*, the *n*-th spectator sits. Arpa wants to know how many spectators are standing at time *t*. Input Specification: The first line contains three integers *n*, *k*, *t* (1<=≤<=*n*<=≤<=109, 1<=≤<=*k*<=≤<=*n*, 1<=≤<=*t*<=&lt;<=*n*<=+<=*k*). Output Specification: Print single integer: how many spectators are standing at time *t*. Demo Input: ['10 5 3\n', '10 5 7\n', '10 5 12\n'] Demo Output: ['3\n', '5\n', '3\n'] Note: In the following a sitting spectator is represented as -, a standing spectator is represented as ^. - At *t* = 0  ---------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 0. - At *t* = 1  ^--------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 1. - At *t* = 2  ^^-------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 2. - At *t* = 3  ^^^------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 3. - At *t* = 4  ^^^^------ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 4. - At *t* = 5  ^^^^^----- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 6  -^^^^^---- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 7  --^^^^^--- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 8  ---^^^^^-- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 9  ----^^^^^- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 10 -----^^^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 11 ------^^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 4. - At *t* = 12 -------^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 3. - At *t* = 13 --------^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 2. - At *t* = 14 ---------^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 1. - At *t* = 15 ---------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 0.
```python #-------------Program-------------- #----Kuzlyaev-Nikita-Codeforces---- #-------------Training------------- #---------------------------------- n,k,t=map(int,input().split()) if t<=k:print(t) elif t>=n:print(n+k-t) else: print(k) ```
3
299
B
Ksusha the Squirrel
PROGRAMMING
900
[ "brute force", "implementation" ]
null
null
Ksusha the Squirrel is standing at the beginning of a straight road, divided into *n* sectors. The sectors are numbered 1 to *n*, from left to right. Initially, Ksusha stands in sector 1. Ksusha wants to walk to the end of the road, that is, get to sector *n*. Unfortunately, there are some rocks on the road. We know that Ksusha hates rocks, so she doesn't want to stand in sectors that have rocks. Ksusha the squirrel keeps fit. She can jump from sector *i* to any of the sectors *i*<=+<=1,<=*i*<=+<=2,<=...,<=*i*<=+<=*k*. Help Ksusha! Given the road description, say if she can reach the end of the road (note, she cannot stand on a rock)?
The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=3·105,<=1<=≤<=*k*<=≤<=3·105). The next line contains *n* characters — the description of the road: the *i*-th character equals ".", if the *i*-th sector contains no rocks. Otherwise, it equals "#". It is guaranteed that the first and the last characters equal ".".
Print "YES" (without the quotes) if Ksusha can reach the end of the road, otherwise print "NO" (without the quotes).
[ "2 1\n..\n", "5 2\n.#.#.\n", "7 3\n.#.###.\n" ]
[ "YES\n", "YES\n", "NO\n" ]
none
1,000
[ { "input": "2 1\n..", "output": "YES" }, { "input": "5 2\n.#.#.", "output": "YES" }, { "input": "7 3\n.#.###.", "output": "NO" }, { "input": "2 200\n..", "output": "YES" }, { "input": "2 1\n..", "output": "YES" }, { "input": "2 2\n..", "output": "YES" }, { "input": "2 100000\n..", "output": "YES" }, { "input": "3 1\n.#.", "output": "NO" }, { "input": "3 2\n.#.", "output": "YES" }, { "input": "3 10000\n.#.", "output": "YES" } ]
1,660,297,965
2,147,483,647
Python 3
OK
TESTS
33
218
819,200
n, m = map(int, input(). split()) s = input() ans = 'YES' d = 0 for i in range(n): if s[i] == '#': d += 1 else: if d >= m: ans = 'NO' break d = 0 print(ans)
Title: Ksusha the Squirrel Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ksusha the Squirrel is standing at the beginning of a straight road, divided into *n* sectors. The sectors are numbered 1 to *n*, from left to right. Initially, Ksusha stands in sector 1. Ksusha wants to walk to the end of the road, that is, get to sector *n*. Unfortunately, there are some rocks on the road. We know that Ksusha hates rocks, so she doesn't want to stand in sectors that have rocks. Ksusha the squirrel keeps fit. She can jump from sector *i* to any of the sectors *i*<=+<=1,<=*i*<=+<=2,<=...,<=*i*<=+<=*k*. Help Ksusha! Given the road description, say if she can reach the end of the road (note, she cannot stand on a rock)? Input Specification: The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=3·105,<=1<=≤<=*k*<=≤<=3·105). The next line contains *n* characters — the description of the road: the *i*-th character equals ".", if the *i*-th sector contains no rocks. Otherwise, it equals "#". It is guaranteed that the first and the last characters equal ".". Output Specification: Print "YES" (without the quotes) if Ksusha can reach the end of the road, otherwise print "NO" (without the quotes). Demo Input: ['2 1\n..\n', '5 2\n.#.#.\n', '7 3\n.#.###.\n'] Demo Output: ['YES\n', 'YES\n', 'NO\n'] Note: none
```python n, m = map(int, input(). split()) s = input() ans = 'YES' d = 0 for i in range(n): if s[i] == '#': d += 1 else: if d >= m: ans = 'NO' break d = 0 print(ans) ```
3
928
A
Login Verification
PROGRAMMING
1,200
[ "*special", "strings" ]
null
null
When registering in a social network, users are allowed to create their own convenient login to make it easier to share contacts, print it on business cards, etc. Login is an arbitrary sequence of lower and uppercase latin letters, digits and underline symbols («_»). However, in order to decrease the number of frauds and user-inattention related issues, it is prohibited to register a login if it is similar with an already existing login. More precisely, two logins *s* and *t* are considered similar if we can transform *s* to *t* via a sequence of operations of the following types: - transform lowercase letters to uppercase and vice versa; - change letter «O» (uppercase latin letter) to digit «0» and vice versa; - change digit «1» (one) to any letter among «l» (lowercase latin «L»), «I» (uppercase latin «i») and vice versa, or change one of these letters to other. For example, logins «Codeforces» and «codef0rces» as well as «OO0OOO00O0OOO0O00OOO0OO_lol» and «OO0OOO0O00OOO0O00OO0OOO_1oI» are considered similar whereas «Codeforces» and «Code_forces» are not. You're given a list of existing logins with no two similar amonst and a newly created user login. Check whether this new login is similar with any of the existing ones.
The first line contains a non-empty string *s* consisting of lower and uppercase latin letters, digits and underline symbols («_») with length not exceeding 50  — the login itself. The second line contains a single integer *n* (1<=≤<=*n*<=≤<=1<=000) — the number of existing logins. The next *n* lines describe the existing logins, following the same constraints as the user login (refer to the first line of the input). It's guaranteed that no two existing logins are similar.
Print «Yes» (without quotes), if user can register via this login, i.e. none of the existing logins is similar with it. Otherwise print «No» (without quotes).
[ "1_wat\n2\n2_wat\nwat_1\n", "000\n3\n00\nooA\noOo\n", "_i_\n3\n__i_\n_1_\nI\n", "La0\n3\n2a0\nLa1\n1a0\n", "abc\n1\naBc\n", "0Lil\n2\nLIL0\n0Ril\n" ]
[ "Yes\n", "No\n", "No\n", "No\n", "No\n", "Yes\n" ]
In the second sample case the user wants to create a login consisting of three zeros. It's impossible due to collision with the third among the existing. In the third sample case the new login is similar with the second one.
500
[ { "input": "1_wat\n2\n2_wat\nwat_1", "output": "Yes" }, { "input": "000\n3\n00\nooA\noOo", "output": "No" }, { "input": "_i_\n3\n__i_\n_1_\nI", "output": "No" }, { "input": "La0\n3\n2a0\nLa1\n1a0", "output": "No" }, { "input": "abc\n1\naBc", "output": "No" }, { "input": "0Lil\n2\nLIL0\n0Ril", "output": "Yes" }, { "input": "iloO\n3\niIl0\noIl0\nIooO", "output": "Yes" }, { "input": "L1il0o1L1\n5\niLLoLL\noOI1Io10il\nIoLLoO\nO01ilOoI\nI10l0o", "output": "Yes" }, { "input": "ELioO1lOoOIOiLoooi1iolul1O\n7\nOoEIuOIl1ui1010uiooOoi0Oio001L0EoEolO0\nOLIoOEuoE11u1u1iLOI0oO\nuEOuO0uIOOlO01OlEI0E1Oo0IO1LI0uE0LILO0\nEOo0Il11iIOOOIiuOiIiiLOLEOOII001EE\niOoO0LOulioE0OLIIIulli01OoiuOOOoOlEiI0EiiElIIu0\nlE1LOE1Oil\n1u0EOliIiIOl1u110il0l1O0u", "output": "Yes" }, { "input": "0blo7X\n20\n1oobb6\nXIXIO2X\n2iYI2\n607XXol\n2I6io22\nOl10I\nbXX0Lo\nolOOb7X\n07LlXL\nlXY17\n12iIX2\n7lL70\nbOo11\n17Y6b62\n0O6L7\n1lX2L\n2iYl6lI\n7bXIi1o\niLIY2\n0OIo1X", "output": "Yes" }, { "input": "lkUL\n25\nIIfL\nokl\nfoo\ni0U\noko\niIoU\nUUv\nvli\nv0Uk\n0Of\niill\n1vkl\nUIf\nUfOO\nlvLO\nUUo0\nIOf1\nlovL\nIkk\noIv\nLvfU\n0UI\nkol\n1OO0\n1OOi", "output": "Yes" }, { "input": "L1lo\n3\nOOo1\nL1lo\n0lOl", "output": "No" }, { "input": "LIoooiLO\n5\nLIoooiLO\nl0o01I00\n0OOl0lLO01\nil10i0\noiloi", "output": "No" }, { "input": "1i1lQI\n7\nuLg1uLLigIiOLoggu\nLLLgIuQIQIIloiQuIIoIO0l0o000\n0u1LQu11oIuooIl0OooLg0i0IQu1O1lloI1\nQuQgIQi0LOIliLOuuuioLQou1l\nlLIO00QLi01LogOliOIggII1\no0Ll1uIOQl10IL0IILQ\n1i1lQI", "output": "No" }, { "input": "oIzz1\n20\n1TTl0O\nloF0LT\n1lLzo\noi0Ov\nFlIF1zT\nzoITzx\n0TIFlT\nl1vllil\nOviix1F\nLFvI1lL\nLIl0loz\nixz1v\n1i1vFi\nTIFTol\noIzz1\nIvTl0o\nxv1U0O\niiiioF\n1oiLUlO\nxToxv1", "output": "No" }, { "input": "00L0\n25\n0il\nIlkZ\nL0I\n00L0\nBd0\nZLd\n0d1k\nddk\nIdl\nkBd\nkBOL\nZ1lI\nkBL\nLOko\noZ0i\nZ1lO\nLiOk\niBld\nLO0d\ndIo\nZ10\n1k1i\n0o0L\nIoBd\ni0B0", "output": "No" }, { "input": "Z\n1\nz", "output": "No" }, { "input": "0\n1\no", "output": "No" }, { "input": "0\n1\nO", "output": "No" }, { "input": "o\n1\n0", "output": "No" }, { "input": "o\n1\nO", "output": "No" }, { "input": "o\n1\no", "output": "No" }, { "input": "O\n1\no", "output": "No" }, { "input": "O\n1\n0", "output": "No" }, { "input": "1\n1\nl", "output": "No" }, { "input": "1\n1\nL", "output": "No" }, { "input": "1\n1\ni", "output": "No" }, { "input": "1\n1\nI", "output": "No" }, { "input": "1\n1\no", "output": "Yes" }, { "input": "i\n1\n1", "output": "No" }, { "input": "i\n1\nL", "output": "No" }, { "input": "i\n1\nl", "output": "No" }, { "input": "I\n1\nL", "output": "No" }, { "input": "I\n1\nl", "output": "No" }, { "input": "I\n1\n1", "output": "No" }, { "input": "l\n1\n1", "output": "No" }, { "input": "l\n1\nL", "output": "No" }, { "input": "l\n1\ni", "output": "No" }, { "input": "l\n1\nI", "output": "No" }, { "input": "L\n1\nl", "output": "No" }, { "input": "L\n1\n1", "output": "No" }, { "input": "L\n1\ni", "output": "No" }, { "input": "L\n1\nI", "output": "No" } ]
1,519,489,781
3,281
Python 3
OK
TESTS
73
77
5,632,000
def checkEquals( a , b): if a == b : return True if a == b.upper() or b == a.upper(): return True if (a == '0' or a == 'O' or a == 'o') and (b == '0' or b == 'O' or b == 'o') : return True if (a == '1' or a == 'i' or a == 'I' or a == 'l' or a == 'L') and (b == '1' or b == 'i' or b == 'I' or b == 'l' or b == 'L'): return True return False def cheakName( name1 , name2): if len(name1) != len(name2) : return False for i in range(len(name1)): if not checkEquals(name1[i] , name2[i]): return False return True newName = input() N = int(input()) mass = [] for i in range(N): mass.append(input()) flag = False for name in mass : if cheakName(newName , name) : flag = True if flag : print('No') else: print('Yes')
Title: Login Verification Time Limit: None seconds Memory Limit: None megabytes Problem Description: When registering in a social network, users are allowed to create their own convenient login to make it easier to share contacts, print it on business cards, etc. Login is an arbitrary sequence of lower and uppercase latin letters, digits and underline symbols («_»). However, in order to decrease the number of frauds and user-inattention related issues, it is prohibited to register a login if it is similar with an already existing login. More precisely, two logins *s* and *t* are considered similar if we can transform *s* to *t* via a sequence of operations of the following types: - transform lowercase letters to uppercase and vice versa; - change letter «O» (uppercase latin letter) to digit «0» and vice versa; - change digit «1» (one) to any letter among «l» (lowercase latin «L»), «I» (uppercase latin «i») and vice versa, or change one of these letters to other. For example, logins «Codeforces» and «codef0rces» as well as «OO0OOO00O0OOO0O00OOO0OO_lol» and «OO0OOO0O00OOO0O00OO0OOO_1oI» are considered similar whereas «Codeforces» and «Code_forces» are not. You're given a list of existing logins with no two similar amonst and a newly created user login. Check whether this new login is similar with any of the existing ones. Input Specification: The first line contains a non-empty string *s* consisting of lower and uppercase latin letters, digits and underline symbols («_») with length not exceeding 50  — the login itself. The second line contains a single integer *n* (1<=≤<=*n*<=≤<=1<=000) — the number of existing logins. The next *n* lines describe the existing logins, following the same constraints as the user login (refer to the first line of the input). It's guaranteed that no two existing logins are similar. Output Specification: Print «Yes» (without quotes), if user can register via this login, i.e. none of the existing logins is similar with it. Otherwise print «No» (without quotes). Demo Input: ['1_wat\n2\n2_wat\nwat_1\n', '000\n3\n00\nooA\noOo\n', '_i_\n3\n__i_\n_1_\nI\n', 'La0\n3\n2a0\nLa1\n1a0\n', 'abc\n1\naBc\n', '0Lil\n2\nLIL0\n0Ril\n'] Demo Output: ['Yes\n', 'No\n', 'No\n', 'No\n', 'No\n', 'Yes\n'] Note: In the second sample case the user wants to create a login consisting of three zeros. It's impossible due to collision with the third among the existing. In the third sample case the new login is similar with the second one.
```python def checkEquals( a , b): if a == b : return True if a == b.upper() or b == a.upper(): return True if (a == '0' or a == 'O' or a == 'o') and (b == '0' or b == 'O' or b == 'o') : return True if (a == '1' or a == 'i' or a == 'I' or a == 'l' or a == 'L') and (b == '1' or b == 'i' or b == 'I' or b == 'l' or b == 'L'): return True return False def cheakName( name1 , name2): if len(name1) != len(name2) : return False for i in range(len(name1)): if not checkEquals(name1[i] , name2[i]): return False return True newName = input() N = int(input()) mass = [] for i in range(N): mass.append(input()) flag = False for name in mass : if cheakName(newName , name) : flag = True if flag : print('No') else: print('Yes') ```
3
268
A
Games
PROGRAMMING
800
[ "brute force" ]
null
null
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
In a single line print the number of games where the host team is going to play in the guest uniform.
[ "3\n1 2\n2 4\n3 4\n", "4\n100 42\n42 100\n5 42\n100 5\n", "2\n1 2\n1 2\n" ]
[ "1\n", "5\n", "0\n" ]
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
500
[ { "input": "3\n1 2\n2 4\n3 4", "output": "1" }, { "input": "4\n100 42\n42 100\n5 42\n100 5", "output": "5" }, { "input": "2\n1 2\n1 2", "output": "0" }, { "input": "7\n4 7\n52 55\n16 4\n55 4\n20 99\n3 4\n7 52", "output": "6" }, { "input": "10\n68 42\n1 35\n25 70\n59 79\n65 63\n46 6\n28 82\n92 62\n43 96\n37 28", "output": "1" }, { "input": "30\n10 39\n89 1\n78 58\n75 99\n36 13\n77 50\n6 97\n79 28\n27 52\n56 5\n93 96\n40 21\n33 74\n26 37\n53 59\n98 56\n61 65\n42 57\n9 7\n25 63\n74 34\n96 84\n95 47\n12 23\n34 21\n71 6\n27 13\n15 47\n64 14\n12 77", "output": "6" }, { "input": "30\n46 100\n87 53\n34 84\n44 66\n23 20\n50 34\n90 66\n17 39\n13 22\n94 33\n92 46\n63 78\n26 48\n44 61\n3 19\n41 84\n62 31\n65 89\n23 28\n58 57\n19 85\n26 60\n75 66\n69 67\n76 15\n64 15\n36 72\n90 89\n42 69\n45 35", "output": "4" }, { "input": "2\n46 6\n6 46", "output": "2" }, { "input": "29\n8 18\n33 75\n69 22\n97 95\n1 97\n78 10\n88 18\n13 3\n19 64\n98 12\n79 92\n41 72\n69 15\n98 31\n57 74\n15 56\n36 37\n15 66\n63 100\n16 42\n47 56\n6 4\n73 15\n30 24\n27 71\n12 19\n88 69\n85 6\n50 11", "output": "10" }, { "input": "23\n43 78\n31 28\n58 80\n66 63\n20 4\n51 95\n40 20\n50 14\n5 34\n36 39\n77 42\n64 97\n62 89\n16 56\n8 34\n58 16\n37 35\n37 66\n8 54\n50 36\n24 8\n68 48\n85 33", "output": "6" }, { "input": "13\n76 58\n32 85\n99 79\n23 58\n96 59\n72 35\n53 43\n96 55\n41 78\n75 10\n28 11\n72 7\n52 73", "output": "0" }, { "input": "18\n6 90\n70 79\n26 52\n67 81\n29 95\n41 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 2", "output": "1" }, { "input": "18\n6 90\n100 79\n26 100\n67 100\n29 100\n100 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 100", "output": "8" }, { "input": "30\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "450" }, { "input": "30\n100 99\n58 59\n56 57\n54 55\n52 53\n50 51\n48 49\n46 47\n44 45\n42 43\n40 41\n38 39\n36 37\n34 35\n32 33\n30 31\n28 29\n26 27\n24 25\n22 23\n20 21\n18 19\n16 17\n14 15\n12 13\n10 11\n8 9\n6 7\n4 5\n2 3", "output": "0" }, { "input": "15\n9 3\n2 6\n7 6\n5 10\n9 5\n8 1\n10 5\n2 8\n4 5\n9 8\n5 3\n3 8\n9 8\n4 10\n8 5", "output": "20" }, { "input": "15\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n1 2", "output": "108" }, { "input": "25\n2 1\n1 2\n1 2\n1 2\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n1 2\n2 1\n2 1\n2 1\n2 1\n1 2", "output": "312" }, { "input": "25\n91 57\n2 73\n54 57\n2 57\n23 57\n2 6\n57 54\n57 23\n91 54\n91 23\n57 23\n91 57\n54 2\n6 91\n57 54\n2 57\n57 91\n73 91\n57 23\n91 57\n2 73\n91 2\n23 6\n2 73\n23 6", "output": "96" }, { "input": "28\n31 66\n31 91\n91 31\n97 66\n31 66\n31 66\n66 91\n91 31\n97 31\n91 97\n97 31\n66 31\n66 97\n91 31\n31 66\n31 66\n66 31\n31 97\n66 97\n97 31\n31 91\n66 91\n91 66\n31 66\n91 66\n66 31\n66 31\n91 97", "output": "210" }, { "input": "29\n78 27\n50 68\n24 26\n68 43\n38 78\n26 38\n78 28\n28 26\n27 24\n23 38\n24 26\n24 43\n61 50\n38 78\n27 23\n61 26\n27 28\n43 23\n28 78\n43 27\n43 78\n27 61\n28 38\n61 78\n50 26\n43 27\n26 78\n28 50\n43 78", "output": "73" }, { "input": "29\n80 27\n69 80\n27 80\n69 80\n80 27\n80 27\n80 27\n80 69\n27 69\n80 69\n80 27\n27 69\n69 27\n80 69\n27 69\n69 80\n27 69\n80 69\n80 27\n69 27\n27 69\n27 80\n80 27\n69 80\n27 69\n80 69\n69 80\n69 80\n27 80", "output": "277" }, { "input": "30\n19 71\n7 89\n89 71\n21 7\n19 21\n7 89\n19 71\n89 8\n89 21\n19 8\n21 7\n8 89\n19 89\n7 21\n19 8\n19 7\n7 19\n8 21\n71 21\n71 89\n7 19\n7 19\n21 7\n21 19\n21 19\n71 8\n21 8\n71 19\n19 71\n8 21", "output": "154" }, { "input": "30\n44 17\n44 17\n44 17\n17 44\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n44 17\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n17 44\n44 17\n44 17\n44 17\n17 44\n17 44\n44 17\n17 44\n44 17\n44 17\n44 17", "output": "418" }, { "input": "22\n78 92\n15 92\n92 78\n78 80\n92 16\n24 80\n92 16\n16 92\n78 16\n24 78\n80 78\n92 80\n16 80\n80 78\n15 78\n92 16\n24 15\n24 80\n80 16\n16 80\n92 80\n24 80", "output": "74" }, { "input": "24\n9 83\n90 31\n83 3\n83 3\n21 31\n83 3\n32 31\n12 21\n31 21\n90 32\n32 21\n12 9\n12 31\n9 83\n83 12\n32 3\n32 83\n90 31\n9 32\n31 21\n83 90\n32 21\n21 3\n32 9", "output": "59" }, { "input": "30\n67 21\n85 39\n85 87\n21 39\n66 85\n10 95\n10 21\n87 85\n82 21\n67 21\n95 10\n21 39\n82 21\n21 66\n66 39\n95 30\n67 85\n66 82\n85 82\n21 66\n10 39\n67 10\n21 85\n10 82\n85 95\n10 85\n21 39\n85 39\n39 10\n95 67", "output": "100" }, { "input": "4\n8 7\n8 7\n7 8\n7 8", "output": "8" }, { "input": "6\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1", "output": "10" }, { "input": "12\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "72" }, { "input": "4\n1 2\n1 2\n2 1\n2 1", "output": "8" } ]
1,695,898,708
2,147,483,647
PyPy 3-64
OK
TESTS
31
124
0
import sys n = int(sys.stdin.readline().strip()) h_count = {} g_count = {} for _ in range(n): h, g = list(map(int, sys.stdin.readline().strip().split())) h_count[h] = h_count.get(h, 0) + 1 g_count[g] = g_count.get(g, 0) + 1 ans = 0 for h, h_num in h_count.items(): if h in g_count: ans += h_num * g_count[h] print(ans)
Title: Games Time Limit: None seconds Memory Limit: None megabytes Problem Description: Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question. Input Specification: The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively. Output Specification: In a single line print the number of games where the host team is going to play in the guest uniform. Demo Input: ['3\n1 2\n2 4\n3 4\n', '4\n100 42\n42 100\n5 42\n100 5\n', '2\n1 2\n1 2\n'] Demo Output: ['1\n', '5\n', '0\n'] Note: In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
```python import sys n = int(sys.stdin.readline().strip()) h_count = {} g_count = {} for _ in range(n): h, g = list(map(int, sys.stdin.readline().strip().split())) h_count[h] = h_count.get(h, 0) + 1 g_count[g] = g_count.get(g, 0) + 1 ans = 0 for h, h_num in h_count.items(): if h in g_count: ans += h_num * g_count[h] print(ans) ```
3
165
A
Supercentral Point
PROGRAMMING
1,000
[ "implementation" ]
null
null
One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*): - point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=&gt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=&lt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=&lt;<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=&gt;<=*y* We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points. Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set.
The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different.
Print the only number — the number of supercentral points of the given set.
[ "8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n", "5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n" ]
[ "2\n", "1\n" ]
In the first sample the supercentral points are only points (1, 1) and (1, 2). In the second sample there is one supercental point — point (0, 0).
500
[ { "input": "8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3", "output": "2" }, { "input": "5\n0 0\n0 1\n1 0\n0 -1\n-1 0", "output": "1" }, { "input": "9\n-565 -752\n-184 723\n-184 -752\n-184 1\n950 723\n-565 723\n950 -752\n950 1\n-565 1", "output": "1" }, { "input": "25\n-651 897\n916 897\n-651 -808\n-748 301\n-734 414\n-651 -973\n-734 897\n916 -550\n-758 414\n916 180\n-758 -808\n-758 -973\n125 -550\n125 -973\n125 301\n916 414\n-748 -808\n-651 301\n-734 301\n-307 897\n-651 -550\n-651 414\n125 -808\n-748 -550\n916 -808", "output": "7" }, { "input": "1\n487 550", "output": "0" }, { "input": "10\n990 -396\n990 736\n990 646\n990 -102\n990 -570\n990 155\n990 528\n990 489\n990 268\n990 676", "output": "0" }, { "input": "30\n507 836\n525 836\n-779 196\n507 -814\n525 -814\n525 42\n525 196\n525 -136\n-779 311\n507 -360\n525 300\n507 578\n507 311\n-779 836\n507 300\n525 -360\n525 311\n-779 -360\n-779 578\n-779 300\n507 42\n525 578\n-779 379\n507 196\n525 379\n507 379\n-779 -814\n-779 42\n-779 -136\n507 -136", "output": "8" }, { "input": "25\n890 -756\n890 -188\n-37 -756\n-37 853\n523 998\n-261 853\n-351 853\n-351 -188\n523 -756\n-261 -188\n-37 998\n523 -212\n-351 998\n-37 -188\n-351 -756\n-37 -212\n890 998\n890 -212\n523 853\n-351 -212\n-261 -212\n-261 998\n-261 -756\n890 853\n523 -188", "output": "9" }, { "input": "21\n-813 -11\n486 254\n685 254\n-708 254\n-55 -11\n-671 -191\n486 -11\n-671 -11\n685 -11\n685 -191\n486 -191\n-55 254\n-708 -11\n-813 254\n-708 -191\n41 -11\n-671 254\n-813 -191\n41 254\n-55 -191\n41 -191", "output": "5" }, { "input": "4\n1 0\n2 0\n1 1\n1 -1", "output": "0" } ]
1,589,200,134
2,147,483,647
Python 3
OK
TESTS
26
248
7,065,600
import sys import collections import math import itertools as it def readArray(type= int): line = input() return [type(x) for x in line.split()] def solve(): n = int(input()) points = [] for x in range(n): points.append(readArray()) xfreq = collections.defaultdict(list) yfreq = collections.defaultdict(list) for p in points: xfreq[p[0]].append(p) yfreq[p[1]].append(p) cc = 0 for p in points: nb = 0 # upper neighbours for q in xfreq[p[0]]: if(q[1] > p[1]): nb+= 1 break # lower neighbours for q in xfreq[p[0]]: if (q[1] < p[1]): nb += 1 break # left neighbours for q in yfreq[p[1]]: if (q[0] < p[0]): nb += 1 break # right neighbours for q in yfreq[p[1]]: if (q[0] > p[0]): nb += 1 break if nb == 4: cc+= 1 print(cc) if __name__ == '__main__': solve()
Title: Supercentral Point Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*): - point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=&gt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=&lt;<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=&lt;<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=&gt;<=*y* We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points. Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set. Input Specification: The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different. Output Specification: Print the only number — the number of supercentral points of the given set. Demo Input: ['8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n', '5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n'] Demo Output: ['2\n', '1\n'] Note: In the first sample the supercentral points are only points (1, 1) and (1, 2). In the second sample there is one supercental point — point (0, 0).
```python import sys import collections import math import itertools as it def readArray(type= int): line = input() return [type(x) for x in line.split()] def solve(): n = int(input()) points = [] for x in range(n): points.append(readArray()) xfreq = collections.defaultdict(list) yfreq = collections.defaultdict(list) for p in points: xfreq[p[0]].append(p) yfreq[p[1]].append(p) cc = 0 for p in points: nb = 0 # upper neighbours for q in xfreq[p[0]]: if(q[1] > p[1]): nb+= 1 break # lower neighbours for q in xfreq[p[0]]: if (q[1] < p[1]): nb += 1 break # left neighbours for q in yfreq[p[1]]: if (q[0] < p[0]): nb += 1 break # right neighbours for q in yfreq[p[1]]: if (q[0] > p[0]): nb += 1 break if nb == 4: cc+= 1 print(cc) if __name__ == '__main__': solve() ```
3
887
A
Div. 64
PROGRAMMING
1,000
[ "implementation" ]
null
null
Top-model Izabella participates in the competition. She wants to impress judges and show her mathematical skills. Her problem is following: for given string, consisting of only 0 and 1, tell if it's possible to remove some digits in such a way, that remaining number is a representation of some positive integer, divisible by 64, in the binary numerical system.
In the only line given a non-empty binary string *s* with length up to 100.
Print «yes» (without quotes) if it's possible to remove digits required way and «no» otherwise.
[ "100010001\n", "100\n" ]
[ "yes", "no" ]
In the first test case, you can get string 1 000 000 after removing two ones which is a representation of number 64 in the binary numerical system. You can read more about binary numeral system representation here: [https://en.wikipedia.org/wiki/Binary_system](https://en.wikipedia.org/wiki/Binary_system)
500
[ { "input": "100010001", "output": "yes" }, { "input": "100", "output": "no" }, { "input": "0000001000000", "output": "yes" }, { "input": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111", "output": "no" }, { "input": "1111111111111111111111111111111111111111111111111111111111111111111111110111111111111111111111111111", "output": "no" }, { "input": "0111111101111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111", "output": "no" }, { "input": "1111011111111111111111111111110111110111111111111111111111011111111111111110111111111111111111111111", "output": "no" }, { "input": "1111111111101111111111111111111111111011111111111111111111111101111011111101111111111101111111111111", "output": "yes" }, { "input": "0110111111111111111111011111111110110111110111111111111111111111111111111111111110111111111111111111", "output": "yes" }, { "input": "1100110001111011001101101000001110111110011110111110010100011000100101000010010111100000010001001101", "output": "yes" }, { "input": "000000", "output": "no" }, { "input": "0001000", "output": "no" }, { "input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "no" }, { "input": "1000000", "output": "yes" }, { "input": "0", "output": "no" }, { "input": "1", "output": "no" }, { "input": "10000000000", "output": "yes" }, { "input": "0000000000", "output": "no" }, { "input": "0010000", "output": "no" }, { "input": "000000011", "output": "no" }, { "input": "000000000", "output": "no" }, { "input": "00000000", "output": "no" }, { "input": "000000000011", "output": "no" }, { "input": "0000000", "output": "no" }, { "input": "00000000011", "output": "no" }, { "input": "000000001", "output": "no" }, { "input": "000000000000000000000000000", "output": "no" }, { "input": "0000001", "output": "no" }, { "input": "00000001", "output": "no" }, { "input": "00000000100", "output": "no" }, { "input": "00000000000000000000", "output": "no" }, { "input": "0000000000000000000", "output": "no" }, { "input": "00001000", "output": "no" }, { "input": "0000000000010", "output": "no" }, { "input": "000000000010", "output": "no" }, { "input": "000000000000010", "output": "no" }, { "input": "0100000", "output": "no" }, { "input": "00010000", "output": "no" }, { "input": "00000000000000000", "output": "no" }, { "input": "00000000000", "output": "no" }, { "input": "000001000", "output": "no" }, { "input": "000000000000", "output": "no" }, { "input": "100000000000000", "output": "yes" }, { "input": "000010000", "output": "no" }, { "input": "00000100", "output": "no" }, { "input": "0001100000", "output": "no" }, { "input": "000000000000000000000000001", "output": "no" }, { "input": "000000100", "output": "no" }, { "input": "0000000000001111111111", "output": "no" }, { "input": "00000010", "output": "no" }, { "input": "0001110000", "output": "no" }, { "input": "0000000000000000000000", "output": "no" }, { "input": "000000010010", "output": "no" }, { "input": "0000100", "output": "no" }, { "input": "0000000001", "output": "no" }, { "input": "000000111", "output": "no" }, { "input": "0000000000000", "output": "no" }, { "input": "000000000000000000", "output": "no" }, { "input": "0000000000000000000000000", "output": "no" }, { "input": "000000000000000", "output": "no" }, { "input": "0010000000000100", "output": "yes" }, { "input": "0000001000", "output": "no" }, { "input": "00000000000000000001", "output": "no" }, { "input": "100000000", "output": "yes" }, { "input": "000000000001", "output": "no" }, { "input": "0000011001", "output": "no" }, { "input": "000", "output": "no" }, { "input": "000000000000000000000", "output": "no" }, { "input": "0000000000011", "output": "no" }, { "input": "0000000000000000", "output": "no" }, { "input": "00000000000000001", "output": "no" }, { "input": "00000000000000", "output": "no" }, { "input": "0000000000000000010", "output": "no" }, { "input": "00000000000000000000000000000000000000000000000000000000", "output": "no" }, { "input": "000011000", "output": "no" }, { "input": "00000011", "output": "no" }, { "input": "0000000000001100", "output": "no" }, { "input": "00000", "output": "no" }, { "input": "000000000000000000000000000111111111111111", "output": "no" }, { "input": "000000010", "output": "no" }, { "input": "00000000111", "output": "no" }, { "input": "000000000000001", "output": "no" }, { "input": "0000000000000011111111111111111", "output": "no" }, { "input": "0000000010", "output": "no" }, { "input": "0000000000000000000000000000000000000000000000000", "output": "no" }, { "input": "00000000010", "output": "no" }, { "input": "101000000000", "output": "yes" }, { "input": "00100000", "output": "no" }, { "input": "00000000000001", "output": "no" }, { "input": "0000000000100", "output": "no" }, { "input": "0000", "output": "no" }, { "input": "00000000000111", "output": "no" }, { "input": "0000000000000011", "output": "no" }, { "input": "0000000000000000000000000000000000000000", "output": "no" }, { "input": "0000000000000010", "output": "no" }, { "input": "0010101010", "output": "no" }, { "input": "0000000000000001", "output": "no" }, { "input": "1010101", "output": "no" } ]
1,510,915,337
2,147,483,647
Python 3
OK
TESTS
98
62
102,400
n = input() if '1' in n and n[n.index('1'):].count('0') >= 6: print('yes') else: print('no')
Title: Div. 64 Time Limit: None seconds Memory Limit: None megabytes Problem Description: Top-model Izabella participates in the competition. She wants to impress judges and show her mathematical skills. Her problem is following: for given string, consisting of only 0 and 1, tell if it's possible to remove some digits in such a way, that remaining number is a representation of some positive integer, divisible by 64, in the binary numerical system. Input Specification: In the only line given a non-empty binary string *s* with length up to 100. Output Specification: Print «yes» (without quotes) if it's possible to remove digits required way and «no» otherwise. Demo Input: ['100010001\n', '100\n'] Demo Output: ['yes', 'no'] Note: In the first test case, you can get string 1 000 000 after removing two ones which is a representation of number 64 in the binary numerical system. You can read more about binary numeral system representation here: [https://en.wikipedia.org/wiki/Binary_system](https://en.wikipedia.org/wiki/Binary_system)
```python n = input() if '1' in n and n[n.index('1'):].count('0') >= 6: print('yes') else: print('no') ```
3
982
B
Bus of Characters
PROGRAMMING
1,300
[ "data structures", "greedy", "implementation" ]
null
null
In the Bus of Characters there are $n$ rows of seat, each having $2$ seats. The width of both seats in the $i$-th row is $w_i$ centimeters. All integers $w_i$ are distinct. Initially the bus is empty. On each of $2n$ stops one passenger enters the bus. There are two types of passengers: - an introvert always chooses a row where both seats are empty. Among these rows he chooses the one with the smallest seats width and takes one of the seats in it; - an extrovert always chooses a row where exactly one seat is occupied (by an introvert). Among these rows he chooses the one with the largest seats width and takes the vacant place in it. You are given the seats width in each row and the order the passengers enter the bus. Determine which row each passenger will take.
The first line contains a single integer $n$ ($1 \le n \le 200\,000$) — the number of rows in the bus. The second line contains the sequence of integers $w_1, w_2, \dots, w_n$ ($1 \le w_i \le 10^{9}$), where $w_i$ is the width of each of the seats in the $i$-th row. It is guaranteed that all $w_i$ are distinct. The third line contains a string of length $2n$, consisting of digits '0' and '1' — the description of the order the passengers enter the bus. If the $j$-th character is '0', then the passenger that enters the bus on the $j$-th stop is an introvert. If the $j$-th character is '1', the the passenger that enters the bus on the $j$-th stop is an extrovert. It is guaranteed that the number of extroverts equals the number of introverts (i. e. both numbers equal $n$), and for each extrovert there always is a suitable row.
Print $2n$ integers — the rows the passengers will take. The order of passengers should be the same as in input.
[ "2\n3 1\n0011\n", "6\n10 8 9 11 13 5\n010010011101\n" ]
[ "2 1 1 2 \n", "6 6 2 3 3 1 4 4 1 2 5 5 \n" ]
In the first example the first passenger (introvert) chooses the row $2$, because it has the seats with smallest width. The second passenger (introvert) chooses the row $1$, because it is the only empty row now. The third passenger (extrovert) chooses the row $1$, because it has exactly one occupied seat and the seat width is the largest among such rows. The fourth passenger (extrovert) chooses the row $2$, because it is the only row with an empty place.
1,000
[ { "input": "2\n3 1\n0011", "output": "2 1 1 2 " }, { "input": "6\n10 8 9 11 13 5\n010010011101", "output": "6 6 2 3 3 1 4 4 1 2 5 5 " }, { "input": "1\n1\n01", "output": "1 1 " }, { "input": "1\n1000000\n01", "output": "1 1 " }, { "input": "2\n1 1000000\n0011", "output": "1 2 2 1 " }, { "input": "2\n1000000000 1\n0101", "output": "2 2 1 1 " }, { "input": "2\n1000000000 999999999\n0011", "output": "2 1 1 2 " }, { "input": "10\n24 53 10 99 83 9 15 62 33 47\n00100000000111111111", "output": "6 3 3 7 1 9 10 2 8 5 4 4 5 8 2 10 9 1 7 6 " } ]
1,624,894,334
2,147,483,647
PyPy 3
OK
TESTS
49
1,185
30,720,000
n=int(input()) i=iter(sorted(zip(map(int,input().split()),range(1,n+1)))) s,o=[],[] for c in input(): if c=='0': x=next(i)[1];o+=[x];s+=[x] else:o.append(s.pop()) print(*o)
Title: Bus of Characters Time Limit: None seconds Memory Limit: None megabytes Problem Description: In the Bus of Characters there are $n$ rows of seat, each having $2$ seats. The width of both seats in the $i$-th row is $w_i$ centimeters. All integers $w_i$ are distinct. Initially the bus is empty. On each of $2n$ stops one passenger enters the bus. There are two types of passengers: - an introvert always chooses a row where both seats are empty. Among these rows he chooses the one with the smallest seats width and takes one of the seats in it; - an extrovert always chooses a row where exactly one seat is occupied (by an introvert). Among these rows he chooses the one with the largest seats width and takes the vacant place in it. You are given the seats width in each row and the order the passengers enter the bus. Determine which row each passenger will take. Input Specification: The first line contains a single integer $n$ ($1 \le n \le 200\,000$) — the number of rows in the bus. The second line contains the sequence of integers $w_1, w_2, \dots, w_n$ ($1 \le w_i \le 10^{9}$), where $w_i$ is the width of each of the seats in the $i$-th row. It is guaranteed that all $w_i$ are distinct. The third line contains a string of length $2n$, consisting of digits '0' and '1' — the description of the order the passengers enter the bus. If the $j$-th character is '0', then the passenger that enters the bus on the $j$-th stop is an introvert. If the $j$-th character is '1', the the passenger that enters the bus on the $j$-th stop is an extrovert. It is guaranteed that the number of extroverts equals the number of introverts (i. e. both numbers equal $n$), and for each extrovert there always is a suitable row. Output Specification: Print $2n$ integers — the rows the passengers will take. The order of passengers should be the same as in input. Demo Input: ['2\n3 1\n0011\n', '6\n10 8 9 11 13 5\n010010011101\n'] Demo Output: ['2 1 1 2 \n', '6 6 2 3 3 1 4 4 1 2 5 5 \n'] Note: In the first example the first passenger (introvert) chooses the row $2$, because it has the seats with smallest width. The second passenger (introvert) chooses the row $1$, because it is the only empty row now. The third passenger (extrovert) chooses the row $1$, because it has exactly one occupied seat and the seat width is the largest among such rows. The fourth passenger (extrovert) chooses the row $2$, because it is the only row with an empty place.
```python n=int(input()) i=iter(sorted(zip(map(int,input().split()),range(1,n+1)))) s,o=[],[] for c in input(): if c=='0': x=next(i)[1];o+=[x];s+=[x] else:o.append(s.pop()) print(*o) ```
3
483
A
Counterexample
PROGRAMMING
1,100
[ "brute force", "implementation", "math", "number theory" ]
null
null
Your friend has recently learned about coprime numbers. A pair of numbers {*a*,<=*b*} is called coprime if the maximum number that divides both *a* and *b* is equal to one. Your friend often comes up with different statements. He has recently supposed that if the pair (*a*,<=*b*) is coprime and the pair (*b*,<=*c*) is coprime, then the pair (*a*,<=*c*) is coprime. You want to find a counterexample for your friend's statement. Therefore, your task is to find three distinct numbers (*a*,<=*b*,<=*c*), for which the statement is false, and the numbers meet the condition *l*<=≤<=*a*<=&lt;<=*b*<=&lt;<=*c*<=≤<=*r*. More specifically, you need to find three numbers (*a*,<=*b*,<=*c*), such that *l*<=≤<=*a*<=&lt;<=*b*<=&lt;<=*c*<=≤<=*r*, pairs (*a*,<=*b*) and (*b*,<=*c*) are coprime, and pair (*a*,<=*c*) is not coprime.
The single line contains two positive space-separated integers *l*, *r* (1<=≤<=*l*<=≤<=*r*<=≤<=1018; *r*<=-<=*l*<=≤<=50).
Print three positive space-separated integers *a*, *b*, *c* — three distinct numbers (*a*,<=*b*,<=*c*) that form the counterexample. If there are several solutions, you are allowed to print any of them. The numbers must be printed in ascending order. If the counterexample does not exist, print the single number -1.
[ "2 4\n", "10 11\n", "900000000000000009 900000000000000029\n" ]
[ "2 3 4\n", "-1\n", "900000000000000009 900000000000000010 900000000000000021\n" ]
In the first sample pair (2, 4) is not coprime and pairs (2, 3) and (3, 4) are. In the second sample you cannot form a group of three distinct integers, so the answer is -1. In the third sample it is easy to see that numbers 900000000000000009 and 900000000000000021 are divisible by three.
500
[ { "input": "2 4", "output": "2 3 4" }, { "input": "10 11", "output": "-1" }, { "input": "900000000000000009 900000000000000029", "output": "900000000000000009 900000000000000010 900000000000000021" }, { "input": "640097987171091791 640097987171091835", "output": "640097987171091792 640097987171091793 640097987171091794" }, { "input": "19534350415104721 19534350415104725", "output": "19534350415104722 19534350415104723 19534350415104724" }, { "input": "933700505788726243 933700505788726280", "output": "933700505788726244 933700505788726245 933700505788726246" }, { "input": "1 3", "output": "-1" }, { "input": "1 4", "output": "2 3 4" }, { "input": "1 1", "output": "-1" }, { "input": "266540997167959130 266540997167959164", "output": "266540997167959130 266540997167959131 266540997167959132" }, { "input": "267367244641009850 267367244641009899", "output": "267367244641009850 267367244641009851 267367244641009852" }, { "input": "268193483524125978 268193483524125993", "output": "268193483524125978 268193483524125979 268193483524125980" }, { "input": "269019726702209402 269019726702209432", "output": "269019726702209402 269019726702209403 269019726702209404" }, { "input": "269845965585325530 269845965585325576", "output": "269845965585325530 269845965585325531 269845965585325532" }, { "input": "270672213058376250 270672213058376260", "output": "270672213058376250 270672213058376251 270672213058376252" }, { "input": "271498451941492378 271498451941492378", "output": "-1" }, { "input": "272324690824608506 272324690824608523", "output": "272324690824608506 272324690824608507 272324690824608508" }, { "input": "273150934002691930 273150934002691962", "output": "273150934002691930 273150934002691931 273150934002691932" }, { "input": "996517375802030516 996517375802030524", "output": "996517375802030516 996517375802030517 996517375802030518" }, { "input": "997343614685146644 997343614685146694", "output": "997343614685146644 997343614685146645 997343614685146646" }, { "input": "998169857863230068 998169857863230083", "output": "998169857863230068 998169857863230069 998169857863230070" }, { "input": "998996101041313492 998996101041313522", "output": "998996101041313492 998996101041313493 998996101041313494" }, { "input": "999822344219396916 999822344219396961", "output": "999822344219396916 999822344219396917 999822344219396918" }, { "input": "648583102513043 648583102513053", "output": "648583102513044 648583102513045 648583102513046" }, { "input": "266540997167959130 266540997167959131", "output": "-1" }, { "input": "267367244641009850 267367244641009850", "output": "-1" }, { "input": "268193483524125978 268193483524125979", "output": "-1" }, { "input": "269019726702209402 269019726702209402", "output": "-1" }, { "input": "269845965585325530 269845965585325530", "output": "-1" }, { "input": "270672213058376250 270672213058376254", "output": "270672213058376250 270672213058376251 270672213058376252" }, { "input": "271498451941492378 271498451941492379", "output": "-1" }, { "input": "272324690824608506 272324690824608508", "output": "272324690824608506 272324690824608507 272324690824608508" }, { "input": "273150934002691930 273150934002691931", "output": "-1" }, { "input": "996517375802030516 996517375802030518", "output": "996517375802030516 996517375802030517 996517375802030518" }, { "input": "997343614685146644 997343614685146644", "output": "-1" }, { "input": "2147483647 2147483649", "output": "-1" }, { "input": "3 5", "output": "-1" }, { "input": "1 7", "output": "2 3 4" }, { "input": "9 12", "output": "9 11 12" }, { "input": "4 4", "output": "-1" }, { "input": "11 13", "output": "-1" }, { "input": "2 2", "output": "-1" } ]
1,624,281,464
2,147,483,647
Python 3
OK
TESTS
42
62
0
a, c = map(int, input().split(" ")) if a & 1 == 0: if a+1 >= c: print(-1) else: print(a, a+1, a+2) else: if a+2 >= c: print(-1) else: print(a+1, a+2, a+3)
Title: Counterexample Time Limit: None seconds Memory Limit: None megabytes Problem Description: Your friend has recently learned about coprime numbers. A pair of numbers {*a*,<=*b*} is called coprime if the maximum number that divides both *a* and *b* is equal to one. Your friend often comes up with different statements. He has recently supposed that if the pair (*a*,<=*b*) is coprime and the pair (*b*,<=*c*) is coprime, then the pair (*a*,<=*c*) is coprime. You want to find a counterexample for your friend's statement. Therefore, your task is to find three distinct numbers (*a*,<=*b*,<=*c*), for which the statement is false, and the numbers meet the condition *l*<=≤<=*a*<=&lt;<=*b*<=&lt;<=*c*<=≤<=*r*. More specifically, you need to find three numbers (*a*,<=*b*,<=*c*), such that *l*<=≤<=*a*<=&lt;<=*b*<=&lt;<=*c*<=≤<=*r*, pairs (*a*,<=*b*) and (*b*,<=*c*) are coprime, and pair (*a*,<=*c*) is not coprime. Input Specification: The single line contains two positive space-separated integers *l*, *r* (1<=≤<=*l*<=≤<=*r*<=≤<=1018; *r*<=-<=*l*<=≤<=50). Output Specification: Print three positive space-separated integers *a*, *b*, *c* — three distinct numbers (*a*,<=*b*,<=*c*) that form the counterexample. If there are several solutions, you are allowed to print any of them. The numbers must be printed in ascending order. If the counterexample does not exist, print the single number -1. Demo Input: ['2 4\n', '10 11\n', '900000000000000009 900000000000000029\n'] Demo Output: ['2 3 4\n', '-1\n', '900000000000000009 900000000000000010 900000000000000021\n'] Note: In the first sample pair (2, 4) is not coprime and pairs (2, 3) and (3, 4) are. In the second sample you cannot form a group of three distinct integers, so the answer is -1. In the third sample it is easy to see that numbers 900000000000000009 and 900000000000000021 are divisible by three.
```python a, c = map(int, input().split(" ")) if a & 1 == 0: if a+1 >= c: print(-1) else: print(a, a+1, a+2) else: if a+2 >= c: print(-1) else: print(a+1, a+2, a+3) ```
3
864
B
Polycarp and Letters
PROGRAMMING
1,000
[ "brute force", "implementation", "strings" ]
null
null
Polycarp loves lowercase letters and dislikes uppercase ones. Once he got a string *s* consisting only of lowercase and uppercase Latin letters. Let *A* be a set of positions in the string. Let's call it pretty if following conditions are met: - letters on positions from *A* in the string are all distinct and lowercase; - there are no uppercase letters in the string which are situated between positions from *A* (i.e. there is no such *j* that *s*[*j*] is an uppercase letter, and *a*1<=&lt;<=*j*<=&lt;<=*a*2 for some *a*1 and *a*2 from *A*). Write a program that will determine the maximum number of elements in a pretty set of positions.
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=200) — length of string *s*. The second line contains a string *s* consisting of lowercase and uppercase Latin letters.
Print maximum number of elements in pretty set of positions for string *s*.
[ "11\naaaaBaabAbA\n", "12\nzACaAbbaazzC\n", "3\nABC\n" ]
[ "2\n", "3\n", "0\n" ]
In the first example the desired positions might be 6 and 8 or 7 and 8. Positions 6 and 7 contain letters 'a', position 8 contains letter 'b'. The pair of positions 1 and 8 is not suitable because there is an uppercase letter 'B' between these position. In the second example desired positions can be 7, 8 and 11. There are other ways to choose pretty set consisting of three elements. In the third example the given string *s* does not contain any lowercase letters, so the answer is 0.
1,000
[ { "input": "11\naaaaBaabAbA", "output": "2" }, { "input": "12\nzACaAbbaazzC", "output": "3" }, { "input": "3\nABC", "output": "0" }, { "input": "1\na", "output": "1" }, { "input": "2\naz", "output": "2" }, { "input": "200\nXbTJZqcbpYuZQEoUrbxlPXAPCtVLrRExpQzxzqzcqsqzsiisswqitswzCtJQxOavicSdBIodideVRKHPojCNHmbnrLgwJlwOpyrJJIhrUePszxSjJGeUgTtOfewPQnPVWhZAtogRPrJLwyShNQaeNsvrJwjuuBOMPCeSckBMISQzGngfOmeyfDObncyeNsihYVtQbSEh", "output": "8" }, { "input": "2\nAZ", "output": "0" }, { "input": "28\nAabcBabcCBNMaaaaabbbbbcccccc", "output": "3" }, { "input": "200\nrsgraosldglhdoorwhkrsehjpuxrjuwgeanjgezhekprzarelduuaxdnspzjuooguuwnzkowkuhzduakdrzpnslauejhrrkalwpurpuuswdgeadlhjwzjgegwpknepazwwleulppwrlgrgedlwdzuodzropsrrkxusjnuzshdkjrxxpgzanzdrpnggdwxarpwohxdepJ", "output": "17" }, { "input": "1\nk", "output": "1" }, { "input": "1\nH", "output": "0" }, { "input": "2\nzG", "output": "1" }, { "input": "2\ngg", "output": "1" }, { "input": "2\nai", "output": "2" }, { "input": "20\npEjVrKWLIFCZjIHgggVU", "output": "1" }, { "input": "20\niFSiiigiYFSKmDnMGcgM", "output": "2" }, { "input": "20\nedxedxxxCQiIVmYEUtLi", "output": "3" }, { "input": "20\nprnchweyabjvzkoqiltm", "output": "20" }, { "input": "35\nQLDZNKFXKVSVLUVHRTDPQYMSTDXBELXBOTS", "output": "0" }, { "input": "35\nbvZWiitgxodztelnYUyljYGnCoWluXTvBLp", "output": "10" }, { "input": "35\nBTexnaeplecllxwlanarpcollawHLVMHIIF", "output": "10" }, { "input": "35\nhhwxqysolegsthsvfcqiryenbujbrrScobu", "output": "20" }, { "input": "26\npbgfqosklxjuzmdheyvawrictn", "output": "26" }, { "input": "100\nchMRWwymTDuZDZuSTvUmmuxvSscnTasyjlwwodhzcoifeahnbmcifyeobbydwparebduoLDCgHlOsPtVRbYGGQXfnkdvrWKIwCRl", "output": "20" }, { "input": "100\nhXYLXKUMBrGkjqQJTGbGWAfmztqqapdbjbhcualhypgnaieKXmhzGMnqXVlcPesskfaEVgvWQTTShRRnEtFahWDyuBzySMpugxCM", "output": "19" }, { "input": "100\nucOgELrgjMrFOgtHzqgvUgtHngKJxdMFKBjfcCppciqmGZXXoiSZibgpadshyljqrwxbomzeutvnhTLGVckZUmyiFPLlwuLBFito", "output": "23" }, { "input": "200\nWTCKAKLVGXSYFVMVJDUYERXNMVNTGWXUGRFCGMYXJQGLODYZTUIDENHYEGFKXFIEUILAMESAXAWZXVCZPJPEYUXBITHMTZOTMKWITGRSFHODKVJHPAHVVWTCTHIVAWAREQXWMPUWQSTPPJFHKGKELBTPUYDAVIUMGASPUEDIODRYXIWCORHOSLIBLOZUNJPHHMXEXOAY", "output": "0" }, { "input": "200\neLCCuYMPPwQoNlCpPOtKWJaQJmWfHeZCKiMSpILHSKjFOYGpRMzMCfMXdDuQdBGNsCNrHIVJzEFfBZcNMwNcFjOFVJvEtUQmLbFNKVHgNDyFkFVQhUTUQDgXhMjJZgFSSiHhMKuTgZQYJqAqKBpHoHddddddddddddddddXSSYNKNnRrKuOjAVKZlRLzCjExPdHaDHBT", "output": "1" }, { "input": "200\nitSYxgOLlwOoAkkkkkzzzzzzzzkzkzkzkkkkkzkzzkzUDJSKybRPBvaIDsNuWImPJvrHkKiMeYukWmtHtgZSyQsgYanZvXNbKXBlFLSUcqRnGWSriAvKxsTkDJfROqaKdzXhvJsPEDATueCraWOGEvRDWjPwXuiNpWsEnCuhDcKWOQxjBkdBqmFatWFkgKsbZuLtRGtY", "output": "2" }, { "input": "200\noggqoqqogoqoggggoggqgooqggogogooogqqgggoqgggqoqogogggogggqgooqgqggqqqoqgqgoooqgqogqoggoqqgqoqgoooqoogooqoogqoqoqqgoqgoqgggogqqqoqoggoqoqqoqggqoggooqqqoqggoggqqqqqqqqqgogqgggggooogogqgggqogqgoqoqogoooq", "output": "3" }, { "input": "200\nCtclUtUnmqFniaLqGRmMoUMeLyFfAgWxIZxdrBarcRQprSOGcdUYsmDbooSuOvBLgrYlgaIjJtFgcxJKHGkCXpYfVKmUbouuIqGstFrrwJzYQqjjqqppqqqqqpqqqjpjjpjqjXRYkfPhGAatOigFuItkKxkjCBLdiNMVGjmdWNMgOOvmaJEdGsWNoaERrINNKqKeQajv", "output": "3" }, { "input": "200\nmeZNrhqtSTSmktGQnnNOTcnyAMTKSixxKQKiagrMqRYBqgbRlsbJhvtNeHVUuMCyZLCnsIixRYrYEAkfQOxSVqXkrPqeCZQksInzRsRKBgvIqlGVPxPQnypknSXjgMjsjElcqGsaJRbegJVAKtWcHoOnzHqzhoKReqBBsOhZYLaYJhmqOMQsizdCsQfjUDHcTtHoeYwu", "output": "4" }, { "input": "200\nvFAYTHJLZaivWzSYmiuDBDUFACDSVbkImnVaXBpCgrbgmTfXKJfoglIkZxWPSeVSFPnHZDNUAqLyhjLXSuAqGLskBlDxjxGPJyGdwzlPfIekwsblIrkxzfhJeNoHywdfAGlJzqXOfQaKceSqViVFTRJEGfACnsFeSFpOYisIHJciqTMNAmgeXeublTvfWoPnddtvKIyF", "output": "6" }, { "input": "200\ngnDdkqJjYvduVYDSsswZDvoCouyaYZTfhmpSakERWLhufZtthWsfbQdTGwhKYjEcrqWBOyxBbiFhdLlIjChLOPiOpYmcrJgDtXsJfmHtLrabyGKOfHQRukEtTzwoqBHfmyVXPebfcpGQacLkGWFwerszjdHpTBXGssYXmGHlcCBgBXyGJqxbVhvDffLyCrZnxonABEXV", "output": "7" }, { "input": "200\nBmggKNRZBXPtJqlJaXLdKKQLDJvXpDuQGupiRQfDwCJCJvAlDDGpPZNOvXkrdKOFOEFBVfrsZjWyHPoKGzXmTAyPJGEmxCyCXpeAdTwbrMtWLmlmGNqxvuxmqpmtpuhrmxxtrquSLFYVlnSYgRJDYHWgHBbziBLZRwCIJNvbtsEdLLxmTbnjkoqSPAuzEeTYLlmejOUH", "output": "9" }, { "input": "200\nMkuxcDWdcnqsrlTsejehQKrTwoOBRCUAywqSnZkDLRmVBDVoOqdZHbrInQQyeRFAjiYYmHGrBbWgWstCPfLPRdNVDXBdqFJsGQfSXbufsiogybEhKDlWfPazIuhpONwGzZWaQNwVnmhTqWdewaklgjwaumXYDGwjSeEcYXjkVtLiYSWULEnTFukIlWQGWsXwWRMJGTcI", "output": "10" }, { "input": "200\nOgMBgYeuMJdjPtLybvwmGDrQEOhliaabEtwulzNEjsfnaznXUMoBbbxkLEwSQzcLrlJdjJCLGVNBxorghPxTYCoqniySJMcilpsqpBAbqdzqRUDVaYOgqGhGrxlIJkyYgkOdTUgRZwpgIkeZFXojLXpDilzirHVVadiHaMrxhzodzpdvhvrzdzxbhmhdpxqqpoDegfFQ", "output": "11" }, { "input": "200\nOLaJOtwultZLiZPSYAVGIbYvbIuZkqFZXwfsqpsavCDmBMStAuUFLBVknWDXNzmiuUYIsUMGxtoadWlPYPqvqSvpYdOiJRxFzGGnnmstniltvitnrmyrblnqyruylummmlsqtqitlbulvtuitiqimuintbimqyurviuntqnnvslynlNYMpYVKYwKVTbIUVdlNGrcFZON", "output": "12" }, { "input": "200\nGAcmlaqfjSAQLvXlkhxujXgSbxdFAwnoxDuldDvYmpUhTWJdcEQSdARLrozJzIgFVCkzPUztWIpaGfiKeqzoXinEjVuoKqyBHmtFjBWcRdBmyjviNlGAIkpikjAimmBgayfphrstfbjexjbttzfzfzaysxfyrjazfhtpghnbbeffjhxrjxpttesgzrnrfbgzzsRsCgmz", "output": "15" }, { "input": "200\nYRvIopNqSTYDhViTqCLMwEbTTIdHkoeuBmAJWhgtOgVxlcHSsavDNzMfpwTghkBvYEtCYQxicLUxdgAcaCzOOgbQYsfnaTXFlFxbeEiGwdNvxwHzkTdKtWlqzalwniDDBDipkxfflpaqkfkgfezbkxdvzemlfohwtgytzzywmwhvzUgPlPdeAVqTPAUZbogQheRXetvT", "output": "20" }, { "input": "200\nNcYVomemswLCUqVRSDKHCknlBmqeSWhVyRzQrnZaOANnTGqsRFMjpczllcEVebqpxdavzppvztxsnfmtcharzqlginndyjkawzurqkxJLXiXKNZTIIxhSQghDpjwzatEqnLMTLxwoEKpHytvWkKFDUcZjLShCiVdocxRvvJtbXHCDGpJvMwRKWLhcTFtswdLUHkbhfau", "output": "25" }, { "input": "200\nDxNZuvkTkQEqdWIkLzcKAwfqvZQiptnTazydSCTIfGjDhLMrlPZiKEsqIdDhgKPAlEvXyzNwWtYorotgkcwydpabjqnzubaksdchucxtkmjzfretdmvlxgklyvicrtftvztsbiUaQorfNIYUOdwQDRsKpxLUiLknbLbinilpPXPTTwLAnXVpMHBaAcKWgDBeOFabPtXU", "output": "26" }, { "input": "4\nabbc", "output": "3" }, { "input": "3\naaa", "output": "1" }, { "input": "3\naba", "output": "2" }, { "input": "3\nabb", "output": "2" }, { "input": "3\nbba", "output": "2" }, { "input": "3\nAaa", "output": "1" }, { "input": "3\nAba", "output": "2" }, { "input": "3\naBa", "output": "1" }, { "input": "3\naAa", "output": "1" }, { "input": "3\naAb", "output": "1" }, { "input": "3\nAaA", "output": "1" }, { "input": "5\naBacd", "output": "3" }, { "input": "5\naAabc", "output": "3" } ]
1,521,486,387
2,147,483,647
Python 3
OK
TESTS
55
93
7,065,600
IL = lambda: list(map(int, input().split())) IS = lambda: input().split() I = lambda: int(input()) S = lambda: input() n = I() s = S() for l in "QWERTYUIOPASDFGHJKLZXCVBNM": s = s.replace(l, '#') print(max([len(set(i)) for i in s.split('#')]))
Title: Polycarp and Letters Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarp loves lowercase letters and dislikes uppercase ones. Once he got a string *s* consisting only of lowercase and uppercase Latin letters. Let *A* be a set of positions in the string. Let's call it pretty if following conditions are met: - letters on positions from *A* in the string are all distinct and lowercase; - there are no uppercase letters in the string which are situated between positions from *A* (i.e. there is no such *j* that *s*[*j*] is an uppercase letter, and *a*1<=&lt;<=*j*<=&lt;<=*a*2 for some *a*1 and *a*2 from *A*). Write a program that will determine the maximum number of elements in a pretty set of positions. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=200) — length of string *s*. The second line contains a string *s* consisting of lowercase and uppercase Latin letters. Output Specification: Print maximum number of elements in pretty set of positions for string *s*. Demo Input: ['11\naaaaBaabAbA\n', '12\nzACaAbbaazzC\n', '3\nABC\n'] Demo Output: ['2\n', '3\n', '0\n'] Note: In the first example the desired positions might be 6 and 8 or 7 and 8. Positions 6 and 7 contain letters 'a', position 8 contains letter 'b'. The pair of positions 1 and 8 is not suitable because there is an uppercase letter 'B' between these position. In the second example desired positions can be 7, 8 and 11. There are other ways to choose pretty set consisting of three elements. In the third example the given string *s* does not contain any lowercase letters, so the answer is 0.
```python IL = lambda: list(map(int, input().split())) IS = lambda: input().split() I = lambda: int(input()) S = lambda: input() n = I() s = S() for l in "QWERTYUIOPASDFGHJKLZXCVBNM": s = s.replace(l, '#') print(max([len(set(i)) for i in s.split('#')])) ```
3
1,011
B
Planning The Expedition
PROGRAMMING
1,200
[ "binary search", "brute force", "implementation" ]
null
null
Natasha is planning an expedition to Mars for $n$ people. One of the important tasks is to provide food for each participant. The warehouse has $m$ daily food packages. Each package has some food type $a_i$. Each participant must eat exactly one food package each day. Due to extreme loads, each participant must eat the same food type throughout the expedition. Different participants may eat different (or the same) types of food. Formally, for each participant $j$ Natasha should select his food type $b_j$ and each day $j$-th participant will eat one food package of type $b_j$. The values $b_j$ for different participants may be different. What is the maximum possible number of days the expedition can last, following the requirements above?
The first line contains two integers $n$ and $m$ ($1 \le n \le 100$, $1 \le m \le 100$) — the number of the expedition participants and the number of the daily food packages available. The second line contains sequence of integers $a_1, a_2, \dots, a_m$ ($1 \le a_i \le 100$), where $a_i$ is the type of $i$-th food package.
Print the single integer — the number of days the expedition can last. If it is not possible to plan the expedition for even one day, print 0.
[ "4 10\n1 5 2 1 1 1 2 5 7 2\n", "100 1\n1\n", "2 5\n5 4 3 2 1\n", "3 9\n42 42 42 42 42 42 42 42 42\n" ]
[ "2\n", "0\n", "1\n", "3\n" ]
In the first example, Natasha can assign type $1$ food to the first participant, the same type $1$ to the second, type $5$ to the third and type $2$ to the fourth. In this case, the expedition can last for $2$ days, since each participant can get two food packages of his food type (there will be used $4$ packages of type $1$, two packages of type $2$ and two packages of type $5$). In the second example, there are $100$ participants and only $1$ food package. In this case, the expedition can't last even $1$ day.
1,000
[ { "input": "4 10\n1 5 2 1 1 1 2 5 7 2", "output": "2" }, { "input": "100 1\n1", "output": "0" }, { "input": "2 5\n5 4 3 2 1", "output": "1" }, { "input": "3 9\n42 42 42 42 42 42 42 42 42", "output": "3" }, { "input": "1 1\n100", "output": "1" }, { "input": "4 100\n84 99 66 69 86 94 89 96 98 93 93 82 87 93 91 100 69 99 93 81 99 84 75 100 86 88 98 100 84 96 44 70 94 91 85 78 86 79 45 88 91 78 98 94 81 87 93 72 96 88 96 97 96 62 86 72 94 84 80 98 88 90 93 73 73 98 78 50 91 96 97 82 85 90 87 41 97 82 97 77 100 100 92 83 98 81 70 81 74 78 84 79 98 98 55 99 97 99 79 98", "output": "5" }, { "input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1" }, { "input": "1 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "100" }, { "input": "6 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "15" }, { "input": "1 1\n59", "output": "1" }, { "input": "1 50\n39 1 46 21 23 28 100 32 63 63 18 15 40 29 34 49 56 74 47 42 96 97 59 62 76 62 69 61 36 21 66 18 92 58 63 85 5 6 77 75 91 66 38 10 66 43 20 74 37 83", "output": "3" }, { "input": "1 100\n83 72 21 55 49 5 61 60 87 21 89 88 3 75 49 81 36 25 50 61 96 19 36 55 48 8 97 69 50 24 23 39 26 25 41 90 69 20 19 62 38 52 60 6 66 31 9 45 36 12 69 94 22 60 91 65 35 58 13 85 33 87 83 11 95 20 20 85 13 21 57 69 17 94 78 37 59 45 60 7 64 51 60 89 91 22 6 58 95 96 51 53 89 22 28 16 27 56 1 54", "output": "5" }, { "input": "50 1\n75", "output": "0" }, { "input": "50 50\n85 20 12 73 52 78 70 95 88 43 31 88 81 41 80 99 16 11 97 11 21 44 2 34 47 38 87 2 32 47 97 93 52 14 35 37 97 48 58 19 52 55 97 72 17 25 16 85 90 58", "output": "1" }, { "input": "50 100\n2 37 74 32 99 75 73 86 67 33 62 30 15 21 51 41 73 75 67 39 90 10 56 74 72 26 38 65 75 55 46 99 34 49 92 82 11 100 15 71 75 12 22 56 47 74 20 98 59 65 14 76 1 40 89 36 43 93 83 73 75 100 50 95 27 10 72 51 25 69 15 3 57 60 84 99 31 44 12 61 69 95 51 31 28 36 57 35 31 52 44 19 79 12 27 27 7 81 68 1", "output": "1" }, { "input": "100 1\n26", "output": "0" }, { "input": "100 50\n8 82 62 11 85 57 5 32 99 92 77 2 61 86 8 88 10 28 83 4 68 79 8 64 56 98 4 88 22 54 30 60 62 79 72 38 17 28 32 16 62 26 56 44 72 33 22 84 77 45", "output": "0" }, { "input": "100 100\n13 88 64 65 78 10 61 97 16 32 76 9 60 1 40 35 90 61 60 85 26 16 38 36 33 95 24 55 82 88 13 9 47 34 94 2 90 74 11 81 46 70 94 11 55 32 19 36 97 16 17 35 38 82 89 16 74 94 97 79 9 94 88 12 28 2 4 25 72 95 49 31 88 82 6 77 70 98 90 57 57 33 38 61 26 75 2 66 22 44 13 35 16 4 33 16 12 66 32 86", "output": "1" }, { "input": "34 64\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1" }, { "input": "53 98\n1 1 2 2 2 2 2 1 2 2 2 1 1 2 2 2 1 1 2 1 1 2 2 1 1 2 1 1 1 2 1 2 1 1 1 2 2 1 2 1 1 1 2 2 1 2 1 1 2 1 2 2 1 2 2 2 2 2 2 2 2 2 1 1 2 2 1 2 1 2 1 2 1 1 2 2 2 1 1 2 1 2 1 1 1 1 2 2 2 2 2 1 1 2 2 2 1 1", "output": "1" }, { "input": "17 8\n2 5 3 4 3 2 2 2", "output": "0" }, { "input": "24 77\n8 6 10 4 6 6 4 10 9 7 7 5 5 4 6 7 10 6 3 4 6 6 4 9 4 6 2 5 3 4 4 1 4 6 6 8 1 1 6 4 6 2 5 7 7 2 4 4 10 1 10 9 2 3 8 1 10 4 3 9 3 8 3 5 6 3 4 9 5 3 4 1 1 6 1 2 1", "output": "2" }, { "input": "65 74\n7 19 2 38 28 44 34 49 14 13 30 22 11 4 4 12 8 1 40 8 34 31 44 38 21 35 13 7 19 32 37 5 36 26 7 2 15 11 47 45 48 2 49 10 10 42 42 31 50 24 29 34 31 38 39 48 43 47 32 46 10 1 33 21 12 50 13 44 38 11 41 41 10 7", "output": "1" }, { "input": "37 71\n50 93 15 80 82 23 35 90 70 73 55 23 23 6 86 63 38 70 38 52 88 34 25 75 32 19 6 98 31 38 21 8 66 8 59 71 7 80 69 23 17 70 6 40 72 5 48 59 18 1 48 91 17 41 11 27 53 95 87 31 62 94 94 60 38 99 70 50 81 86 44", "output": "1" }, { "input": "35 4\n100 100 100 100", "output": "0" }, { "input": "68 12\n100 100 100 99 99 100 100 100 99 99 99 99", "output": "0" }, { "input": "91 33\n97 100 96 96 97 100 97 97 96 96 99 99 98 97 97 99 99 98 100 96 96 99 100 96 97 100 97 97 99 98 96 98 97", "output": "0" }, { "input": "59 72\n99 96 96 93 94 97 93 96 100 99 93 99 96 92 92 97 93 100 92 100 91 96 99 100 97 98 93 93 96 100 97 99 100 100 91 93 96 91 93 100 95 96 92 97 91 91 99 100 91 95 95 100 92 93 98 93 95 92 95 100 91 95 99 95 92 91 100 93 98 98 96 99", "output": "1" }, { "input": "9 35\n95 54 78 94 56 63 68 73 61 85 73 62 61 94 67 91 66 54 89 69 92 60 91 87 63 62 85 70 62 68 97 88 96 55 62", "output": "2" }, { "input": "99 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1" }, { "input": "1 50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "50" } ]
1,696,055,970
2,147,483,647
Python 3
OK
TESTS
31
46
0
# LUOGU_RID: 126684742 a,b=map(int,input().split());b=input().split();c={} for i in b: if i in c:c[i]+=1 else:c[i]=1 b=1 while 1: if sum(c[j]//b for j in c)<a:print(b-1);break b+=1
Title: Planning The Expedition Time Limit: None seconds Memory Limit: None megabytes Problem Description: Natasha is planning an expedition to Mars for $n$ people. One of the important tasks is to provide food for each participant. The warehouse has $m$ daily food packages. Each package has some food type $a_i$. Each participant must eat exactly one food package each day. Due to extreme loads, each participant must eat the same food type throughout the expedition. Different participants may eat different (or the same) types of food. Formally, for each participant $j$ Natasha should select his food type $b_j$ and each day $j$-th participant will eat one food package of type $b_j$. The values $b_j$ for different participants may be different. What is the maximum possible number of days the expedition can last, following the requirements above? Input Specification: The first line contains two integers $n$ and $m$ ($1 \le n \le 100$, $1 \le m \le 100$) — the number of the expedition participants and the number of the daily food packages available. The second line contains sequence of integers $a_1, a_2, \dots, a_m$ ($1 \le a_i \le 100$), where $a_i$ is the type of $i$-th food package. Output Specification: Print the single integer — the number of days the expedition can last. If it is not possible to plan the expedition for even one day, print 0. Demo Input: ['4 10\n1 5 2 1 1 1 2 5 7 2\n', '100 1\n1\n', '2 5\n5 4 3 2 1\n', '3 9\n42 42 42 42 42 42 42 42 42\n'] Demo Output: ['2\n', '0\n', '1\n', '3\n'] Note: In the first example, Natasha can assign type $1$ food to the first participant, the same type $1$ to the second, type $5$ to the third and type $2$ to the fourth. In this case, the expedition can last for $2$ days, since each participant can get two food packages of his food type (there will be used $4$ packages of type $1$, two packages of type $2$ and two packages of type $5$). In the second example, there are $100$ participants and only $1$ food package. In this case, the expedition can't last even $1$ day.
```python # LUOGU_RID: 126684742 a,b=map(int,input().split());b=input().split();c={} for i in b: if i in c:c[i]+=1 else:c[i]=1 b=1 while 1: if sum(c[j]//b for j in c)<a:print(b-1);break b+=1 ```
3
617
A
Elephant
PROGRAMMING
800
[ "math" ]
null
null
An elephant decided to visit his friend. It turned out that the elephant's house is located at point 0 and his friend's house is located at point *x*(*x*<=&gt;<=0) of the coordinate line. In one step the elephant can move 1, 2, 3, 4 or 5 positions forward. Determine, what is the minimum number of steps he need to make in order to get to his friend's house.
The first line of the input contains an integer *x* (1<=≤<=*x*<=≤<=1<=000<=000) — The coordinate of the friend's house.
Print the minimum number of steps that elephant needs to make to get from point 0 to point *x*.
[ "5\n", "12\n" ]
[ "1\n", "3\n" ]
In the first sample the elephant needs to make one step of length 5 to reach the point *x*. In the second sample the elephant can get to point *x* if he moves by 3, 5 and 4. There are other ways to get the optimal answer but the elephant cannot reach *x* in less than three moves.
500
[ { "input": "5", "output": "1" }, { "input": "12", "output": "3" }, { "input": "999999", "output": "200000" }, { "input": "41", "output": "9" }, { "input": "1000000", "output": "200000" }, { "input": "1", "output": "1" }, { "input": "2", "output": "1" }, { "input": "3", "output": "1" }, { "input": "4", "output": "1" }, { "input": "534204", "output": "106841" }, { "input": "469569", "output": "93914" }, { "input": "502877", "output": "100576" }, { "input": "942212", "output": "188443" }, { "input": "97", "output": "20" }, { "input": "53", "output": "11" }, { "input": "89", "output": "18" }, { "input": "574", "output": "115" }, { "input": "716", "output": "144" }, { "input": "729", "output": "146" }, { "input": "8901", "output": "1781" }, { "input": "3645", "output": "729" }, { "input": "4426", "output": "886" }, { "input": "46573", "output": "9315" }, { "input": "86380", "output": "17276" }, { "input": "94190", "output": "18838" }, { "input": "999990", "output": "199998" }, { "input": "999991", "output": "199999" }, { "input": "999992", "output": "199999" }, { "input": "999993", "output": "199999" }, { "input": "999994", "output": "199999" }, { "input": "999995", "output": "199999" }, { "input": "999996", "output": "200000" }, { "input": "999997", "output": "200000" }, { "input": "999998", "output": "200000" } ]
1,696,009,912
2,147,483,647
Python 3
OK
TESTS
34
46
0
import math n = int(input()) print(int(math.ceil(n/5)))
Title: Elephant Time Limit: None seconds Memory Limit: None megabytes Problem Description: An elephant decided to visit his friend. It turned out that the elephant's house is located at point 0 and his friend's house is located at point *x*(*x*<=&gt;<=0) of the coordinate line. In one step the elephant can move 1, 2, 3, 4 or 5 positions forward. Determine, what is the minimum number of steps he need to make in order to get to his friend's house. Input Specification: The first line of the input contains an integer *x* (1<=≤<=*x*<=≤<=1<=000<=000) — The coordinate of the friend's house. Output Specification: Print the minimum number of steps that elephant needs to make to get from point 0 to point *x*. Demo Input: ['5\n', '12\n'] Demo Output: ['1\n', '3\n'] Note: In the first sample the elephant needs to make one step of length 5 to reach the point *x*. In the second sample the elephant can get to point *x* if he moves by 3, 5 and 4. There are other ways to get the optimal answer but the elephant cannot reach *x* in less than three moves.
```python import math n = int(input()) print(int(math.ceil(n/5))) ```
3
1,011
A
Stages
PROGRAMMING
900
[ "greedy", "implementation", "sortings" ]
null
null
Natasha is going to fly to Mars. She needs to build a rocket, which consists of several stages in some order. Each of the stages is defined by a lowercase Latin letter. This way, the rocket can be described by the string — concatenation of letters, which correspond to the stages. There are $n$ stages available. The rocket must contain exactly $k$ of them. Stages in the rocket should be ordered by their weight. So, after the stage with some letter can go only stage with a letter, which is at least two positions after in the alphabet (skipping one letter in between, or even more). For example, after letter 'c' can't go letters 'a', 'b', 'c' and 'd', but can go letters 'e', 'f', ..., 'z'. For the rocket to fly as far as possible, its weight should be minimal. The weight of the rocket is equal to the sum of the weights of its stages. The weight of the stage is the number of its letter in the alphabet. For example, the stage 'a 'weighs one ton,' b 'weighs two tons, and' z' — $26$ tons. Build the rocket with the minimal weight or determine, that it is impossible to build a rocket at all. Each stage can be used at most once.
The first line of input contains two integers — $n$ and $k$ ($1 \le k \le n \le 50$) – the number of available stages and the number of stages to use in the rocket. The second line contains string $s$, which consists of exactly $n$ lowercase Latin letters. Each letter defines a new stage, which can be used to build the rocket. Each stage can be used at most once.
Print a single integer — the minimal total weight of the rocket or -1, if it is impossible to build the rocket at all.
[ "5 3\nxyabd\n", "7 4\nproblem\n", "2 2\nab\n", "12 1\nabaabbaaabbb\n" ]
[ "29", "34", "-1", "1" ]
In the first example, the following rockets satisfy the condition: - "adx" (weight is $1+4+24=29$);- "ady" (weight is $1+4+25=30$);- "bdx" (weight is $2+4+24=30$);- "bdy" (weight is $2+4+25=31$). Rocket "adx" has the minimal weight, so the answer is $29$. In the second example, target rocket is "belo". Its weight is $2+5+12+15=34$. In the third example, $n=k=2$, so the rocket must have both stages: 'a' and 'b'. This rocket doesn't satisfy the condition, because these letters are adjacent in the alphabet. Answer is -1.
500
[ { "input": "5 3\nxyabd", "output": "29" }, { "input": "7 4\nproblem", "output": "34" }, { "input": "2 2\nab", "output": "-1" }, { "input": "12 1\nabaabbaaabbb", "output": "1" }, { "input": "50 13\nqwertyuiopasdfghjklzxcvbnmaaaaaaaaaaaaaaaaaaaaaaaa", "output": "169" }, { "input": "50 14\nqwertyuiopasdfghjklzxcvbnmaaaaaaaaaaaaaaaaaaaaaaaa", "output": "-1" }, { "input": "1 1\na", "output": "1" }, { "input": "50 1\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "1" }, { "input": "50 2\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "-1" }, { "input": "13 13\nuwgmkyqeiaocs", "output": "169" }, { "input": "13 13\nhzdxpbfvrltnj", "output": "182" }, { "input": "1 1\nn", "output": "14" }, { "input": "10 8\nsmzeblyjqw", "output": "113" }, { "input": "20 20\ntzmvhskkyugkuuxpvtbh", "output": "-1" }, { "input": "30 15\nwjzolzzkfulwgioksfxmcxmnnjtoav", "output": "-1" }, { "input": "40 30\nxumfrflllrrgswehqtsskefixhcxjrxbjmrpsshv", "output": "-1" }, { "input": "50 31\nahbyyoxltryqdmvenemaqnbakglgqolxnaifnqtoclnnqiabpz", "output": "-1" }, { "input": "10 7\niuiukrxcml", "output": "99" }, { "input": "38 2\nvjzarfykmrsrvwbwfwldsulhxtykmjbnwmdufa", "output": "5" }, { "input": "12 6\nfwseyrarkwcd", "output": "61" }, { "input": "2 2\nac", "output": "4" }, { "input": "1 1\nc", "output": "3" }, { "input": "2 2\nad", "output": "5" }, { "input": "2 1\nac", "output": "1" }, { "input": "4 3\nadjz", "output": "15" }, { "input": "3 3\naoz", "output": "42" }, { "input": "3 1\nzzz", "output": "26" }, { "input": "2 1\nxz", "output": "24" }, { "input": "5 1\naaddd", "output": "1" } ]
1,564,940,744
2,147,483,647
Python 3
OK
TESTS
29
124
0
n,k=map(int,input().split()) s=list(map(ord,sorted(input()))) last=0 total=0 i=0 while i<n: if s[i]>last+1: total += s[i]-96 last = s[i] k -= 1 if k==0: break i+=1 if i<n: print(total) else: print(-1)
Title: Stages Time Limit: None seconds Memory Limit: None megabytes Problem Description: Natasha is going to fly to Mars. She needs to build a rocket, which consists of several stages in some order. Each of the stages is defined by a lowercase Latin letter. This way, the rocket can be described by the string — concatenation of letters, which correspond to the stages. There are $n$ stages available. The rocket must contain exactly $k$ of them. Stages in the rocket should be ordered by their weight. So, after the stage with some letter can go only stage with a letter, which is at least two positions after in the alphabet (skipping one letter in between, or even more). For example, after letter 'c' can't go letters 'a', 'b', 'c' and 'd', but can go letters 'e', 'f', ..., 'z'. For the rocket to fly as far as possible, its weight should be minimal. The weight of the rocket is equal to the sum of the weights of its stages. The weight of the stage is the number of its letter in the alphabet. For example, the stage 'a 'weighs one ton,' b 'weighs two tons, and' z' — $26$ tons. Build the rocket with the minimal weight or determine, that it is impossible to build a rocket at all. Each stage can be used at most once. Input Specification: The first line of input contains two integers — $n$ and $k$ ($1 \le k \le n \le 50$) – the number of available stages and the number of stages to use in the rocket. The second line contains string $s$, which consists of exactly $n$ lowercase Latin letters. Each letter defines a new stage, which can be used to build the rocket. Each stage can be used at most once. Output Specification: Print a single integer — the minimal total weight of the rocket or -1, if it is impossible to build the rocket at all. Demo Input: ['5 3\nxyabd\n', '7 4\nproblem\n', '2 2\nab\n', '12 1\nabaabbaaabbb\n'] Demo Output: ['29', '34', '-1', '1'] Note: In the first example, the following rockets satisfy the condition: - "adx" (weight is $1+4+24=29$);- "ady" (weight is $1+4+25=30$);- "bdx" (weight is $2+4+24=30$);- "bdy" (weight is $2+4+25=31$). Rocket "adx" has the minimal weight, so the answer is $29$. In the second example, target rocket is "belo". Its weight is $2+5+12+15=34$. In the third example, $n=k=2$, so the rocket must have both stages: 'a' and 'b'. This rocket doesn't satisfy the condition, because these letters are adjacent in the alphabet. Answer is -1.
```python n,k=map(int,input().split()) s=list(map(ord,sorted(input()))) last=0 total=0 i=0 while i<n: if s[i]>last+1: total += s[i]-96 last = s[i] k -= 1 if k==0: break i+=1 if i<n: print(total) else: print(-1) ```
3
858
A
k-rounding
PROGRAMMING
1,100
[ "brute force", "math", "number theory" ]
null
null
For a given positive integer *n* denote its *k*-rounding as the minimum positive integer *x*, such that *x* ends with *k* or more zeros in base 10 and is divisible by *n*. For example, 4-rounding of 375 is 375·80<==<=30000. 30000 is the minimum integer such that it ends with 4 or more zeros and is divisible by 375. Write a program that will perform the *k*-rounding of *n*.
The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=109, 0<=≤<=*k*<=≤<=8).
Print the *k*-rounding of *n*.
[ "375 4\n", "10000 1\n", "38101 0\n", "123456789 8\n" ]
[ "30000\n", "10000\n", "38101\n", "12345678900000000\n" ]
none
750
[ { "input": "375 4", "output": "30000" }, { "input": "10000 1", "output": "10000" }, { "input": "38101 0", "output": "38101" }, { "input": "123456789 8", "output": "12345678900000000" }, { "input": "1 0", "output": "1" }, { "input": "2 0", "output": "2" }, { "input": "100 0", "output": "100" }, { "input": "1000000000 0", "output": "1000000000" }, { "input": "160 2", "output": "800" }, { "input": "3 0", "output": "3" }, { "input": "10 0", "output": "10" }, { "input": "1 1", "output": "10" }, { "input": "2 1", "output": "10" }, { "input": "3 1", "output": "30" }, { "input": "4 1", "output": "20" }, { "input": "5 1", "output": "10" }, { "input": "6 1", "output": "30" }, { "input": "7 1", "output": "70" }, { "input": "8 1", "output": "40" }, { "input": "9 1", "output": "90" }, { "input": "10 1", "output": "10" }, { "input": "11 1", "output": "110" }, { "input": "12 1", "output": "60" }, { "input": "16 2", "output": "400" }, { "input": "2 2", "output": "100" }, { "input": "1 2", "output": "100" }, { "input": "5 2", "output": "100" }, { "input": "15 2", "output": "300" }, { "input": "36 2", "output": "900" }, { "input": "1 8", "output": "100000000" }, { "input": "8 8", "output": "100000000" }, { "input": "96 8", "output": "300000000" }, { "input": "175 8", "output": "700000000" }, { "input": "9999995 8", "output": "199999900000000" }, { "input": "999999999 8", "output": "99999999900000000" }, { "input": "12345678 8", "output": "617283900000000" }, { "input": "78125 8", "output": "100000000" }, { "input": "390625 8", "output": "100000000" }, { "input": "1953125 8", "output": "500000000" }, { "input": "9765625 8", "output": "2500000000" }, { "input": "68359375 8", "output": "17500000000" }, { "input": "268435456 8", "output": "104857600000000" }, { "input": "125829120 8", "output": "9830400000000" }, { "input": "128000 8", "output": "400000000" }, { "input": "300000 8", "output": "300000000" }, { "input": "3711871 8", "output": "371187100000000" }, { "input": "55555 8", "output": "1111100000000" }, { "input": "222222222 8", "output": "11111111100000000" }, { "input": "479001600 8", "output": "7484400000000" }, { "input": "655360001 7", "output": "6553600010000000" }, { "input": "655360001 8", "output": "65536000100000000" }, { "input": "1000000000 1", "output": "1000000000" }, { "input": "1000000000 7", "output": "1000000000" }, { "input": "1000000000 8", "output": "1000000000" }, { "input": "100000000 8", "output": "100000000" }, { "input": "10000000 8", "output": "100000000" }, { "input": "1000000 8", "output": "100000000" }, { "input": "10000009 8", "output": "1000000900000000" }, { "input": "10000005 8", "output": "200000100000000" }, { "input": "10000002 8", "output": "500000100000000" }, { "input": "999999997 8", "output": "99999999700000000" }, { "input": "999999997 7", "output": "9999999970000000" }, { "input": "999999995 8", "output": "19999999900000000" }, { "input": "123 8", "output": "12300000000" }, { "input": "24 2", "output": "600" }, { "input": "16 4", "output": "10000" }, { "input": "123456787 8", "output": "12345678700000000" }, { "input": "100000000 8", "output": "100000000" }, { "input": "7 1", "output": "70" }, { "input": "101 1", "output": "1010" }, { "input": "50 2", "output": "100" }, { "input": "999999818 1", "output": "4999999090" }, { "input": "2 1", "output": "10" }, { "input": "123 1", "output": "1230" }, { "input": "16 1", "output": "80" }, { "input": "1 1", "output": "10" }, { "input": "1000000000 8", "output": "1000000000" }, { "input": "15304 6", "output": "1913000000" }, { "input": "3 8", "output": "300000000" }, { "input": "4 2", "output": "100" }, { "input": "100000 7", "output": "10000000" }, { "input": "5 8", "output": "100000000" }, { "input": "16724 6", "output": "4181000000" }, { "input": "999999999 1", "output": "9999999990" }, { "input": "999999990 8", "output": "9999999900000000" }, { "input": "999999999 8", "output": "99999999900000000" }, { "input": "100000 1", "output": "100000" }, { "input": "8 3", "output": "1000" }, { "input": "16768 6", "output": "262000000" }, { "input": "123456789 1", "output": "1234567890" }, { "input": "2 8", "output": "100000000" }, { "input": "999999937 8", "output": "99999993700000000" }, { "input": "5 1", "output": "10" }, { "input": "2000000 7", "output": "10000000" }, { "input": "1999998 2", "output": "99999900" }, { "input": "125 3", "output": "1000" } ]
1,615,269,152
2,147,483,647
Python 3
OK
TESTS
96
62
0
import math a,b=input().split() a=int(a) b=int(b) ab=1 for i in range(b): ab=ab*10 print((ab//math.gcd(ab,a))*a)
Title: k-rounding Time Limit: None seconds Memory Limit: None megabytes Problem Description: For a given positive integer *n* denote its *k*-rounding as the minimum positive integer *x*, such that *x* ends with *k* or more zeros in base 10 and is divisible by *n*. For example, 4-rounding of 375 is 375·80<==<=30000. 30000 is the minimum integer such that it ends with 4 or more zeros and is divisible by 375. Write a program that will perform the *k*-rounding of *n*. Input Specification: The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=109, 0<=≤<=*k*<=≤<=8). Output Specification: Print the *k*-rounding of *n*. Demo Input: ['375 4\n', '10000 1\n', '38101 0\n', '123456789 8\n'] Demo Output: ['30000\n', '10000\n', '38101\n', '12345678900000000\n'] Note: none
```python import math a,b=input().split() a=int(a) b=int(b) ab=1 for i in range(b): ab=ab*10 print((ab//math.gcd(ab,a))*a) ```
3
215
A
Bicycle Chain
PROGRAMMING
900
[ "brute force", "implementation" ]
null
null
Vasya's bicycle chain drive consists of two parts: *n* stars are attached to the pedal axle, *m* stars are attached to the rear wheel axle. The chain helps to rotate the rear wheel by transmitting the pedal rotation. We know that the *i*-th star on the pedal axle has *a**i* (0<=&lt;<=*a*1<=&lt;<=*a*2<=&lt;<=...<=&lt;<=*a**n*) teeth, and the *j*-th star on the rear wheel axle has *b**j* (0<=&lt;<=*b*1<=&lt;<=*b*2<=&lt;<=...<=&lt;<=*b**m*) teeth. Any pair (*i*,<=*j*) (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*) is called a gear and sets the indexes of stars to which the chain is currently attached. Gear (*i*,<=*j*) has a gear ratio, equal to the value . Since Vasya likes integers, he wants to find such gears (*i*,<=*j*), that their ratios are integers. On the other hand, Vasya likes fast driving, so among all "integer" gears (*i*,<=*j*) he wants to choose a gear with the maximum ratio. Help him to find the number of such gears. In the problem, fraction denotes division in real numbers, that is, no rounding is performed.
The first input line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stars on the bicycle's pedal axle. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) in the order of strict increasing. The third input line contains integer *m* (1<=≤<=*m*<=≤<=50) — the number of stars on the rear wheel axle. The fourth line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=104) in the order of strict increasing. It is guaranteed that there exists at least one gear (*i*,<=*j*), that its gear ratio is an integer. The numbers on the lines are separated by spaces.
Print the number of "integer" gears with the maximum ratio among all "integer" gears.
[ "2\n4 5\n3\n12 13 15\n", "4\n1 2 3 4\n5\n10 11 12 13 14\n" ]
[ "2\n", "1\n" ]
In the first sample the maximum "integer" gear ratio equals 3. There are two gears that have such gear ratio. For one of them *a*<sub class="lower-index">1</sub> = 4, *b*<sub class="lower-index">1</sub> = 12, and for the other *a*<sub class="lower-index">2</sub> = 5, *b*<sub class="lower-index">3</sub> = 15.
500
[ { "input": "2\n4 5\n3\n12 13 15", "output": "2" }, { "input": "4\n1 2 3 4\n5\n10 11 12 13 14", "output": "1" }, { "input": "1\n1\n1\n1", "output": "1" }, { "input": "2\n1 2\n1\n1", "output": "1" }, { "input": "1\n1\n2\n1 2", "output": "1" }, { "input": "4\n3 7 11 13\n4\n51 119 187 221", "output": "4" }, { "input": "4\n2 3 4 5\n3\n1 2 3", "output": "2" }, { "input": "10\n6 12 13 20 48 53 74 92 96 97\n10\n1 21 32 36 47 54 69 75 95 97", "output": "1" }, { "input": "10\n5 9 10 14 15 17 19 22 24 26\n10\n2 11 17 19 21 22 24 25 27 28", "output": "1" }, { "input": "10\n24 53 56 126 354 432 442 740 795 856\n10\n273 438 494 619 689 711 894 947 954 958", "output": "1" }, { "input": "10\n3 4 6 7 8 10 14 16 19 20\n10\n3 4 5 7 8 10 15 16 18 20", "output": "1" }, { "input": "10\n1 6 8 14 15 17 25 27 34 39\n10\n1 8 16 17 19 22 32 39 44 50", "output": "1" }, { "input": "10\n5 21 22 23 25 32 35 36 38 39\n10\n3 7 8 9 18 21 23 24 36 38", "output": "4" }, { "input": "50\n5 8 13 16 19 20 21 22 24 27 28 29 30 32 33 34 35 43 45 48 50 51 54 55 58 59 60 61 62 65 70 71 72 76 78 79 80 81 83 84 85 87 89 91 92 94 97 98 99 100\n50\n2 3 5 6 7 10 15 16 17 20 23 28 29 30 31 34 36 37 40 42 45 46 48 54 55 56 58 59 61 62 69 70 71 72 75 76 78 82 84 85 86 87 88 89 90 91 92 97 99 100", "output": "1" }, { "input": "50\n3 5 6 8 9 11 13 19 21 23 24 32 34 35 42 50 51 52 56 58 59 69 70 72 73 75 76 77 78 80 83 88 90 95 96 100 101 102 108 109 113 119 124 135 138 141 142 143 145 150\n50\n5 8 10 11 18 19 23 30 35 43 51 53 55 58 63 68 69 71 77 78 79 82 83 86 88 89 91 92 93 94 96 102 103 105 109 110 113 114 116 123 124 126 127 132 133 135 136 137 142 149", "output": "1" }, { "input": "50\n6 16 24 25 27 33 36 40 51 60 62 65 71 72 75 77 85 87 91 93 98 102 103 106 117 118 120 121 122 123 125 131 134 136 143 148 155 157 160 161 164 166 170 178 184 187 188 192 194 197\n50\n5 9 17 23 27 34 40 44 47 59 62 70 81 82 87 88 89 90 98 101 102 110 113 114 115 116 119 122 124 128 130 137 138 140 144 150 152 155 159 164 166 169 171 175 185 186 187 189 190 193", "output": "1" }, { "input": "50\n14 22 23 31 32 35 48 63 76 79 88 97 101 102 103 104 106 113 114 115 116 126 136 138 145 152 155 156 162 170 172 173 179 180 182 203 208 210 212 222 226 229 231 232 235 237 245 246 247 248\n50\n2 5 6 16 28 44 45 46 54 55 56 63 72 80 87 93 94 96 97 100 101 103 132 135 140 160 164 165 167 168 173 180 182 185 186 192 194 198 199 202 203 211 213 216 217 227 232 233 236 245", "output": "1" }, { "input": "50\n14 19 33 35 38 41 51 54 69 70 71 73 76 80 84 94 102 104 105 106 107 113 121 128 131 168 180 181 187 191 195 201 205 207 210 216 220 238 249 251 263 271 272 275 281 283 285 286 291 294\n50\n2 3 5 20 21 35 38 40 43 48 49 52 55 64 73 77 82 97 109 113 119 121 125 132 137 139 145 146 149 180 182 197 203 229 234 241 244 251 264 271 274 281 284 285 287 291 292 293 294 298", "output": "1" }, { "input": "50\n2 4 5 16 18 19 22 23 25 26 34 44 48 54 67 79 80 84 92 110 116 133 138 154 163 171 174 202 205 218 228 229 234 245 247 249 250 263 270 272 274 275 277 283 289 310 312 334 339 342\n50\n1 5 17 18 25 37 46 47 48 59 67 75 80 83 84 107 115 122 137 141 159 162 175 180 184 204 221 224 240 243 247 248 249 258 259 260 264 266 269 271 274 293 294 306 329 330 334 335 342 350", "output": "1" }, { "input": "50\n6 9 11 21 28 39 42 56 60 63 81 88 91 95 105 110 117 125 149 165 174 176 185 189 193 196 205 231 233 268 278 279 281 286 289 292 298 303 305 306 334 342 350 353 361 371 372 375 376 378\n50\n6 17 20 43 45 52 58 59 82 83 88 102 111 118 121 131 145 173 190 191 200 216 224 225 232 235 243 256 260 271 290 291 321 322 323 329 331 333 334 341 343 348 351 354 356 360 366 379 387 388", "output": "1" }, { "input": "10\n17 239 443 467 661 1069 1823 2333 3767 4201\n20\n51 83 97 457 593 717 997 1329 1401 1459 1471 1983 2371 2539 3207 3251 3329 5469 6637 6999", "output": "8" }, { "input": "20\n179 359 401 467 521 601 919 941 1103 1279 1709 1913 1949 2003 2099 2143 2179 2213 2399 4673\n20\n151 181 191 251 421 967 1109 1181 1249 1447 1471 1553 1619 2327 2551 2791 3049 3727 6071 7813", "output": "3" }, { "input": "20\n79 113 151 709 809 983 1291 1399 1409 1429 2377 2659 2671 2897 3217 3511 3557 3797 3823 4363\n10\n19 101 659 797 1027 1963 2129 2971 3299 9217", "output": "3" }, { "input": "30\n19 47 109 179 307 331 389 401 461 509 547 569 617 853 883 1249 1361 1381 1511 1723 1741 1783 2459 2531 2621 3533 3821 4091 5557 6217\n20\n401 443 563 941 967 997 1535 1567 1655 1747 1787 1945 1999 2251 2305 2543 2735 4415 6245 7555", "output": "8" }, { "input": "30\n3 43 97 179 257 313 353 359 367 389 397 457 547 599 601 647 1013 1021 1063 1433 1481 1531 1669 3181 3373 3559 3769 4157 4549 5197\n50\n13 15 17 19 29 79 113 193 197 199 215 223 271 293 359 485 487 569 601 683 895 919 941 967 1283 1285 1289 1549 1565 1765 1795 1835 1907 1931 1945 1985 1993 2285 2731 2735 2995 3257 4049 4139 5105 5315 7165 7405 7655 8345", "output": "20" }, { "input": "50\n11 17 23 53 59 109 137 149 173 251 353 379 419 421 439 503 593 607 661 773 821 877 941 997 1061 1117 1153 1229 1289 1297 1321 1609 1747 2311 2389 2543 2693 3041 3083 3137 3181 3209 3331 3373 3617 3767 4201 4409 4931 6379\n50\n55 59 67 73 85 89 101 115 211 263 295 353 545 599 607 685 739 745 997 1031 1255 1493 1523 1667 1709 1895 1949 2161 2195 2965 3019 3035 3305 3361 3373 3673 3739 3865 3881 4231 4253 4385 4985 5305 5585 5765 6145 6445 8045 8735", "output": "23" }, { "input": "5\n33 78 146 3055 4268\n5\n2211 2584 5226 9402 9782", "output": "3" }, { "input": "5\n35 48 52 86 8001\n10\n332 3430 3554 4704 4860 5096 6215 7583 8228 8428", "output": "4" }, { "input": "10\n97 184 207 228 269 2084 4450 6396 7214 9457\n16\n338 1179 1284 1545 1570 2444 3167 3395 3397 5550 6440 7245 7804 7980 9415 9959", "output": "5" }, { "input": "30\n25 30 41 57 58 62 70 72 76 79 84 85 88 91 98 101 104 109 119 129 136 139 148 151 926 1372 3093 3936 5423 7350\n25\n1600 1920 2624 3648 3712 3968 4480 4608 4864 5056 5376 5440 5632 5824 6272 6464 6656 6934 6976 7616 8256 8704 8896 9472 9664", "output": "24" }, { "input": "5\n33 78 146 3055 4268\n5\n2211 2584 5226 9402 9782", "output": "3" }, { "input": "5\n35 48 52 86 8001\n10\n332 3430 3554 4704 4860 5096 6215 7583 8228 8428", "output": "4" }, { "input": "10\n97 184 207 228 269 2084 4450 6396 7214 9457\n16\n338 1179 1284 1545 1570 2444 3167 3395 3397 5550 6440 7245 7804 7980 9415 9959", "output": "5" }, { "input": "30\n25 30 41 57 58 62 70 72 76 79 84 85 88 91 98 101 104 109 119 129 136 139 148 151 926 1372 3093 3936 5423 7350\n25\n1600 1920 2624 3648 3712 3968 4480 4608 4864 5056 5376 5440 5632 5824 6272 6464 6656 6934 6976 7616 8256 8704 8896 9472 9664", "output": "24" }, { "input": "47\n66 262 357 457 513 530 538 540 592 691 707 979 1015 1242 1246 1667 1823 1886 1963 2133 2649 2679 2916 2949 3413 3523 3699 3958 4393 4922 5233 5306 5799 6036 6302 6629 7208 7282 7315 7822 7833 7927 8068 8150 8870 8962 9987\n39\n167 199 360 528 1515 1643 1986 1988 2154 2397 2856 3552 3656 3784 3980 4096 4104 4240 4320 4736 4951 5266 5656 5849 5850 6169 6517 6875 7244 7339 7689 7832 8120 8716 9503 9509 9933 9936 9968", "output": "12" }, { "input": "1\n94\n50\n423 446 485 1214 1468 1507 1853 1930 1999 2258 2271 2285 2425 2543 2715 2743 2992 3196 4074 4108 4448 4475 4652 5057 5250 5312 5356 5375 5731 5986 6298 6501 6521 7146 7255 7276 7332 7481 7998 8141 8413 8665 8908 9221 9336 9491 9504 9677 9693 9706", "output": "1" }, { "input": "50\n51 67 75 186 194 355 512 561 720 876 1077 1221 1503 1820 2153 2385 2568 2608 2937 2969 3271 3311 3481 4081 4093 4171 4255 4256 4829 5020 5192 5636 5817 6156 6712 6717 7153 7436 7608 7612 7866 7988 8264 8293 8867 9311 9879 9882 9889 9908\n1\n5394", "output": "1" }, { "input": "50\n26 367 495 585 675 789 855 1185 1312 1606 2037 2241 2587 2612 2628 2807 2873 2924 3774 4067 4376 4668 4902 5001 5082 5100 5104 5209 5345 5515 5661 5777 5902 5907 6155 6323 6675 6791 7503 8159 8207 8254 8740 8848 8855 8933 9069 9164 9171 9586\n5\n1557 6246 7545 8074 8284", "output": "1" }, { "input": "5\n25 58 91 110 2658\n50\n21 372 909 1172 1517 1554 1797 1802 1843 1977 2006 2025 2137 2225 2317 2507 2645 2754 2919 3024 3202 3212 3267 3852 4374 4487 4553 4668 4883 4911 4916 5016 5021 5068 5104 5162 5683 5856 6374 6871 7333 7531 8099 8135 8173 8215 8462 8776 9433 9790", "output": "4" }, { "input": "45\n37 48 56 59 69 70 79 83 85 86 99 114 131 134 135 145 156 250 1739 1947 2116 2315 2449 3104 3666 4008 4406 4723 4829 5345 5836 6262 6296 6870 7065 7110 7130 7510 7595 8092 8442 8574 9032 9091 9355\n50\n343 846 893 1110 1651 1837 2162 2331 2596 3012 3024 3131 3294 3394 3528 3717 3997 4125 4347 4410 4581 4977 5030 5070 5119 5229 5355 5413 5418 5474 5763 5940 6151 6161 6164 6237 6506 6519 6783 7182 7413 7534 8069 8253 8442 8505 9135 9308 9828 9902", "output": "17" }, { "input": "50\n17 20 22 28 36 38 46 47 48 50 52 57 58 62 63 69 70 74 75 78 79 81 82 86 87 90 93 95 103 202 292 442 1756 1769 2208 2311 2799 2957 3483 4280 4324 4932 5109 5204 6225 6354 6561 7136 8754 9670\n40\n68 214 957 1649 1940 2078 2134 2716 3492 3686 4462 4559 4656 4756 4850 5044 5490 5529 5592 5626 6014 6111 6693 6790 7178 7275 7566 7663 7702 7857 7954 8342 8511 8730 8957 9021 9215 9377 9445 9991", "output": "28" }, { "input": "39\n10 13 21 25 36 38 47 48 58 64 68 69 73 79 86 972 2012 2215 2267 2503 3717 3945 4197 4800 5266 6169 6612 6824 7023 7322 7582 7766 8381 8626 8879 9079 9088 9838 9968\n50\n432 877 970 1152 1202 1223 1261 1435 1454 1578 1843 1907 2003 2037 2183 2195 2215 2425 3065 3492 3615 3637 3686 3946 4189 4415 4559 4656 4665 4707 4886 4887 5626 5703 5955 6208 6521 6581 6596 6693 6985 7013 7081 7343 7663 8332 8342 8637 9207 9862", "output": "15" }, { "input": "50\n7 144 269 339 395 505 625 688 709 950 1102 1152 1350 1381 1641 1830 1977 1999 2093 2180 2718 3308 3574 4168 4232 4259 4393 4689 4982 5154 5476 5581 5635 5721 6159 6302 6741 7010 7152 7315 7417 7482 8116 8239 8640 9347 9395 9614 9661 9822\n20\n84 162 292 1728 1866 2088 3228 3470 4068 5318 5470 6060 6380 6929 7500 8256 8399 8467 8508 9691", "output": "8" }, { "input": "50\n159 880 1070 1139 1358 1608 1691 1841 2073 2171 2213 2597 2692 2759 2879 2931 3173 3217 3441 4201 4878 5106 5129 5253 5395 5647 5968 6019 6130 6276 6286 6330 6409 6728 7488 7713 7765 7828 7899 8064 8264 8457 8483 8685 8900 8946 8965 9133 9187 9638\n45\n57 159 1070 1139 1391 1608 1691 1841 2171 2213 2692 2759 2931 3173 3217 3441 4201 4878 5106 5129 5253 5647 5968 6130 6276 6286 6409 7488 7694 7713 7765 7828 7899 8003 8064 8081 8244 8264 8685 8900 8946 8965 9133 9638 9673", "output": "38" }, { "input": "3\n3 4 5\n3\n6 20 25", "output": "2" }, { "input": "4\n2 3 5 8\n4\n2 6 8 10", "output": "1" }, { "input": "4\n3 5 7 11\n4\n3 5 7 22", "output": "1" }, { "input": "2\n2 3\n3\n20 30 50", "output": "1" }, { "input": "3\n1 2 3\n4\n2 4 6 49", "output": "1" }, { "input": "2\n4 5\n3\n12 15 20", "output": "1" }, { "input": "3\n2 5 7\n3\n4 5 7", "output": "1" }, { "input": "3\n3 5 8\n3\n6 8 10", "output": "2" }, { "input": "2\n2 3\n4\n4 6 9 33", "output": "1" }, { "input": "2\n2 3\n4\n4 6 21 40", "output": "1" }, { "input": "3\n4 9 10\n3\n8 9 10", "output": "1" }, { "input": "5\n1 5 6 9 51\n5\n5 12 18 27 10000", "output": "1" }, { "input": "13\n1 2 3 4 5 6 7 8 9 10 11 12 13\n1\n14", "output": "1" } ]
1,660,669,330
2,147,483,647
PyPy 3-64
OK
TESTS
57
154
1,536,000
import math n=int(input()) l1=[int(i) for i in input().split()] m=int(input()) l2=[int(j) for j in input().split()] l3=[] for x in range(m): for y in range(n): k=l2[x]/l1[y] if k-math.floor(k)==0: l3.append(k) a=max(l3) print(l3.count(a))
Title: Bicycle Chain Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya's bicycle chain drive consists of two parts: *n* stars are attached to the pedal axle, *m* stars are attached to the rear wheel axle. The chain helps to rotate the rear wheel by transmitting the pedal rotation. We know that the *i*-th star on the pedal axle has *a**i* (0<=&lt;<=*a*1<=&lt;<=*a*2<=&lt;<=...<=&lt;<=*a**n*) teeth, and the *j*-th star on the rear wheel axle has *b**j* (0<=&lt;<=*b*1<=&lt;<=*b*2<=&lt;<=...<=&lt;<=*b**m*) teeth. Any pair (*i*,<=*j*) (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*) is called a gear and sets the indexes of stars to which the chain is currently attached. Gear (*i*,<=*j*) has a gear ratio, equal to the value . Since Vasya likes integers, he wants to find such gears (*i*,<=*j*), that their ratios are integers. On the other hand, Vasya likes fast driving, so among all "integer" gears (*i*,<=*j*) he wants to choose a gear with the maximum ratio. Help him to find the number of such gears. In the problem, fraction denotes division in real numbers, that is, no rounding is performed. Input Specification: The first input line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stars on the bicycle's pedal axle. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) in the order of strict increasing. The third input line contains integer *m* (1<=≤<=*m*<=≤<=50) — the number of stars on the rear wheel axle. The fourth line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=104) in the order of strict increasing. It is guaranteed that there exists at least one gear (*i*,<=*j*), that its gear ratio is an integer. The numbers on the lines are separated by spaces. Output Specification: Print the number of "integer" gears with the maximum ratio among all "integer" gears. Demo Input: ['2\n4 5\n3\n12 13 15\n', '4\n1 2 3 4\n5\n10 11 12 13 14\n'] Demo Output: ['2\n', '1\n'] Note: In the first sample the maximum "integer" gear ratio equals 3. There are two gears that have such gear ratio. For one of them *a*<sub class="lower-index">1</sub> = 4, *b*<sub class="lower-index">1</sub> = 12, and for the other *a*<sub class="lower-index">2</sub> = 5, *b*<sub class="lower-index">3</sub> = 15.
```python import math n=int(input()) l1=[int(i) for i in input().split()] m=int(input()) l2=[int(j) for j in input().split()] l3=[] for x in range(m): for y in range(n): k=l2[x]/l1[y] if k-math.floor(k)==0: l3.append(k) a=max(l3) print(l3.count(a)) ```
3
747
A
Display Size
PROGRAMMING
800
[ "brute force", "math" ]
null
null
A big company decided to launch a new series of rectangular displays, and decided that the display must have exactly *n* pixels. Your task is to determine the size of the rectangular display — the number of lines (rows) of pixels *a* and the number of columns of pixels *b*, so that: - there are exactly *n* pixels on the display; - the number of rows does not exceed the number of columns, it means *a*<=≤<=*b*; - the difference *b*<=-<=*a* is as small as possible.
The first line contains the positive integer *n* (1<=≤<=*n*<=≤<=106) — the number of pixels display should have.
Print two integers — the number of rows and columns on the display.
[ "8\n", "64\n", "5\n", "999999\n" ]
[ "2 4\n", "8 8\n", "1 5\n", "999 1001\n" ]
In the first example the minimum possible difference equals 2, so on the display should be 2 rows of 4 pixels. In the second example the minimum possible difference equals 0, so on the display should be 8 rows of 8 pixels. In the third example the minimum possible difference equals 4, so on the display should be 1 row of 5 pixels.
500
[ { "input": "8", "output": "2 4" }, { "input": "64", "output": "8 8" }, { "input": "5", "output": "1 5" }, { "input": "999999", "output": "999 1001" }, { "input": "716539", "output": "97 7387" }, { "input": "1", "output": "1 1" }, { "input": "2", "output": "1 2" }, { "input": "3", "output": "1 3" }, { "input": "4", "output": "2 2" }, { "input": "6", "output": "2 3" }, { "input": "7", "output": "1 7" }, { "input": "9", "output": "3 3" }, { "input": "10", "output": "2 5" }, { "input": "11", "output": "1 11" }, { "input": "12", "output": "3 4" }, { "input": "15", "output": "3 5" }, { "input": "100", "output": "10 10" }, { "input": "101", "output": "1 101" }, { "input": "169", "output": "13 13" }, { "input": "179", "output": "1 179" }, { "input": "190", "output": "10 19" }, { "input": "1000", "output": "25 40" }, { "input": "10000", "output": "100 100" }, { "input": "10001", "output": "73 137" }, { "input": "100000", "output": "250 400" }, { "input": "100001", "output": "11 9091" }, { "input": "1000000", "output": "1000 1000" }, { "input": "999983", "output": "1 999983" }, { "input": "524288", "output": "512 1024" }, { "input": "954493", "output": "971 983" }, { "input": "966289", "output": "983 983" }, { "input": "944663", "output": "961 983" }, { "input": "912673", "output": "97 9409" }, { "input": "732641", "output": "679 1079" }, { "input": "232897", "output": "343 679" }, { "input": "16807", "output": "49 343" }, { "input": "999958", "output": "2 499979" }, { "input": "990151", "output": "1 990151" }, { "input": "997002", "output": "998 999" }, { "input": "20", "output": "4 5" }, { "input": "20261", "output": "1 20261" }, { "input": "999123", "output": "3 333041" }, { "input": "901841", "output": "1 901841" } ]
1,591,420,623
2,147,483,647
PyPy 3
OK
TESTS
43
155
0
from math import* #n,k=map(int, input().split()) n=int(input()) #l=list(map(int, input().split())) #s=input() k=int(pow(n,1/2)) for i in range(k,0,-1): if n%i==0: print(i,n//i) break
Title: Display Size Time Limit: None seconds Memory Limit: None megabytes Problem Description: A big company decided to launch a new series of rectangular displays, and decided that the display must have exactly *n* pixels. Your task is to determine the size of the rectangular display — the number of lines (rows) of pixels *a* and the number of columns of pixels *b*, so that: - there are exactly *n* pixels on the display; - the number of rows does not exceed the number of columns, it means *a*<=≤<=*b*; - the difference *b*<=-<=*a* is as small as possible. Input Specification: The first line contains the positive integer *n* (1<=≤<=*n*<=≤<=106) — the number of pixels display should have. Output Specification: Print two integers — the number of rows and columns on the display. Demo Input: ['8\n', '64\n', '5\n', '999999\n'] Demo Output: ['2 4\n', '8 8\n', '1 5\n', '999 1001\n'] Note: In the first example the minimum possible difference equals 2, so on the display should be 2 rows of 4 pixels. In the second example the minimum possible difference equals 0, so on the display should be 8 rows of 8 pixels. In the third example the minimum possible difference equals 4, so on the display should be 1 row of 5 pixels.
```python from math import* #n,k=map(int, input().split()) n=int(input()) #l=list(map(int, input().split())) #s=input() k=int(pow(n,1/2)) for i in range(k,0,-1): if n%i==0: print(i,n//i) break ```
3
39
J
Spelling Check
PROGRAMMING
1,500
[ "hashing", "implementation", "strings" ]
J. Spelling Check
2
256
Petya has noticed that when he types using a keyboard, he often presses extra buttons and adds extra letters to the words. Of course, the spell-checking system underlines the words for him and he has to click every word and choose the right variant. Petya got fed up with correcting his mistakes himself, that’s why he decided to invent the function that will correct the words itself. Petya started from analyzing the case that happens to him most of the time, when all one needs is to delete one letter for the word to match a word from the dictionary. Thus, Petya faces one mini-task: he has a printed word and a word from the dictionary, and he should delete one letter from the first word to get the second one. And now the very non-trivial question that Petya faces is: which letter should he delete?
The input data contains two strings, consisting of lower-case Latin letters. The length of each string is from 1 to 106 symbols inclusive, the first string contains exactly 1 symbol more than the second one.
In the first line output the number of positions of the symbols in the first string, after the deleting of which the first string becomes identical to the second one. In the second line output space-separated positions of these symbols in increasing order. The positions are numbered starting from 1. If it is impossible to make the first string identical to the second string by deleting one symbol, output one number 0.
[ "abdrakadabra\nabrakadabra\n", "aa\na\n", "competition\ncodeforces\n" ]
[ "1\n3\n", "2\n1 2\n", "0\n" ]
none
0
[ { "input": "abdrakadabra\nabrakadabra", "output": "1\n3 " }, { "input": "aa\na", "output": "2\n1 2 " }, { "input": "competition\ncodeforces", "output": "0" }, { "input": "ab\na", "output": "1\n2 " }, { "input": "bb\nb", "output": "2\n1 2 " }, { "input": "aab\nab", "output": "2\n1 2 " }, { "input": "aabb\nabb", "output": "2\n1 2 " }, { "input": "babaacaacaa\nbbaacaacaa", "output": "1\n2 " }, { "input": "bccaabbcccc\nbccaabcccc", "output": "2\n6 7 " }, { "input": "ababcaabaaa\nabacaabaaa", "output": "1\n4 " }, { "input": "cccacaccacb\ncccacaccac", "output": "1\n11 " }, { "input": "aaaaaaaaaaa\naaaaaaaaaa", "output": "11\n1 2 3 4 5 6 7 8 9 10 11 " }, { "input": "lcaaxcbcjca\nccaaacccca", "output": "0" }, { "input": "babbbtaamba\nbabbbaabba", "output": "0" }, { "input": "xdfxmcnzpch\nazvotghvtk", "output": "0" }, { "input": "ki\nb", "output": "0" }, { "input": "vct\nie", "output": "0" }, { "input": "feee\nsnl", "output": "0" }, { "input": "cbxxxxzvks\ncbxxxzvks", "output": "4\n3 4 5 6 " }, { "input": "qybldcgfhdhhhhhhhhhhopqkhuczzytzluiahwbqjltgafvvoecititchjwdoljiehubngmtjckqymldhoncgtqhxnqvoagnrmur\nqybldcgfhdhhhhhhhhhopqkhuczzytzluiahwbqjltgafvvoecititchjwdoljiehubngmtjckqymldhoncgtqhxnqvoagnrmur", "output": "10\n11 12 13 14 15 16 17 18 19 20 " } ]
1,553,170,560
2,147,483,647
PyPy 3
OK
TESTS
40
1,716
48,742,400
s, t = input(), input() n = j = len(t) for i in range(n): if s[i] != t[i]: j = i break for i in range(j + 1, n + 1): if s[i] != t[i - 1]: print(0) break else: i = j while i > 0 and s[i - 1] == s[j]: i -= 1 print(j - i + 1) print(*range(i + 1, j + 2))
Title: Spelling Check Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Petya has noticed that when he types using a keyboard, he often presses extra buttons and adds extra letters to the words. Of course, the spell-checking system underlines the words for him and he has to click every word and choose the right variant. Petya got fed up with correcting his mistakes himself, that’s why he decided to invent the function that will correct the words itself. Petya started from analyzing the case that happens to him most of the time, when all one needs is to delete one letter for the word to match a word from the dictionary. Thus, Petya faces one mini-task: he has a printed word and a word from the dictionary, and he should delete one letter from the first word to get the second one. And now the very non-trivial question that Petya faces is: which letter should he delete? Input Specification: The input data contains two strings, consisting of lower-case Latin letters. The length of each string is from 1 to 106 symbols inclusive, the first string contains exactly 1 symbol more than the second one. Output Specification: In the first line output the number of positions of the symbols in the first string, after the deleting of which the first string becomes identical to the second one. In the second line output space-separated positions of these symbols in increasing order. The positions are numbered starting from 1. If it is impossible to make the first string identical to the second string by deleting one symbol, output one number 0. Demo Input: ['abdrakadabra\nabrakadabra\n', 'aa\na\n', 'competition\ncodeforces\n'] Demo Output: ['1\n3\n', '2\n1 2\n', '0\n'] Note: none
```python s, t = input(), input() n = j = len(t) for i in range(n): if s[i] != t[i]: j = i break for i in range(j + 1, n + 1): if s[i] != t[i - 1]: print(0) break else: i = j while i > 0 and s[i - 1] == s[j]: i -= 1 print(j - i + 1) print(*range(i + 1, j + 2)) ```
3.48021
236
A
Boy or Girl
PROGRAMMING
800
[ "brute force", "implementation", "strings" ]
null
null
Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network. But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names. This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method.
The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters.
If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes).
[ "wjmzbmr\n", "xiaodao\n", "sevenkplus\n" ]
[ "CHAT WITH HER!\n", "IGNORE HIM!\n", "CHAT WITH HER!\n" ]
For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
500
[ { "input": "wjmzbmr", "output": "CHAT WITH HER!" }, { "input": "xiaodao", "output": "IGNORE HIM!" }, { "input": "sevenkplus", "output": "CHAT WITH HER!" }, { "input": "pezu", "output": "CHAT WITH HER!" }, { "input": "wnemlgppy", "output": "CHAT WITH HER!" }, { "input": "zcinitufxoldnokacdvtmdohsfdjepyfioyvclhmujiqwvmudbfjzxjfqqxjmoiyxrfsbvseawwoyynn", "output": "IGNORE HIM!" }, { "input": "qsxxuoynwtebujwpxwpajitiwxaxwgbcylxneqiebzfphugwkftpaikixmumkhfbjiswmvzbtiyifbx", "output": "CHAT WITH HER!" }, { "input": "qwbdfzfylckctudyjlyrtmvbidfatdoqfmrfshsqqmhzohhsczscvwzpwyoyswhktjlykumhvaounpzwpxcspxwlgt", "output": "IGNORE HIM!" }, { "input": "nuezoadauueermoeaabjrkxttkatspjsjegjcjcdmcxgodowzbwuqncfbeqlhkk", "output": "IGNORE HIM!" }, { "input": "lggvdmulrsvtuagoavstuyufhypdxfomjlzpnduulukszqnnwfvxbvxyzmleocmofwclmzz", "output": "IGNORE HIM!" }, { "input": "tgcdptnkc", "output": "IGNORE HIM!" }, { "input": "wvfgnfrzabgibzxhzsojskmnlmrokydjoexnvi", "output": "IGNORE HIM!" }, { "input": "sxtburpzskucowowebgrbovhadrrayamuwypmmxhscrujkmcgvyinp", "output": "IGNORE HIM!" }, { "input": "pjqxhvxkyeqqvyuujxhmbspatvrckhhkfloottuybjivkkhpyivcighxumavrxzxslfpggnwbtalmhysyfllznphzia", "output": "IGNORE HIM!" }, { "input": "fpellxwskyekoyvrfnuf", "output": "CHAT WITH HER!" }, { "input": "xninyvkuvakfbs", "output": "IGNORE HIM!" }, { "input": "vnxhrweyvhqufpfywdwftoyrfgrhxuamqhblkvdpxmgvphcbeeqbqssresjifwyzgfhurmamhkwupymuomak", "output": "CHAT WITH HER!" }, { "input": "kmsk", "output": "IGNORE HIM!" }, { "input": "lqonogasrkzhryjxppjyriyfxmdfubieglthyswz", "output": "CHAT WITH HER!" }, { "input": "ndormkufcrkxlihdhmcehzoimcfhqsmombnfjrlcalffq", "output": "CHAT WITH HER!" }, { "input": "zqzlnnuwcfufwujygtczfakhcpqbtxtejrbgoodychepzdphdahtxyfpmlrycyicqthsgm", "output": "IGNORE HIM!" }, { "input": "ppcpbnhwoizajrl", "output": "IGNORE HIM!" }, { "input": "sgubujztzwkzvztitssxxxwzanfmddfqvv", "output": "CHAT WITH HER!" }, { "input": "ptkyaxycecpbrjnvxcjtbqiocqcswnmicxbvhdsptbxyxswbw", "output": "IGNORE HIM!" }, { "input": "yhbtzfppwcycxqjpqdfmjnhwaogyuaxamwxpnrdrnqsgdyfvxu", "output": "CHAT WITH HER!" }, { "input": "ojjvpnkrxibyevxk", "output": "CHAT WITH HER!" }, { "input": "wjweqcrqfuollfvfbiyriijovweg", "output": "IGNORE HIM!" }, { "input": "hkdbykboclchfdsuovvpknwqr", "output": "IGNORE HIM!" }, { "input": "stjvyfrfowopwfjdveduedqylerqugykyu", "output": "IGNORE HIM!" }, { "input": "rafcaanqytfclvfdegak", "output": "CHAT WITH HER!" }, { "input": "xczn", "output": "CHAT WITH HER!" }, { "input": "arcoaeozyeawbveoxpmafxxzdjldsielp", "output": "IGNORE HIM!" }, { "input": "smdfafbyehdylhaleevhoggiurdgeleaxkeqdixyfztkuqsculgslheqfafxyghyuibdgiuwrdxfcitojxika", "output": "CHAT WITH HER!" }, { "input": "vbpfgjqnhfazmvtkpjrdasfhsuxnpiepxfrzvoh", "output": "CHAT WITH HER!" }, { "input": "dbdokywnpqnotfrhdbrzmuyoxfdtrgrzcccninbtmoqvxfatcqg", "output": "CHAT WITH HER!" }, { "input": "udlpagtpq", "output": "CHAT WITH HER!" }, { "input": "zjurevbytijifnpfuyswfchdzelxheboruwjqijxcucylysmwtiqsqqhktexcynquvcwhbjsipy", "output": "CHAT WITH HER!" }, { "input": "qagzrqjomdwhagkhrjahhxkieijyten", "output": "CHAT WITH HER!" }, { "input": "achhcfjnnfwgoufxamcqrsontgjjhgyfzuhklkmiwybnrlsvblnsrjqdytglipxsulpnphpjpoewvlusalsgovwnsngb", "output": "CHAT WITH HER!" }, { "input": "qbkjsdwpahdbbohggbclfcufqelnojoehsxxkr", "output": "CHAT WITH HER!" }, { "input": "cpvftiwgyvnlmbkadiafddpgfpvhqqvuehkypqjsoibpiudfvpkhzlfrykc", "output": "IGNORE HIM!" }, { "input": "lnpdosnceumubvk", "output": "IGNORE HIM!" }, { "input": "efrk", "output": "CHAT WITH HER!" }, { "input": "temnownneghnrujforif", "output": "IGNORE HIM!" }, { "input": "ottnneymszwbumgobazfjyxewkjakglbfflsajuzescplpcxqta", "output": "IGNORE HIM!" }, { "input": "eswpaclodzcwhgixhpyzvhdwsgneqidanbzdzszquefh", "output": "IGNORE HIM!" }, { "input": "gwntwbpj", "output": "IGNORE HIM!" }, { "input": "wuqvlbblkddeindiiswsinkfrnkxghhwunzmmvyovpqapdfbolyim", "output": "IGNORE HIM!" }, { "input": "swdqsnzmzmsyvktukaoyqsqzgfmbzhezbfaqeywgwizrwjyzquaahucjchegknqaioliqd", "output": "CHAT WITH HER!" }, { "input": "vlhrpzezawyolhbmvxbwhtjustdbqggexmzxyieihjlelvwjosmkwesfjmramsikhkupzvfgezmrqzudjcalpjacmhykhgfhrjx", "output": "IGNORE HIM!" }, { "input": "lxxwbkrjgnqjwsnflfnsdyxihmlspgivirazsbveztnkuzpaxtygidniflyjheejelnjyjvgkgvdqks", "output": "CHAT WITH HER!" }, { "input": "wpxbxzfhtdecetpljcrvpjjnllosdqirnkzesiqeukbedkayqx", "output": "CHAT WITH HER!" }, { "input": "vmzxgacicvweclaodrunmjnfwtimceetsaoickarqyrkdghcmyjgmtgsqastcktyrjgvjqimdc", "output": "CHAT WITH HER!" }, { "input": "yzlzmesxdttfcztooypjztlgxwcr", "output": "IGNORE HIM!" }, { "input": "qpbjwzwgdzmeluheirjrvzrhbmagfsjdgvzgwumjtjzecsfkrfqjasssrhhtgdqqfydlmrktlgfc", "output": "IGNORE HIM!" }, { "input": "aqzftsvezdgouyrirsxpbuvdjupnzvbhguyayeqozfzymfnepvwgblqzvmxxkxcilmsjvcgyqykpoaktjvsxbygfgsalbjoq", "output": "CHAT WITH HER!" }, { "input": "znicjjgijhrbdlnwmtjgtdgziollrfxroabfhadygnomodaembllreorlyhnehijfyjbfxucazellblegyfrzuraogadj", "output": "IGNORE HIM!" }, { "input": "qordzrdiknsympdrkgapjxokbldorpnmnpucmwakklmqenpmkom", "output": "CHAT WITH HER!" }, { "input": "wqfldgihuxfktzanyycluzhtewmwvnawqlfoavuguhygqrrxtstxwouuzzsryjqtfqo", "output": "CHAT WITH HER!" }, { "input": "vujtrrpshinkskgyknlcfckmqdrwtklkzlyipmetjvaqxdsslkskschbalmdhzsdrrjmxdltbtnxbh", "output": "IGNORE HIM!" }, { "input": "zioixjibuhrzyrbzqcdjbbhhdmpgmqykixcxoqupggaqajuzonrpzihbsogjfsrrypbiphehonyhohsbybnnukqebopppa", "output": "CHAT WITH HER!" }, { "input": "oh", "output": "CHAT WITH HER!" }, { "input": "kxqthadqesbpgpsvpbcbznxpecqrzjoilpauttzlnxvaczcqwuri", "output": "IGNORE HIM!" }, { "input": "zwlunigqnhrwirkvufqwrnwcnkqqonebrwzcshcbqqwkjxhymjjeakuzjettebciadjlkbfp", "output": "CHAT WITH HER!" }, { "input": "fjuldpuejgmggvvigkwdyzytfxzwdlofrpifqpdnhfyroginqaufwgjcbgshyyruwhofctsdaisqpjxqjmtpp", "output": "CHAT WITH HER!" }, { "input": "xiwntnheuitbtqxrmzvxmieldudakogealwrpygbxsbluhsqhtwmdlpjwzyafckrqrdduonkgo", "output": "CHAT WITH HER!" }, { "input": "mnmbupgo", "output": "IGNORE HIM!" }, { "input": "mcjehdiygkbmrbfjqwpwxidbdfelifwhstaxdapigbymmsgrhnzsdjhsqchl", "output": "IGNORE HIM!" }, { "input": "yocxrzspinchmhtmqo", "output": "CHAT WITH HER!" }, { "input": "vasvvnpymtgjirnzuynluluvmgpquskuaafwogeztfnvybblajvuuvfomtifeuzpikjrolzeeoftv", "output": "CHAT WITH HER!" }, { "input": "ecsdicrznvglwggrdbrvehwzaenzjutjydhvimtqegweurpxtjkmpcznshtrvotkvrghxhacjkedidqqzrduzad", "output": "IGNORE HIM!" }, { "input": "ubvhyaebyxoghakajqrpqpctwbrfqzli", "output": "CHAT WITH HER!" }, { "input": "gogbxfeqylxoummvgxpkoqzsmobasesxbqjjktqbwqxeiaagnnhbvepbpy", "output": "IGNORE HIM!" }, { "input": "nheihhxkbbrmlpxpxbhnpofcjmxemyvqqdbanwd", "output": "IGNORE HIM!" }, { "input": "acrzbavz", "output": "CHAT WITH HER!" }, { "input": "drvzznznvrzskftnrhvvzxcalwutxmdza", "output": "IGNORE HIM!" }, { "input": "oacwxipdfcoabhkwxqdbtowiekpnflnqhlrkustgzryvws", "output": "CHAT WITH HER!" }, { "input": "tpnwfmfsibnccvdwjvzviyvjfljupinfigfunyff", "output": "CHAT WITH HER!" }, { "input": "gavaihhamfolcndgytcsgucqdqngxkrlovpthvteacmmthoglxu", "output": "CHAT WITH HER!" }, { "input": "hsfcfvameeupldgvchmogrvwxrvsmnwxxkxoawwodtsahqvehlcw", "output": "IGNORE HIM!" }, { "input": "sbkydrscoojychxchqsuciperfroumenelgiyiwlqfwximrgdbyvkmacy", "output": "CHAT WITH HER!" }, { "input": "rhh", "output": "CHAT WITH HER!" }, { "input": "zhdouqfmlkenjzdijxdfxnlegxeuvhelo", "output": "IGNORE HIM!" }, { "input": "yufkkfwyhhvcjntsgsvpzbhqtmtgyxifqoewmuplphykmptfdebjxuaxigomjtwgtljwdjhjernkitifbomifbhysnmadtnyn", "output": "CHAT WITH HER!" }, { "input": "urigreuzpxnej", "output": "CHAT WITH HER!" } ]
1,697,154,509
2,147,483,647
PyPy 3-64
OK
TESTS
85
124
0
name = input() nameSet = set() for char in name: nameSet.add(char) if len(nameSet) % 2 == 0: print('CHAT WITH HER!') else: print('IGNORE HIM!')
Title: Boy or Girl Time Limit: None seconds Memory Limit: None megabytes Problem Description: Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network. But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names. This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method. Input Specification: The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters. Output Specification: If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes). Demo Input: ['wjmzbmr\n', 'xiaodao\n', 'sevenkplus\n'] Demo Output: ['CHAT WITH HER!\n', 'IGNORE HIM!\n', 'CHAT WITH HER!\n'] Note: For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
```python name = input() nameSet = set() for char in name: nameSet.add(char) if len(nameSet) % 2 == 0: print('CHAT WITH HER!') else: print('IGNORE HIM!') ```
3
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,648,455,004
2,147,483,647
Python 3
OK
TESTS
30
62
0
s = input() upper = '' lower = '' for i in s: if i.isupper(): upper += i else: lower += i if len(upper) > len(lower): print(s.upper()) else: print(s.lower())
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python s = input() upper = '' lower = '' for i in s: if i.isupper(): upper += i else: lower += i if len(upper) > len(lower): print(s.upper()) else: print(s.lower()) ```
3.9845
761
A
Dasha and Stairs
PROGRAMMING
1,000
[ "brute force", "constructive algorithms", "implementation", "math" ]
null
null
On her way to programming school tiger Dasha faced her first test — a huge staircase! The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values — the number of steps with even and odd numbers. You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≤<=*l*<=≤<=*r*), for which values that Dasha has found are correct.
In the only line you are given two integers *a*, *b* (0<=≤<=*a*,<=*b*<=≤<=100) — the number of even and odd steps, accordingly.
In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise.
[ "2 3\n", "3 1\n" ]
[ "YES\n", "NO\n" ]
In the first example one of suitable intervals is from 1 to 5. The interval contains two even steps — 2 and 4, and three odd: 1, 3 and 5.
500
[ { "input": "2 3", "output": "YES" }, { "input": "3 1", "output": "NO" }, { "input": "5 4", "output": "YES" }, { "input": "9 9", "output": "YES" }, { "input": "85 95", "output": "NO" }, { "input": "0 1", "output": "YES" }, { "input": "89 25", "output": "NO" }, { "input": "74 73", "output": "YES" }, { "input": "62 39", "output": "NO" }, { "input": "57 57", "output": "YES" }, { "input": "100 99", "output": "YES" }, { "input": "0 0", "output": "NO" }, { "input": "98 100", "output": "NO" }, { "input": "99 100", "output": "YES" }, { "input": "1 0", "output": "YES" }, { "input": "100 0", "output": "NO" }, { "input": "0 100", "output": "NO" }, { "input": "100 98", "output": "NO" }, { "input": "100 100", "output": "YES" }, { "input": "0 5", "output": "NO" }, { "input": "2 2", "output": "YES" } ]
1,485,890,957
2,147,483,647
Python 3
OK
TESTS
21
93
4,608,000
n,m = map(int,input().split()) if (n+m)> 0 and abs(n-m)<= 1 : print("YES") else : print("NO")
Title: Dasha and Stairs Time Limit: None seconds Memory Limit: None megabytes Problem Description: On her way to programming school tiger Dasha faced her first test — a huge staircase! The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values — the number of steps with even and odd numbers. You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≤<=*l*<=≤<=*r*), for which values that Dasha has found are correct. Input Specification: In the only line you are given two integers *a*, *b* (0<=≤<=*a*,<=*b*<=≤<=100) — the number of even and odd steps, accordingly. Output Specification: In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise. Demo Input: ['2 3\n', '3 1\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first example one of suitable intervals is from 1 to 5. The interval contains two even steps — 2 and 4, and three odd: 1, 3 and 5.
```python n,m = map(int,input().split()) if (n+m)> 0 and abs(n-m)<= 1 : print("YES") else : print("NO") ```
3
31
A
Worms Evolution
PROGRAMMING
1,200
[ "implementation" ]
A. Worms Evolution
2
256
Professor Vasechkin is studying evolution of worms. Recently he put forward hypotheses that all worms evolve by division. There are *n* forms of worms. Worms of these forms have lengths *a*1, *a*2, ..., *a**n*. To prove his theory, professor needs to find 3 different forms that the length of the first form is equal to sum of lengths of the other two forms. Help him to do this.
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of worm's forms. The second line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=1000) — lengths of worms of each form.
Output 3 distinct integers *i* *j* *k* (1<=≤<=*i*,<=*j*,<=*k*<=≤<=*n*) — such indexes of worm's forms that *a**i*<==<=*a**j*<=+<=*a**k*. If there is no such triple, output -1. If there are several solutions, output any of them. It possible that *a**j*<==<=*a**k*.
[ "5\n1 2 3 5 7\n", "5\n1 8 1 5 1\n" ]
[ "3 2 1\n", "-1\n" ]
none
500
[ { "input": "5\n1 2 3 5 7", "output": "3 2 1" }, { "input": "5\n1 8 1 5 1", "output": "-1" }, { "input": "4\n303 872 764 401", "output": "-1" }, { "input": "6\n86 402 133 524 405 610", "output": "6 4 1" }, { "input": "8\n217 779 418 895 996 473 3 22", "output": "5 2 1" }, { "input": "10\n858 972 670 15 662 114 33 273 53 310", "output": "2 6 1" }, { "input": "100\n611 697 572 770 603 870 128 245 49 904 468 982 788 943 549 288 668 796 803 515 999 735 912 49 298 80 412 841 494 434 543 298 17 571 271 105 70 313 178 755 194 279 585 766 412 164 907 841 776 556 731 268 735 880 176 267 287 65 239 588 155 658 821 47 783 595 585 69 226 906 429 161 999 148 7 484 362 585 952 365 92 749 904 525 307 626 883 367 450 755 564 950 728 724 69 106 119 157 96 290", "output": "1 38 25" }, { "input": "100\n713 572 318 890 577 657 646 146 373 783 392 229 455 871 20 593 573 336 26 381 280 916 907 732 820 713 111 840 570 446 184 711 481 399 788 647 492 15 40 530 549 506 719 782 126 20 778 996 712 761 9 74 812 418 488 175 103 585 900 3 604 521 109 513 145 708 990 361 682 827 791 22 596 780 596 385 450 643 158 496 876 975 319 783 654 895 891 361 397 81 682 899 347 623 809 557 435 279 513 438", "output": "1 63 61" }, { "input": "100\n156 822 179 298 981 82 610 345 373 378 895 734 768 15 78 335 764 608 932 297 717 553 916 367 425 447 361 195 66 70 901 236 905 744 919 564 296 610 963 628 840 52 100 750 345 308 37 687 192 704 101 815 10 990 216 358 823 546 578 821 706 148 182 582 421 482 829 425 121 337 500 301 402 868 66 935 625 527 746 585 308 523 488 914 608 709 875 252 151 781 447 2 756 176 976 302 450 35 680 791", "output": "1 98 69" }, { "input": "100\n54 947 785 838 359 647 92 445 48 465 323 486 101 86 607 31 860 420 709 432 435 372 272 37 903 814 309 197 638 58 259 822 793 564 309 22 522 907 101 853 486 824 614 734 630 452 166 532 256 499 470 9 933 452 256 450 7 26 916 406 257 285 895 117 59 369 424 133 16 417 352 440 806 236 478 34 889 469 540 806 172 296 73 655 261 792 868 380 204 454 330 53 136 629 236 850 134 560 264 291", "output": "2 29 27" }, { "input": "99\n175 269 828 129 499 890 127 263 995 807 508 289 996 226 437 320 365 642 757 22 190 8 345 499 834 713 962 889 336 171 608 492 320 257 472 801 176 325 301 306 198 729 933 4 640 322 226 317 567 586 249 237 202 633 287 128 911 654 719 988 420 855 361 574 716 899 317 356 581 440 284 982 541 111 439 29 37 560 961 224 478 906 319 416 736 603 808 87 762 697 392 713 19 459 262 238 239 599 997", "output": "1 44 30" }, { "input": "98\n443 719 559 672 16 69 529 632 953 999 725 431 54 22 346 968 558 696 48 669 963 129 257 712 39 870 498 595 45 821 344 925 179 388 792 346 755 213 423 365 344 659 824 356 773 637 628 897 841 155 243 536 951 361 192 105 418 431 635 596 150 162 145 548 473 531 750 306 377 354 450 975 79 743 656 733 440 940 19 139 237 346 276 227 64 799 479 633 199 17 796 362 517 234 729 62 995 535", "output": "2 70 40" }, { "input": "97\n359 522 938 862 181 600 283 1000 910 191 590 220 761 818 903 264 751 751 987 316 737 898 168 925 244 674 34 950 754 472 81 6 37 520 112 891 981 454 897 424 489 238 363 709 906 951 677 828 114 373 589 835 52 89 97 435 277 560 551 204 879 469 928 523 231 163 183 609 821 915 615 969 616 23 874 437 844 321 78 53 643 786 585 38 744 347 150 179 988 985 200 11 15 9 547 886 752", "output": "1 23 10" }, { "input": "4\n303 872 764 401", "output": "-1" }, { "input": "100\n328 397 235 453 188 254 879 225 423 36 384 296 486 592 231 849 856 255 213 898 234 800 701 529 951 693 507 326 15 905 618 348 967 927 28 979 752 850 343 35 84 302 36 390 482 826 249 918 91 289 973 457 557 348 365 239 709 565 320 560 153 130 647 708 483 469 788 473 322 844 830 562 611 961 397 673 69 960 74 703 369 968 382 451 328 160 211 230 566 208 7 545 293 73 806 375 157 410 303 58", "output": "1 79 6" }, { "input": "33\n52 145 137 734 180 847 178 286 716 134 181 630 358 764 593 762 785 28 1 468 189 540 764 485 165 656 114 58 628 108 605 584 257", "output": "8 30 7" }, { "input": "57\n75 291 309 68 444 654 985 158 514 204 116 918 374 806 176 31 49 455 269 66 722 713 164 818 317 295 546 564 134 641 28 13 987 478 146 219 213 940 289 173 157 666 168 391 392 71 870 477 446 988 414 568 964 684 409 671 454", "output": "2 41 29" }, { "input": "88\n327 644 942 738 84 118 981 686 530 404 137 197 434 16 693 183 423 325 410 345 941 329 7 106 79 867 584 358 533 675 192 718 641 329 900 768 404 301 101 538 954 590 401 954 447 14 559 337 756 586 934 367 538 928 945 936 770 641 488 579 206 869 902 139 216 446 723 150 829 205 373 578 357 368 960 40 121 206 503 385 521 161 501 694 138 370 709 308", "output": "1 77 61" }, { "input": "100\n804 510 266 304 788 625 862 888 408 82 414 470 777 991 729 229 933 406 601 1 596 720 608 706 432 361 527 548 59 548 474 515 4 991 263 568 681 24 117 563 576 587 281 643 904 521 891 106 842 884 943 54 605 815 504 757 311 374 335 192 447 652 633 410 455 402 382 150 432 836 413 819 669 875 638 925 217 805 632 520 605 266 728 795 162 222 603 159 284 790 914 443 775 97 789 606 859 13 851 47", "output": "1 77 42" }, { "input": "100\n449 649 615 713 64 385 927 466 138 126 143 886 80 199 208 43 196 694 92 89 264 180 617 970 191 196 910 150 275 89 693 190 191 99 542 342 45 592 114 56 451 170 64 589 176 102 308 92 402 153 414 675 352 157 69 150 91 288 163 121 816 184 20 234 836 12 593 150 793 439 540 93 99 663 186 125 349 247 476 106 77 523 215 7 363 278 441 745 337 25 148 384 15 915 108 211 240 58 23 408", "output": "1 6 5" }, { "input": "90\n881 436 52 308 97 261 153 931 670 538 702 156 114 445 154 685 452 76 966 790 93 42 547 65 736 364 136 489 719 322 239 628 696 735 55 703 622 375 100 188 804 341 546 474 484 446 729 290 974 301 602 225 996 244 488 983 882 460 962 754 395 617 61 640 534 292 158 375 632 902 420 979 379 38 100 67 963 928 190 456 545 571 45 716 153 68 844 2 102 116", "output": "1 14 2" }, { "input": "80\n313 674 262 240 697 146 391 221 793 504 896 818 92 899 86 370 341 339 306 887 937 570 830 683 729 519 240 833 656 847 427 958 435 704 853 230 758 347 660 575 843 293 649 396 437 787 654 599 35 103 779 783 447 379 444 585 902 713 791 150 851 228 306 721 996 471 617 403 102 168 197 741 877 481 968 545 331 715 236 654", "output": "1 13 8" }, { "input": "70\n745 264 471 171 946 32 277 511 269 469 89 831 69 2 369 407 583 602 646 633 429 747 113 302 722 321 344 824 241 372 263 287 822 24 652 758 246 967 219 313 882 597 752 965 389 775 227 556 95 904 308 340 899 514 400 187 275 318 621 546 659 488 199 154 811 1 725 79 925 82", "output": "1 63 60" }, { "input": "60\n176 502 680 102 546 917 516 801 392 435 635 492 398 456 653 444 472 513 634 378 273 276 44 920 68 124 800 167 825 250 452 264 561 344 98 933 381 939 426 51 568 548 206 887 342 763 151 514 156 354 486 546 998 649 356 438 295 570 450 589", "output": "2 26 20" }, { "input": "50\n608 92 889 33 146 803 402 91 868 400 828 505 375 558 584 129 361 776 974 123 765 804 326 186 61 927 904 511 762 775 640 593 300 664 897 461 869 911 986 789 607 500 309 457 294 104 724 471 216 155", "output": "3 25 11" }, { "input": "40\n40 330 98 612 747 336 640 381 991 366 22 167 352 12 868 166 603 40 313 869 609 981 609 804 54 729 8 854 347 300 828 922 39 633 695 988 4 530 545 176", "output": "5 10 8" }, { "input": "30\n471 920 308 544 347 222 878 671 467 332 215 180 681 114 151 203 492 951 653 614 453 510 540 422 399 532 113 198 932 825", "output": "2 21 9" }, { "input": "20\n551 158 517 475 595 108 764 961 590 297 761 841 659 568 82 888 733 214 993 359", "output": "3 20 2" }, { "input": "10\n983 748 726 406 196 993 2 251 66 263", "output": "-1" }, { "input": "9\n933 266 457 863 768 257 594 136 145", "output": "-1" }, { "input": "8\n537 198 48 771 944 868 700 163", "output": "7 8 1" }, { "input": "7\n140 779 639 679 768 479 158", "output": "2 3 1" }, { "input": "6\n744 359 230 586 944 442", "output": "-1" }, { "input": "5\n700 939 173 494 120", "output": "-1" }, { "input": "4\n303 872 764 401", "output": "-1" }, { "input": "3\n907 452 355", "output": "-1" }, { "input": "3\n963 630 333", "output": "1 3 2" }, { "input": "3\n2 2 4", "output": "3 2 1" }, { "input": "3\n2 4 100", "output": "-1" } ]
1,693,408,561
2,147,483,647
Python 3
OK
TESTS
39
372
0
n=int(input()) arr=[int(i) for i in input().split()] ansi=-1 ansj=-1 ansk=-1 for i in range(n): for j in range(n): for k in range(n): if arr[i]== arr[j]+ arr[k]and j!=k: ansi= i ansj= j ansk= k if ansi==-1: print(-1) else: print(ansi+1,ansj+1,ansk+1)
Title: Worms Evolution Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Professor Vasechkin is studying evolution of worms. Recently he put forward hypotheses that all worms evolve by division. There are *n* forms of worms. Worms of these forms have lengths *a*1, *a*2, ..., *a**n*. To prove his theory, professor needs to find 3 different forms that the length of the first form is equal to sum of lengths of the other two forms. Help him to do this. Input Specification: The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of worm's forms. The second line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=1000) — lengths of worms of each form. Output Specification: Output 3 distinct integers *i* *j* *k* (1<=≤<=*i*,<=*j*,<=*k*<=≤<=*n*) — such indexes of worm's forms that *a**i*<==<=*a**j*<=+<=*a**k*. If there is no such triple, output -1. If there are several solutions, output any of them. It possible that *a**j*<==<=*a**k*. Demo Input: ['5\n1 2 3 5 7\n', '5\n1 8 1 5 1\n'] Demo Output: ['3 2 1\n', '-1\n'] Note: none
```python n=int(input()) arr=[int(i) for i in input().split()] ansi=-1 ansj=-1 ansk=-1 for i in range(n): for j in range(n): for k in range(n): if arr[i]== arr[j]+ arr[k]and j!=k: ansi= i ansj= j ansk= k if ansi==-1: print(-1) else: print(ansi+1,ansj+1,ansk+1) ```
3.907
837
C
Two Seals
PROGRAMMING
1,500
[ "brute force", "implementation" ]
null
null
One very important person has a piece of paper in the form of a rectangle *a*<=×<=*b*. Also, he has *n* seals. Each seal leaves an impression on the paper in the form of a rectangle of the size *x**i*<=×<=*y**i*. Each impression must be parallel to the sides of the piece of paper (but seal can be rotated by 90 degrees). A very important person wants to choose two different seals and put them two impressions. Each of the selected seals puts exactly one impression. Impressions should not overlap (but they can touch sides), and the total area occupied by them should be the largest possible. What is the largest area that can be occupied by two seals?
The first line contains three integer numbers *n*, *a* and *b* (1<=≤<=*n*,<=*a*,<=*b*<=≤<=100). Each of the next *n* lines contain two numbers *x**i*, *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=100).
Print the largest total area that can be occupied by two seals. If you can not select two seals, print 0.
[ "2 2 2\n1 2\n2 1\n", "4 10 9\n2 3\n1 1\n5 10\n9 11\n", "3 10 10\n6 6\n7 7\n20 5\n" ]
[ "4\n", "56\n", "0\n" ]
In the first example you can rotate the second seal by 90 degrees. Then put impression of it right under the impression of the first seal. This will occupy all the piece of paper. In the second example you can't choose the last seal because it doesn't fit. By choosing the first and the third seals you occupy the largest area. In the third example there is no such pair of seals that they both can fit on a piece of paper.
0
[ { "input": "2 2 2\n1 2\n2 1", "output": "4" }, { "input": "4 10 9\n2 3\n1 1\n5 10\n9 11", "output": "56" }, { "input": "3 10 10\n6 6\n7 7\n20 5", "output": "0" }, { "input": "2 1 1\n1 1\n1 1", "output": "0" }, { "input": "2 1 2\n1 1\n1 1", "output": "2" }, { "input": "2 100 100\n100 100\n1 1", "output": "0" }, { "input": "2 100 100\n50 100\n100 50", "output": "10000" }, { "input": "2 100 100\n100 100\n87 72", "output": "0" }, { "input": "5 100 100\n100 100\n100 100\n100 100\n100 100\n100 100", "output": "0" }, { "input": "15 50 50\n9 36\n28 14\n77 74\n35 2\n20 32\n83 85\n47 3\n41 50\n21 7\n38 46\n17 6\n79 90\n91 83\n9 33\n24 11", "output": "2374" }, { "input": "15 100 100\n100 100\n100 100\n100 100\n42 58\n80 22\n100 100\n100 100\n100 100\n100 100\n100 100\n48 42\n100 100\n100 100\n100 100\n100 100", "output": "4452" }, { "input": "30 100 100\n60 34\n29 82\n89 77\n39 1\n100 100\n82 12\n57 87\n93 43\n78 50\n38 55\n37 9\n67 5\n100 100\n100 100\n82 47\n3 71\n100 100\n19 26\n25 94\n89 5\n100 100\n32 1\n100 100\n34 3\n40 99\n100 100\n36 12\n100 100\n100 100\n100 100", "output": "8958" }, { "input": "3 100 1\n1 50\n1 60\n1 30", "output": "90" }, { "input": "3 1 60\n1 40\n2 2\n20 1", "output": "60" }, { "input": "4 1 100\n1 25\n25 1\n1 25\n2 100", "output": "50" }, { "input": "1 100 50\n4 20", "output": "0" }, { "input": "2 2 4\n3 1\n2 2", "output": "0" }, { "input": "2 2 4\n2 3\n2 1", "output": "8" }, { "input": "2 4 2\n1 2\n2 3", "output": "8" }, { "input": "2 1 4\n1 2\n1 2", "output": "4" }, { "input": "2 4 5\n2 4\n4 3", "output": "20" }, { "input": "2 1 4\n1 1\n3 3", "output": "0" }, { "input": "6 9 5\n4 5\n6 2\n1 4\n5 6\n3 7\n6 5", "output": "34" }, { "input": "6 8 5\n4 1\n3 3\n5 3\n6 7\n2 2\n5 4", "output": "35" }, { "input": "6 7 5\n6 4\n5 7\n4 7\n5 4\n1 1\n3 6", "output": "29" }, { "input": "6 9 7\n1 2\n1 5\n4 3\n4 7\n3 5\n6 7", "output": "57" }, { "input": "6 5 9\n2 3\n7 4\n1 5\n1 7\n2 5\n7 1", "output": "38" }, { "input": "2 4 2\n2 2\n1 3", "output": "0" }, { "input": "2 3 2\n3 2\n1 1", "output": "0" }, { "input": "6 7 5\n6 6\n4 7\n6 1\n4 1\n4 6\n1 5", "output": "34" }, { "input": "2 2 3\n1 2\n2 3", "output": "0" }, { "input": "2 2 2\n2 1\n1 1", "output": "3" }, { "input": "5 9 7\n6 7\n4 5\n2 7\n4 2\n5 8", "output": "56" }, { "input": "2 11 51\n1 10\n11 50", "output": "560" }, { "input": "5 9 7\n3 8\n7 6\n4 1\n5 8\n7 8", "output": "60" }, { "input": "2 4 6\n4 4\n4 2", "output": "24" }, { "input": "5 9 7\n1 6\n7 9\n1 5\n1 5\n7 3", "output": "27" }, { "input": "5 9 7\n5 2\n6 9\n1 4\n7 7\n6 4", "output": "59" }, { "input": "5 9 7\n6 7\n4 1\n1 2\n4 7\n5 6", "output": "58" }, { "input": "5 9 7\n2 8\n3 8\n2 8\n4 4\n2 2", "output": "40" }, { "input": "2 2 3\n1 4\n2 1", "output": "0" }, { "input": "5 9 7\n4 7\n3 9\n5 4\n3 4\n3 8", "output": "55" }, { "input": "5 9 7\n7 4\n6 9\n4 3\n7 5\n2 3", "output": "63" }, { "input": "2 2 3\n1 2\n2 2", "output": "6" }, { "input": "2 4 3\n2 1\n1 2", "output": "4" }, { "input": "2 4 6\n4 2\n4 4", "output": "24" }, { "input": "2 1 4\n3 2\n3 3", "output": "0" } ]
1,501,777,149
3,849
Python 3
OK
TESTS
51
93
4,915,200
def main(): n, a, b = [int(t) for t in input().split()] points = [] for _ in range(n): point = [int(t) for t in input().split()] points.append(point) largest_area = 0 for i, (x1, y1) in enumerate(points): for j, (x2, y2) in enumerate(points): if i == j: continue if satisfy(x1, y1, x2, y2, a, b): area = x1 * y1 + x2 * y2 largest_area = max(area, largest_area) print(largest_area) def satisfy(x1, y1, x2, y2, a, b): if satisfy_single(max((x1, x2)), sum((y1, y2)), a, b): return True if satisfy_single(sum((x1, x2)), max((y1, y2)), a, b): return True if satisfy_single(max((x1, y2)), sum((y1, x2)), a, b): return True if satisfy_single(sum((x1, y2)), max((y1, x2)), a, b): return True if satisfy_single(max((y1, x2)), sum((x1, y2)), a, b): return True if satisfy_single(sum((y1, x2)), max((x1, y2)), a, b): return True return False def satisfy_single(x, y, a, b): if x <= a and y <= b: return True if x <= b and y <= a: return True return False if __name__ == '__main__': main()
Title: Two Seals Time Limit: None seconds Memory Limit: None megabytes Problem Description: One very important person has a piece of paper in the form of a rectangle *a*<=×<=*b*. Also, he has *n* seals. Each seal leaves an impression on the paper in the form of a rectangle of the size *x**i*<=×<=*y**i*. Each impression must be parallel to the sides of the piece of paper (but seal can be rotated by 90 degrees). A very important person wants to choose two different seals and put them two impressions. Each of the selected seals puts exactly one impression. Impressions should not overlap (but they can touch sides), and the total area occupied by them should be the largest possible. What is the largest area that can be occupied by two seals? Input Specification: The first line contains three integer numbers *n*, *a* and *b* (1<=≤<=*n*,<=*a*,<=*b*<=≤<=100). Each of the next *n* lines contain two numbers *x**i*, *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=100). Output Specification: Print the largest total area that can be occupied by two seals. If you can not select two seals, print 0. Demo Input: ['2 2 2\n1 2\n2 1\n', '4 10 9\n2 3\n1 1\n5 10\n9 11\n', '3 10 10\n6 6\n7 7\n20 5\n'] Demo Output: ['4\n', '56\n', '0\n'] Note: In the first example you can rotate the second seal by 90 degrees. Then put impression of it right under the impression of the first seal. This will occupy all the piece of paper. In the second example you can't choose the last seal because it doesn't fit. By choosing the first and the third seals you occupy the largest area. In the third example there is no such pair of seals that they both can fit on a piece of paper.
```python def main(): n, a, b = [int(t) for t in input().split()] points = [] for _ in range(n): point = [int(t) for t in input().split()] points.append(point) largest_area = 0 for i, (x1, y1) in enumerate(points): for j, (x2, y2) in enumerate(points): if i == j: continue if satisfy(x1, y1, x2, y2, a, b): area = x1 * y1 + x2 * y2 largest_area = max(area, largest_area) print(largest_area) def satisfy(x1, y1, x2, y2, a, b): if satisfy_single(max((x1, x2)), sum((y1, y2)), a, b): return True if satisfy_single(sum((x1, x2)), max((y1, y2)), a, b): return True if satisfy_single(max((x1, y2)), sum((y1, x2)), a, b): return True if satisfy_single(sum((x1, y2)), max((y1, x2)), a, b): return True if satisfy_single(max((y1, x2)), sum((x1, y2)), a, b): return True if satisfy_single(sum((y1, x2)), max((x1, y2)), a, b): return True return False def satisfy_single(x, y, a, b): if x <= a and y <= b: return True if x <= b and y <= a: return True return False if __name__ == '__main__': main() ```
3
900
B
Position in Fraction
PROGRAMMING
1,300
[ "math", "number theory" ]
null
null
You have a fraction . You need to find the first occurrence of digit *c* into decimal notation of the fraction after decimal point.
The first contains three single positive integers *a*, *b*, *c* (1<=≤<=*a*<=&lt;<=*b*<=≤<=105, 0<=≤<=*c*<=≤<=9).
Print position of the first occurrence of digit *c* into the fraction. Positions are numbered from 1 after decimal point. It there is no such position, print -1.
[ "1 2 0\n", "2 3 7\n" ]
[ "2", "-1" ]
The fraction in the first example has the following decimal notation: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/896357459a466614a0542f34c9cfb0cef1afc9ed.png" style="max-width: 100.0%;max-height: 100.0%;"/>. The first zero stands on second position. The fraction in the second example has the following decimal notation: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/130ba579a8276fc53a1917606eee9db58817f28d.png" style="max-width: 100.0%;max-height: 100.0%;"/>. There is no digit 7 in decimal notation of the fraction.
1,000
[ { "input": "1 2 0", "output": "2" }, { "input": "2 3 7", "output": "-1" }, { "input": "1 100000 1", "output": "5" }, { "input": "1 7 7", "output": "6" }, { "input": "99999 100000 8", "output": "-1" }, { "input": "44102 73848 2", "output": "132" }, { "input": "7 31 3", "output": "15" }, { "input": "8880 81608 9", "output": "161" }, { "input": "4942 62768 5", "output": "122" }, { "input": "69168 84860 4", "output": "107" }, { "input": "971 1883 3", "output": "130" }, { "input": "1636 3269 6", "output": "150" }, { "input": "6873 7769 3", "output": "163" }, { "input": "13805 15538 3", "output": "164" }, { "input": "10958 21926 3", "output": "117" }, { "input": "8 51 0", "output": "10" }, { "input": "1 10 1", "output": "1" }, { "input": "1 9 0", "output": "-1" }, { "input": "53 101 6", "output": "-1" }, { "input": "1 10001 9", "output": "5" }, { "input": "25102 31579 2", "output": "174" }, { "input": "38790 39359 0", "output": "212" }, { "input": "47117 78718 0", "output": "213" }, { "input": "1 57 0", "output": "1" }, { "input": "1 3 0", "output": "-1" }, { "input": "1 100 0", "output": "1" }, { "input": "2 3 0", "output": "-1" }, { "input": "99971 99989 0", "output": "9" }, { "input": "567 1580 0", "output": "6" }, { "input": "45 97 0", "output": "39" }, { "input": "35 111 4", "output": "-1" }, { "input": "1 2 5", "output": "1" }, { "input": "1 7 0", "output": "-1" } ]
1,572,700,064
2,147,483,647
Python 3
OK
TESTS
33
124
0
a,b,c=map(int,input().split()) a%=b k=0 for i in range(1,b+1): a*=10 if int(a/b)==c: print(i) k+=1 break a%=b if k==0: print(-1)
Title: Position in Fraction Time Limit: None seconds Memory Limit: None megabytes Problem Description: You have a fraction . You need to find the first occurrence of digit *c* into decimal notation of the fraction after decimal point. Input Specification: The first contains three single positive integers *a*, *b*, *c* (1<=≤<=*a*<=&lt;<=*b*<=≤<=105, 0<=≤<=*c*<=≤<=9). Output Specification: Print position of the first occurrence of digit *c* into the fraction. Positions are numbered from 1 after decimal point. It there is no such position, print -1. Demo Input: ['1 2 0\n', '2 3 7\n'] Demo Output: ['2', '-1'] Note: The fraction in the first example has the following decimal notation: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/896357459a466614a0542f34c9cfb0cef1afc9ed.png" style="max-width: 100.0%;max-height: 100.0%;"/>. The first zero stands on second position. The fraction in the second example has the following decimal notation: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/130ba579a8276fc53a1917606eee9db58817f28d.png" style="max-width: 100.0%;max-height: 100.0%;"/>. There is no digit 7 in decimal notation of the fraction.
```python a,b,c=map(int,input().split()) a%=b k=0 for i in range(1,b+1): a*=10 if int(a/b)==c: print(i) k+=1 break a%=b if k==0: print(-1) ```
3
618
C
Constellation
PROGRAMMING
1,600
[ "geometry", "implementation" ]
null
null
Cat Noku has obtained a map of the night sky. On this map, he found a constellation with *n* stars numbered from 1 to *n*. For each *i*, the *i*-th star is located at coordinates (*x**i*,<=*y**i*). No two stars are located at the same position. In the evening Noku is going to take a look at the night sky. He would like to find three distinct stars and form a triangle. The triangle must have positive area. In addition, all other stars must lie strictly outside of this triangle. He is having trouble finding the answer and would like your help. Your job is to find the indices of three stars that would form a triangle that satisfies all the conditions. It is guaranteed that there is no line such that all stars lie on that line. It can be proven that if the previous condition is satisfied, there exists a solution to this problem.
The first line of the input contains a single integer *n* (3<=≤<=*n*<=≤<=100<=000). Each of the next *n* lines contains two integers *x**i* and *y**i* (<=-<=109<=≤<=*x**i*,<=*y**i*<=≤<=109). It is guaranteed that no two stars lie at the same point, and there does not exist a line such that all stars lie on that line.
Print three distinct integers on a single line — the indices of the three points that form a triangle that satisfies the conditions stated in the problem. If there are multiple possible answers, you may print any of them.
[ "3\n0 1\n1 0\n1 1\n", "5\n0 0\n0 2\n2 0\n2 2\n1 1\n" ]
[ "1 2 3\n", "1 3 5\n" ]
In the first sample, we can print the three indices in any order. In the second sample, we have the following picture. Note that the triangle formed by starts 1, 4 and 3 doesn't satisfy the conditions stated in the problem, as point 5 is not strictly outside of this triangle (it lies on it's border).
1,500
[ { "input": "3\n0 1\n1 0\n1 1", "output": "1 2 3" }, { "input": "5\n0 0\n0 2\n2 0\n2 2\n1 1", "output": "1 3 5" }, { "input": "3\n819934317 939682125\n487662889 8614219\n-557136619 382982369", "output": "1 3 2" }, { "input": "10\n25280705 121178189\n219147240 -570920213\n-829849659 923854124\n18428128 -781819137\n-876779400 528386329\n-780997681 387686853\n-101900553 749998368\n58277314 355353788\n732128908 336416193\n840698381 600685123", "output": "1 3 2" }, { "input": "10\n404775998 670757742\n30131431 723806809\n25599613 633170449\n13303280 387243789\n-33017802 -539177851\n1425218 149682549\n-47620079 -831223391\n-25996011 -398742031\n38471092 890600029\n-3745401 46270169", "output": "1 2 3" }, { "input": "10\n13303280 387243789\n30131431 723806809\n404775998 670757742\n-25996011 -398742031\n25599613 633170449\n38471092 890600029\n-33017802 -539177851\n-47620079 -831223391\n1425218 149682549\n-3745401 46270169", "output": "1 3 5" }, { "input": "10\n999999999 1\n999999998 1\n999999997 1\n1000000000 1\n999999996 1\n999999995 1\n999999994 1\n999999992 1\n999999993 1\n0 0", "output": "1 2 10" }, { "input": "4\n0 1\n0 2\n0 3\n7 7", "output": "1 4 2" }, { "input": "3\n0 0\n999999999 1\n999999998 1", "output": "1 2 3" }, { "input": "10\n0 999999999\n0 1000000000\n-1 1000000000\n1 1000000000\n-2 1000000000\n2 1000000000\n-3 1000000000\n3 1000000000\n-4 1000000000\n4 1000000000", "output": "1 2 3" }, { "input": "12\n1000000000 0\n1000000000 1\n1000000000 2\n1000000000 3\n1000000000 4\n1000000000 5\n1000000000 6\n1000000000 7\n1000000000 8\n1000000000 9\n1000000000 10\n999999999 5", "output": "1 2 12" }, { "input": "12\n1000000000 0\n1000000000 1\n1000000000 2\n1000000000 3\n1000000000 4\n1000000000 5\n1000000000 6\n1000000000 7\n1000000000 8\n1000000000 9\n1000000000 10\n999999999 -1", "output": "1 2 12" }, { "input": "12\n1000000000 0\n1000000000 1\n1000000000 2\n1000000000 3\n1000000000 4\n1000000000 5\n1000000000 6\n1000000000 7\n1000000000 8\n1000000000 9\n1000000000 10\n999999999 10", "output": "1 2 12" }, { "input": "12\n1000000000 0\n1000000000 1\n1000000000 2\n1000000000 3\n1000000000 4\n1000000000 5\n1000000000 6\n1000000000 7\n1000000000 8\n1000000000 9\n1000000000 10\n999999999 1", "output": "1 2 12" }, { "input": "11\n-1000000000 1\n-1000000000 2\n-1000000000 3\n-1000000000 4\n-1000000000 5\n-1000000000 6\n-1000000000 7\n-1000000000 8\n-1000000000 9\n-1000000000 10\n-999999999 5", "output": "1 11 2" }, { "input": "11\n-1000000000 1\n-1000000000 2\n-1000000000 3\n-1000000000 4\n-1000000000 5\n-1000000000 6\n-1000000000 7\n-1000000000 8\n-1000000000 9\n-1000000000 10\n-999999999 7", "output": "1 11 2" }, { "input": "11\n-1000000000 1\n-1000000000 2\n-1000000000 3\n-1000000000 4\n-1000000000 5\n-1000000000 6\n-1000000000 7\n-1000000000 8\n-1000000000 9\n-1000000000 10\n-999999999 8", "output": "1 11 2" }, { "input": "11\n-1000000000 1\n-1000000000 2\n-1000000000 3\n-1000000000 4\n-1000000000 5\n-1000000000 6\n-1000000000 7\n-1000000000 8\n-1000000000 9\n-1000000000 10\n-999999999 10", "output": "1 11 2" }, { "input": "11\n-1000000000 -1\n-1000000000 -2\n-1000000000 -3\n-1000000000 -4\n-1000000000 -5\n-1000000000 -6\n-1000000000 -7\n-1000000000 -8\n-1000000000 -9\n-1000000000 -10\n-999999999 -5", "output": "1 2 11" }, { "input": "11\n-1000000000 -1\n-1000000000 -2\n-1000000000 -3\n-1000000000 -4\n-1000000000 -5\n-1000000000 -6\n-1000000000 -7\n-1000000000 -8\n-1000000000 -9\n-1000000000 -10\n-999999999 -1", "output": "1 2 11" }, { "input": "11\n-1000000000 -1\n-1000000000 -2\n-1000000000 -3\n-1000000000 -4\n-1000000000 -5\n-1000000000 -6\n-1000000000 -7\n-1000000000 -8\n-1000000000 -9\n-1000000000 -10\n-999999999 -2", "output": "1 2 11" }, { "input": "11\n-1000000000 -1\n-1000000000 -2\n-1000000000 -3\n-1000000000 -4\n-1000000000 -5\n-1000000000 -6\n-1000000000 -7\n-1000000000 -8\n-1000000000 -9\n-1000000000 -10\n-999999999 -4", "output": "1 2 11" }, { "input": "11\n-1000000000 -1\n-1000000000 -2\n-1000000000 -3\n-1000000000 -4\n-1000000000 -5\n-1000000000 -6\n-1000000000 -7\n-1000000000 -8\n-1000000000 -9\n-1000000000 -10\n-999999999 -8", "output": "1 2 11" }, { "input": "10\n2 1000000000\n8 1000000000\n9 1000000000\n3 1000000000\n4 1000000000\n5 1000000000\n6 1000000000\n1 1000000000\n7 1000000000\n0 0", "output": "1 10 4" }, { "input": "10\n1000000000 1\n999999999 1\n999999998 1\n999999997 1\n999999996 1\n999999995 1\n999999994 1\n999999993 1\n999999992 1\n0 0", "output": "1 2 10" }, { "input": "10\n999999999 1\n999999998 1\n999999997 1\n999999996 1\n999999995 1\n999999994 1\n999999993 1\n1000000000 1\n999999992 1\n0 0", "output": "1 2 10" }, { "input": "4\n0 0\n1 0\n2 0\n1 100", "output": "1 2 4" }, { "input": "4\n0 0\n3 0\n2 0\n1 1", "output": "3 2 4" }, { "input": "4\n0 0\n1 1\n2 2\n3 4", "output": "1 2 4" }, { "input": "4\n0 0\n0 1\n0 2\n1 1", "output": "1 4 2" }, { "input": "4\n0 0\n2 0\n1 0\n1 1", "output": "3 2 4" }, { "input": "4\n0 0\n1 1\n2 2\n5 -1", "output": "1 4 2" }, { "input": "5\n0 1\n0 2\n0 3\n0 4\n10 10", "output": "1 5 2" }, { "input": "4\n0 1\n0 2\n0 3\n1 1", "output": "1 4 2" }, { "input": "4\n0 0\n1 0\n2 0\n2 1", "output": "1 2 4" }, { "input": "4\n0 0\n-1 -1\n1 1\n100 0", "output": "1 2 4" }, { "input": "4\n0 0\n2 0\n1 1\n1 0", "output": "4 2 3" }, { "input": "4\n0 0\n1 0\n2 0\n3 1", "output": "1 2 4" }, { "input": "3\n0 0\n12345691 12336918\n19349510 19335760", "output": "1 3 2" }, { "input": "21\n0 19\n0 0\n0 8\n0 2\n0 18\n0 17\n0 1\n0 5\n0 16\n0 11\n0 10\n0 13\n0 12\n0 14\n0 6\n0 7\n0 3\n0 15\n0 4\n0 9\n1 1", "output": "7 2 21" }, { "input": "10\n0 0\n1 -100\n1 100\n1 50\n1 0\n1 -50\n1 10\n1 -10\n1 5\n1 -5", "output": "1 2 6" }, { "input": "3\n1 2\n2 1\n2 3", "output": "1 2 3" }, { "input": "3\n-1000000000 -1000000000\n1000000000 -1000000000\n-1000000000 1000000000", "output": "1 2 3" }, { "input": "10\n0 0\n1 0\n2 0\n3 0\n4 0\n5 0\n6 0\n7 0\n8 1\n9 0", "output": "1 2 9" }, { "input": "4\n1 1\n2 2\n3 3\n10 11", "output": "1 2 4" }, { "input": "4\n0 0\n0 2\n0 1\n3 3", "output": "1 4 3" }, { "input": "4\n0 0\n2 2\n1 1\n2 0", "output": "1 4 3" }, { "input": "4\n0 1\n0 0\n0 5\n1 1", "output": "1 2 4" }, { "input": "4\n1 0\n2 0\n3 0\n-7 -7", "output": "1 4 2" }, { "input": "4\n0 0\n0 2\n0 1\n10 10", "output": "1 4 3" }, { "input": "4\n-50000000 204926\n0 0\n8192 50000000\n16384 100000000", "output": "1 2 3" }, { "input": "4\n65537 536870912\n0 536805376\n1 536870912\n-8191 0", "output": "1 3 2" }, { "input": "4\n0 0\n131072 0\n131072 131072\n200000 0", "output": "1 2 3" }, { "input": "3\n-536870912 10\n536870912 11\n-536870912 6", "output": "1 3 2" }, { "input": "4\n3 7\n2 4\n1 2\n0 0", "output": "1 3 2" }, { "input": "4\n0 0\n0 1\n0 2\n3 3", "output": "1 4 2" } ]
1,454,133,412
2,147,483,647
Python 3
OK
TESTS
98
748
13,004,800
n = int(input()) points = [list(map(int, input().split(' ')))+[i+1] for i in range(n)] points.sort() i, j, k = 0, 1, 2 while True: if points[i][0] == points[j][0] and points[j][0] == points[k][0]: k += 1 elif points[i][0] != points[j][0] and points[i][0] != points[k][0] and\ (points[j][1]-points[i][1])/(points[j][0]-points[i][0]) == (points[k][1]-points[i][1])/(points[k][0]-points[i][0]): k += 1 else: break print(points[i][2], points[j][2], points[k][2])
Title: Constellation Time Limit: None seconds Memory Limit: None megabytes Problem Description: Cat Noku has obtained a map of the night sky. On this map, he found a constellation with *n* stars numbered from 1 to *n*. For each *i*, the *i*-th star is located at coordinates (*x**i*,<=*y**i*). No two stars are located at the same position. In the evening Noku is going to take a look at the night sky. He would like to find three distinct stars and form a triangle. The triangle must have positive area. In addition, all other stars must lie strictly outside of this triangle. He is having trouble finding the answer and would like your help. Your job is to find the indices of three stars that would form a triangle that satisfies all the conditions. It is guaranteed that there is no line such that all stars lie on that line. It can be proven that if the previous condition is satisfied, there exists a solution to this problem. Input Specification: The first line of the input contains a single integer *n* (3<=≤<=*n*<=≤<=100<=000). Each of the next *n* lines contains two integers *x**i* and *y**i* (<=-<=109<=≤<=*x**i*,<=*y**i*<=≤<=109). It is guaranteed that no two stars lie at the same point, and there does not exist a line such that all stars lie on that line. Output Specification: Print three distinct integers on a single line — the indices of the three points that form a triangle that satisfies the conditions stated in the problem. If there are multiple possible answers, you may print any of them. Demo Input: ['3\n0 1\n1 0\n1 1\n', '5\n0 0\n0 2\n2 0\n2 2\n1 1\n'] Demo Output: ['1 2 3\n', '1 3 5\n'] Note: In the first sample, we can print the three indices in any order. In the second sample, we have the following picture. Note that the triangle formed by starts 1, 4 and 3 doesn't satisfy the conditions stated in the problem, as point 5 is not strictly outside of this triangle (it lies on it's border).
```python n = int(input()) points = [list(map(int, input().split(' ')))+[i+1] for i in range(n)] points.sort() i, j, k = 0, 1, 2 while True: if points[i][0] == points[j][0] and points[j][0] == points[k][0]: k += 1 elif points[i][0] != points[j][0] and points[i][0] != points[k][0] and\ (points[j][1]-points[i][1])/(points[j][0]-points[i][0]) == (points[k][1]-points[i][1])/(points[k][0]-points[i][0]): k += 1 else: break print(points[i][2], points[j][2], points[k][2]) ```
3
688
B
Lovely Palindromes
PROGRAMMING
1,000
[ "constructive algorithms", "math" ]
null
null
Pari has a friend who loves palindrome numbers. A palindrome number is a number that reads the same forward or backward. For example 12321, 100001 and 1 are palindrome numbers, while 112 and 1021 are not. Pari is trying to love them too, but only very special and gifted people can understand the beauty behind palindrome numbers. Pari loves integers with even length (i.e. the numbers with even number of digits), so she tries to see a lot of big palindrome numbers with even length (like a 2-digit 11 or 6-digit 122221), so maybe she could see something in them. Now Pari asks you to write a program that gets a huge integer *n* from the input and tells what is the *n*-th even-length positive palindrome number?
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=10100<=000).
Print the *n*-th even-length palindrome number.
[ "1\n", "10\n" ]
[ "11\n", "1001\n" ]
The first 10 even-length palindrome numbers are 11, 22, 33, ... , 88, 99 and 1001.
1,000
[ { "input": "1", "output": "11" }, { "input": "10", "output": "1001" }, { "input": "11", "output": "1111" }, { "input": "12", "output": "1221" }, { "input": "100", "output": "100001" }, { "input": "1321", "output": "13211231" }, { "input": "2", "output": "22" }, { "input": "3", "output": "33" }, { "input": "4", "output": "44" }, { "input": "5", "output": "55" }, { "input": "6", "output": "66" }, { "input": "7", "output": "77" }, { "input": "8", "output": "88" }, { "input": "9", "output": "99" }, { "input": "13", "output": "1331" }, { "input": "14", "output": "1441" }, { "input": "15", "output": "1551" }, { "input": "16", "output": "1661" }, { "input": "17", "output": "1771" }, { "input": "18", "output": "1881" }, { "input": "19", "output": "1991" }, { "input": "20", "output": "2002" }, { "input": "26550", "output": "2655005562" }, { "input": "16137", "output": "1613773161" }, { "input": "91471", "output": "9147117419" }, { "input": "41242", "output": "4124224214" }, { "input": "30866", "output": "3086666803" }, { "input": "4442231232741003009964183199713851566466079882929007253443848371978048610682180431295671905105980116", "output": "44422312327410030099641831997138515664660798829290072534438483719780486106821804312956719051059801166110895015091765921340812860168408791738483443527009292889706646651583179913814699003001472321322444" }, { "input": "7806526084732010742850470902979267046151204705563201965818390803445852115032119297648697933316807252", "output": "78065260847320107428504709029792670461512047055632019658183908034458521150321192976486979333168072522527086133397968467929112305112585443080938185691023655074021516407629792090740582470102374806256087" }, { "input": "2244399823612183124978103773977739948197709395321563148611877999503840818596183803323258317041875913", "output": "22443998236121831249781037739777399481977093953215631486118779995038408185961838033232583170418759133195781407138523233083816958180483059997781168413651235939077918499377793773018794213812163289934422" }, { "input": "123451", "output": "123451154321" } ]
1,610,494,577
2,147,483,647
Python 3
OK
TESTS
40
92
921,600
n = str(input()) res = n for j in range(len(n) - 1, -1, -1): res += n[j] print(res)
Title: Lovely Palindromes Time Limit: None seconds Memory Limit: None megabytes Problem Description: Pari has a friend who loves palindrome numbers. A palindrome number is a number that reads the same forward or backward. For example 12321, 100001 and 1 are palindrome numbers, while 112 and 1021 are not. Pari is trying to love them too, but only very special and gifted people can understand the beauty behind palindrome numbers. Pari loves integers with even length (i.e. the numbers with even number of digits), so she tries to see a lot of big palindrome numbers with even length (like a 2-digit 11 or 6-digit 122221), so maybe she could see something in them. Now Pari asks you to write a program that gets a huge integer *n* from the input and tells what is the *n*-th even-length positive palindrome number? Input Specification: The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=10100<=000). Output Specification: Print the *n*-th even-length palindrome number. Demo Input: ['1\n', '10\n'] Demo Output: ['11\n', '1001\n'] Note: The first 10 even-length palindrome numbers are 11, 22, 33, ... , 88, 99 and 1001.
```python n = str(input()) res = n for j in range(len(n) - 1, -1, -1): res += n[j] print(res) ```
3
47
A
Triangular numbers
PROGRAMMING
800
[ "brute force", "math" ]
A. Triangular numbers
2
256
A triangular number is the number of dots in an equilateral triangle uniformly filled with dots. For example, three dots can be arranged in a triangle; thus three is a triangular number. The *n*-th triangular number is the number of dots in a triangle with *n* dots on a side. . You can learn more about these numbers from Wikipedia (http://en.wikipedia.org/wiki/Triangular_number). Your task is to find out if a given integer is a triangular number.
The first line contains the single number *n* (1<=≤<=*n*<=≤<=500) — the given integer.
If the given integer is a triangular number output YES, otherwise output NO.
[ "1\n", "2\n", "3\n" ]
[ "YES\n", "NO\n", "YES\n" ]
none
500
[ { "input": "1", "output": "YES" }, { "input": "2", "output": "NO" }, { "input": "3", "output": "YES" }, { "input": "4", "output": "NO" }, { "input": "5", "output": "NO" }, { "input": "6", "output": "YES" }, { "input": "7", "output": "NO" }, { "input": "8", "output": "NO" }, { "input": "12", "output": "NO" }, { "input": "10", "output": "YES" }, { "input": "11", "output": "NO" }, { "input": "9", "output": "NO" }, { "input": "14", "output": "NO" }, { "input": "15", "output": "YES" }, { "input": "16", "output": "NO" }, { "input": "20", "output": "NO" }, { "input": "21", "output": "YES" }, { "input": "22", "output": "NO" }, { "input": "121", "output": "NO" }, { "input": "135", "output": "NO" }, { "input": "136", "output": "YES" }, { "input": "137", "output": "NO" }, { "input": "152", "output": "NO" }, { "input": "153", "output": "YES" }, { "input": "154", "output": "NO" }, { "input": "171", "output": "YES" }, { "input": "189", "output": "NO" }, { "input": "190", "output": "YES" }, { "input": "191", "output": "NO" }, { "input": "210", "output": "YES" }, { "input": "211", "output": "NO" }, { "input": "231", "output": "YES" }, { "input": "232", "output": "NO" }, { "input": "252", "output": "NO" }, { "input": "253", "output": "YES" }, { "input": "254", "output": "NO" }, { "input": "275", "output": "NO" }, { "input": "276", "output": "YES" }, { "input": "277", "output": "NO" }, { "input": "299", "output": "NO" }, { "input": "300", "output": "YES" }, { "input": "301", "output": "NO" }, { "input": "324", "output": "NO" }, { "input": "325", "output": "YES" }, { "input": "326", "output": "NO" }, { "input": "350", "output": "NO" }, { "input": "351", "output": "YES" }, { "input": "352", "output": "NO" }, { "input": "377", "output": "NO" }, { "input": "378", "output": "YES" }, { "input": "406", "output": "YES" }, { "input": "434", "output": "NO" }, { "input": "435", "output": "YES" }, { "input": "464", "output": "NO" }, { "input": "465", "output": "YES" }, { "input": "495", "output": "NO" }, { "input": "496", "output": "YES" }, { "input": "497", "output": "NO" }, { "input": "331", "output": "NO" }, { "input": "413", "output": "NO" }, { "input": "177", "output": "NO" }, { "input": "122", "output": "NO" }, { "input": "478", "output": "NO" }, { "input": "188", "output": "NO" }, { "input": "21", "output": "YES" }, { "input": "474", "output": "NO" }, { "input": "21", "output": "YES" }, { "input": "48", "output": "NO" }, { "input": "498", "output": "NO" }, { "input": "499", "output": "NO" }, { "input": "500", "output": "NO" } ]
1,603,055,334
2,147,483,647
Python 3
OK
TESTS
71
218
0
n=int(input()) sol="NO" # n(n+1)/2=tn for i in range(n+1): if int(i*(i+1)/2)==n: sol="YES" break print(sol)
Title: Triangular numbers Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A triangular number is the number of dots in an equilateral triangle uniformly filled with dots. For example, three dots can be arranged in a triangle; thus three is a triangular number. The *n*-th triangular number is the number of dots in a triangle with *n* dots on a side. . You can learn more about these numbers from Wikipedia (http://en.wikipedia.org/wiki/Triangular_number). Your task is to find out if a given integer is a triangular number. Input Specification: The first line contains the single number *n* (1<=≤<=*n*<=≤<=500) — the given integer. Output Specification: If the given integer is a triangular number output YES, otherwise output NO. Demo Input: ['1\n', '2\n', '3\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n'] Note: none
```python n=int(input()) sol="NO" # n(n+1)/2=tn for i in range(n+1): if int(i*(i+1)/2)==n: sol="YES" break print(sol) ```
3.9455
965
A
Paper Airplanes
PROGRAMMING
800
[ "math" ]
null
null
To make a paper airplane, one has to use a rectangular piece of paper. From a sheet of standard size you can make $s$ airplanes. A group of $k$ people decided to make $n$ airplanes each. They are going to buy several packs of paper, each of them containing $p$ sheets, and then distribute the sheets between the people. Each person should have enough sheets to make $n$ airplanes. How many packs should they buy?
The only line contains four integers $k$, $n$, $s$, $p$ ($1 \le k, n, s, p \le 10^4$) — the number of people, the number of airplanes each should make, the number of airplanes that can be made using one sheet and the number of sheets in one pack, respectively.
Print a single integer — the minimum number of packs they should buy.
[ "5 3 2 3\n", "5 3 100 1\n" ]
[ "4\n", "5\n" ]
In the first sample they have to buy $4$ packs of paper: there will be $12$ sheets in total, and giving $2$ sheets to each person is enough to suit everyone's needs. In the second sample they have to buy a pack for each person as they can't share sheets.
500
[ { "input": "5 3 2 3", "output": "4" }, { "input": "5 3 100 1", "output": "5" }, { "input": "10000 10000 1 1", "output": "100000000" }, { "input": "1 1 10000 10000", "output": "1" }, { "input": "300 300 21 23", "output": "196" }, { "input": "300 2 37 51", "output": "6" }, { "input": "2 400 23 57", "output": "1" }, { "input": "1 1 1 1", "output": "1" }, { "input": "10000 10000 3 2", "output": "16670000" }, { "input": "1 2 1 2", "output": "1" }, { "input": "1 1 2 2", "output": "1" }, { "input": "1 1 10 10", "output": "1" }, { "input": "5324 5439 32 13", "output": "69622" }, { "input": "9000 1 2432 1", "output": "9000" }, { "input": "230 1234 9124 23", "output": "10" }, { "input": "11 1 1 1", "output": "11" }, { "input": "6246 8489 1227 9", "output": "4858" }, { "input": "9 20 5 7", "output": "6" } ]
1,668,142,673
2,147,483,647
PyPy 3-64
OK
TESTS
18
62
0
from math import ceil k,n,s,p = map(float,input().split()) print(ceil((ceil(n/s)*k)/p))
Title: Paper Airplanes Time Limit: None seconds Memory Limit: None megabytes Problem Description: To make a paper airplane, one has to use a rectangular piece of paper. From a sheet of standard size you can make $s$ airplanes. A group of $k$ people decided to make $n$ airplanes each. They are going to buy several packs of paper, each of them containing $p$ sheets, and then distribute the sheets between the people. Each person should have enough sheets to make $n$ airplanes. How many packs should they buy? Input Specification: The only line contains four integers $k$, $n$, $s$, $p$ ($1 \le k, n, s, p \le 10^4$) — the number of people, the number of airplanes each should make, the number of airplanes that can be made using one sheet and the number of sheets in one pack, respectively. Output Specification: Print a single integer — the minimum number of packs they should buy. Demo Input: ['5 3 2 3\n', '5 3 100 1\n'] Demo Output: ['4\n', '5\n'] Note: In the first sample they have to buy $4$ packs of paper: there will be $12$ sheets in total, and giving $2$ sheets to each person is enough to suit everyone's needs. In the second sample they have to buy a pack for each person as they can't share sheets.
```python from math import ceil k,n,s,p = map(float,input().split()) print(ceil((ceil(n/s)*k)/p)) ```
3
32
B
Borze
PROGRAMMING
800
[ "expression parsing", "implementation" ]
B. Borze
2
256
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
Output the decoded ternary number. It can have leading zeroes.
[ ".-.--\n", "--.\n", "-..-.--\n" ]
[ "012", "20", "1012" ]
none
1,000
[ { "input": ".-.--", "output": "012" }, { "input": "--.", "output": "20" }, { "input": "-..-.--", "output": "1012" }, { "input": "---..", "output": "210" }, { "input": "..--.---..", "output": "0020210" }, { "input": "-.....----.", "output": "10000220" }, { "input": ".", "output": "0" }, { "input": "-.", "output": "1" }, { "input": "--", "output": "2" }, { "input": "..", "output": "00" }, { "input": "--.", "output": "20" }, { "input": ".--.", "output": "020" }, { "input": ".-.-..", "output": "0110" }, { "input": "----.-.", "output": "2201" }, { "input": "-..--.-.", "output": "10201" }, { "input": "..--..--.", "output": "0020020" }, { "input": "-.-.---.--..-..-.-.-..-..-.--.", "output": "112120010111010120" }, { "input": "---.-.-.------..-..-..-..-.-..-.--.-.-..-.-.-----..-.-.", "output": "21112220010101011012011011221011" }, { "input": "-.-..--.-.-.-.-.-..-.-.-.---------.--.---..--...--.-----.-.-.-...--.-.-.---.------.--..-.--.-----.-...-..------", "output": "11020111110111222212021020002022111100201121222020012022110010222" }, { "input": "-.-..-.--.---..---.-..---.-...-.-.----..-.---.-.---..-.--.---.-.-------.---.--....----.-.---.---.---.----.-----..---.-.-.-.-----.--.-------.-..", "output": "110120210211021100112200121121012021122212120000220121212122022102111122120222110" }, { "input": ".-..-.-.---.-----.--.---...-.--.-.-....-..", "output": "01011212212021001201100010" }, { "input": ".------.-.---..--...-..-..-.-.-.--.--.-..-.--...-.-.---.-.-.------..--..-.---..----.-..-.--.---.-.----.-.---...-.-.-.-----.-.-.---.---.-.....-.-...-----.-...-.---.-..-.-----.--...---.-.-..-.--.-.---..", "output": "022201210200010101112020101200011211122200200121022010120211220121001112211121211000011002211001211012212000211101201210" }, { "input": ".-.--.---.-----.-.-----.-.-..-----..-..----..--.-.--.----..---.---..-.-.-----..-------.----..----.-..---...-----..-..-----...-..-.-.-----....---..---..-.-----...-.--...--.-.---.-.-.-.-.-...---..----.", "output": "01202122112211102210102200201202200212101122102221220022010210022101022100101122100021021012210012000201211111100210220" }, { "input": "..-.-.-.---.-.-.-..-.-..-.-.---.-------.---..-----.---....-.---.--.--.-.---.---------.-..---.-.-.--..---.---.-.---.-.-..-.-..-.-.-.----.--.-....--------.-.---..----.------.-.-.--.--.-----.-----.----", "output": "0011121111011011212221210221210001212020121222211021112002121121110110111220201000222201210220222011202022122122" }, { "input": "-..-------.------.-..--.-.-..--.-.-..-----..-.-.-..-..-..--.---..-----..---..-..--.-..-.-.---...-.....-------.---.-----.-...-.-...-.-.---.---.-----.--.--...-.--..-.-..-...-.-.-.-.---..---.-..-.-.-.-..", "output": "102221222010201102011022101110101020210221021010201011210010000222121221100110011212122120200012001101001111210211011110" }, { "input": ".-.----.-.--..-.-.-.-..----..-.-...--.-.---.---.-------..-.--..-......--.------.--.----.--...-.--.--..-----..-.....--.--.-.-.------..--------.----------..-.---.----.---.-..--..-.....-..------.--.", "output": "012201200111102200110020121212221012001000002022202022020001202002210100002020112220022220222220012122021102001000010222020" }, { "input": "------.-----.-....--.-.----.-.---.-.-..---.-.---.-----..-...-.-.---..-.-.-..-.-.-...-.-.-.----..--.------.----.-..-.--...-.-------...-.-..-.-.--.--.---..--..--------.--.-.-.---.-.-.-...----.--..-.--..", "output": "222022110002012201211102112122101001121011101110011122002022202201012000122210011011202021020022220201121111002202001200" }, { "input": "-.---...----...--.--...-.--.----", "output": "121002200020200012022" }, { "input": "--.--.--.---.--.-.---.-.-..-..--.-..---.-.....-..---.-----.--...-.-.-------.-.--.-.----.-..-.------.", "output": "202020212012111010201021100001021221200011222112012201012220" } ]
1,605,528,890
2,147,483,647
Python 3
OK
TESTS
30
186
0
# n=int(input()) # s1=0 # s2=0 # s3=0 # for _ in range(n): # x,y,z=(map(int,input().split())) # s1=s1+x # s2=s2+y # s3=s3+z # # if s1==0 and s2==0 and s3==0: # print("YES") # else: # print("NO") # l=[] # for i in range(5): # arr=list(map(int,input().split())) # l.append(arr) # # print(l) # x,y=3,3 # for i in range(1,6): # for j in range(1,6): # if l[i-1][j-1]==1: # print(abs(x-i)+abs(y-j)) # n,t=map(int,input().split()) # s=input() # # for i in range(t): # # # s=s.replace("BG",'GB') # # # print(s) s=input() for i in range(len(s)): s = s.replace("--", '2') s = s.replace("-.", "1") s=s.replace(".",'0') print(s)
Title: Borze Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet. Input Specification: The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes). Output Specification: Output the decoded ternary number. It can have leading zeroes. Demo Input: ['.-.--\n', '--.\n', '-..-.--\n'] Demo Output: ['012', '20', '1012'] Note: none
```python # n=int(input()) # s1=0 # s2=0 # s3=0 # for _ in range(n): # x,y,z=(map(int,input().split())) # s1=s1+x # s2=s2+y # s3=s3+z # # if s1==0 and s2==0 and s3==0: # print("YES") # else: # print("NO") # l=[] # for i in range(5): # arr=list(map(int,input().split())) # l.append(arr) # # print(l) # x,y=3,3 # for i in range(1,6): # for j in range(1,6): # if l[i-1][j-1]==1: # print(abs(x-i)+abs(y-j)) # n,t=map(int,input().split()) # s=input() # # for i in range(t): # # # s=s.replace("BG",'GB') # # # print(s) s=input() for i in range(len(s)): s = s.replace("--", '2') s = s.replace("-.", "1") s=s.replace(".",'0') print(s) ```
3.9535
450
B
Jzzhu and Sequences
PROGRAMMING
1,300
[ "implementation", "math" ]
null
null
Jzzhu has invented a kind of sequences, they meet the following property: You are given *x* and *y*, please calculate *f**n* modulo 1000000007 (109<=+<=7).
The first line contains two integers *x* and *y* (|*x*|,<=|*y*|<=≤<=109). The second line contains a single integer *n* (1<=≤<=*n*<=≤<=2·109).
Output a single integer representing *f**n* modulo 1000000007 (109<=+<=7).
[ "2 3\n3\n", "0 -1\n2\n" ]
[ "1\n", "1000000006\n" ]
In the first sample, *f*<sub class="lower-index">2</sub> = *f*<sub class="lower-index">1</sub> + *f*<sub class="lower-index">3</sub>, 3 = 2 + *f*<sub class="lower-index">3</sub>, *f*<sub class="lower-index">3</sub> = 1. In the second sample, *f*<sub class="lower-index">2</sub> =  - 1;  - 1 modulo (10<sup class="upper-index">9</sup> + 7) equals (10<sup class="upper-index">9</sup> + 6).
1,000
[ { "input": "2 3\n3", "output": "1" }, { "input": "0 -1\n2", "output": "1000000006" }, { "input": "-9 -11\n12345", "output": "1000000005" }, { "input": "0 0\n1000000000", "output": "0" }, { "input": "-1000000000 1000000000\n2000000000", "output": "1000000000" }, { "input": "-12345678 12345678\n1912345678", "output": "12345678" }, { "input": "728374857 678374857\n1928374839", "output": "950000007" }, { "input": "278374837 992837483\n1000000000", "output": "721625170" }, { "input": "-693849384 502938493\n982838498", "output": "502938493" }, { "input": "-783928374 983738273\n992837483", "output": "16261734" }, { "input": "-872837483 -682738473\n999999999", "output": "190099010" }, { "input": "-892837483 -998273847\n999283948", "output": "892837483" }, { "input": "-283938494 738473848\n1999999999", "output": "716061513" }, { "input": "-278374857 819283838\n1", "output": "721625150" }, { "input": "-1000000000 123456789\n1", "output": "7" }, { "input": "-529529529 -524524524\n2", "output": "475475483" }, { "input": "1 2\n2000000000", "output": "2" }, { "input": "-1 -2\n2000000000", "output": "1000000005" }, { "input": "1 2\n1999999999", "output": "1" }, { "input": "1 2\n1999999998", "output": "1000000006" }, { "input": "1 2\n1999999997", "output": "1000000005" }, { "input": "1 2\n1999999996", "output": "1000000006" }, { "input": "69975122 366233206\n1189460676", "output": "703741923" }, { "input": "812229413 904420051\n806905621", "output": "812229413" }, { "input": "872099024 962697902\n1505821695", "output": "90598878" }, { "input": "887387283 909670917\n754835014", "output": "112612724" }, { "input": "37759824 131342932\n854621399", "output": "868657075" }, { "input": "-246822123 800496170\n626323615", "output": "753177884" }, { "input": "-861439463 974126967\n349411083", "output": "835566423" }, { "input": "-69811049 258093841\n1412447", "output": "741906166" }, { "input": "844509330 -887335829\n123329059", "output": "844509330" }, { "input": "83712471 -876177148\n1213284777", "output": "40110388" }, { "input": "598730524 -718984219\n1282749880", "output": "401269483" }, { "input": "-474244697 -745885656\n1517883612", "output": "271640959" }, { "input": "-502583588 -894906953\n1154189557", "output": "497416419" }, { "input": "-636523651 -873305815\n154879215", "output": "763217843" }, { "input": "721765550 594845720\n78862386", "output": "126919830" }, { "input": "364141461 158854993\n1337196589", "output": "364141461" }, { "input": "878985260 677031952\n394707801", "output": "798046699" }, { "input": "439527072 -24854079\n1129147002", "output": "464381151" }, { "input": "840435009 -612103127\n565968986", "output": "387896880" }, { "input": "875035447 -826471373\n561914518", "output": "124964560" }, { "input": "-342526698 305357084\n70776744", "output": "352116225" }, { "input": "-903244186 899202229\n1527859274", "output": "899202229" }, { "input": "-839482546 815166320\n1127472130", "output": "839482546" }, { "input": "-976992569 -958313041\n1686580818", "output": "981320479" }, { "input": "-497338894 -51069176\n737081851", "output": "502661113" }, { "input": "-697962643 -143148799\n1287886520", "output": "856851208" }, { "input": "-982572938 -482658433\n1259858332", "output": "982572938" }, { "input": "123123 78817\n2000000000", "output": "78817" }, { "input": "1000000000 -1000000000\n3", "output": "14" }, { "input": "-1000000000 1000000000\n6", "output": "14" }, { "input": "2 3\n6", "output": "1000000006" }, { "input": "0 -1\n6", "output": "1" }, { "input": "500000000 -1000000000\n600000003", "output": "500000014" }, { "input": "-1000000000 1000000000\n3", "output": "999999993" }, { "input": "1 3\n6", "output": "1000000005" }, { "input": "1 2\n12", "output": "1000000006" }, { "input": "7 -1000000000\n3", "output": "0" }, { "input": "-999999997 999999997\n6", "output": "20" }, { "input": "3 4\n6", "output": "1000000006" }, { "input": "-1 2\n6", "output": "1000000004" }, { "input": "2 3\n12", "output": "1000000006" }, { "input": "4 18\n6", "output": "999999993" }, { "input": "1 2\n6", "output": "1000000006" }, { "input": "1000000000 -1000000000\n6", "output": "999999993" }, { "input": "999999999 -999999999\n3", "output": "16" }, { "input": "-1 0\n1", "output": "1000000006" }, { "input": "1000000000 -1000000000\n9", "output": "14" }, { "input": "999999999 -1000000000\n12", "output": "999999992" }, { "input": "1000000000 -7\n3", "output": "0" }, { "input": "-5 5\n6", "output": "999999997" }, { "input": "5 9\n6", "output": "1000000003" }, { "input": "-15 -10\n1", "output": "999999992" } ]
1,636,009,231
2,147,483,647
Python 3
OK
TESTS
74
62
4,505,600
a, b = map(int, input().split()) n = int(input()) if(n%6==1): val = a elif(n%6==2): val = b elif(n%6==3): val = b-a elif(n%6==4): val = -a elif(n%6==5): val = -b else: val = a-b if(val<0): val += 1000000007 print(val%1000000007)
Title: Jzzhu and Sequences Time Limit: None seconds Memory Limit: None megabytes Problem Description: Jzzhu has invented a kind of sequences, they meet the following property: You are given *x* and *y*, please calculate *f**n* modulo 1000000007 (109<=+<=7). Input Specification: The first line contains two integers *x* and *y* (|*x*|,<=|*y*|<=≤<=109). The second line contains a single integer *n* (1<=≤<=*n*<=≤<=2·109). Output Specification: Output a single integer representing *f**n* modulo 1000000007 (109<=+<=7). Demo Input: ['2 3\n3\n', '0 -1\n2\n'] Demo Output: ['1\n', '1000000006\n'] Note: In the first sample, *f*<sub class="lower-index">2</sub> = *f*<sub class="lower-index">1</sub> + *f*<sub class="lower-index">3</sub>, 3 = 2 + *f*<sub class="lower-index">3</sub>, *f*<sub class="lower-index">3</sub> = 1. In the second sample, *f*<sub class="lower-index">2</sub> =  - 1;  - 1 modulo (10<sup class="upper-index">9</sup> + 7) equals (10<sup class="upper-index">9</sup> + 6).
```python a, b = map(int, input().split()) n = int(input()) if(n%6==1): val = a elif(n%6==2): val = b elif(n%6==3): val = b-a elif(n%6==4): val = -a elif(n%6==5): val = -b else: val = a-b if(val<0): val += 1000000007 print(val%1000000007) ```
3
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,636,989,744
2,147,483,647
PyPy 3-64
OK
TESTS
30
122
0
n=input() c=0 d=0 for x in n: if x.isupper(): c+=1 else: d+=1 if c>d: print(n.upper()) else: print(n.lower())
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python n=input() c=0 d=0 for x in n: if x.isupper(): c+=1 else: d+=1 if c>d: print(n.upper()) else: print(n.lower()) ```
3.9695
266
B
Queue at the School
PROGRAMMING
800
[ "constructive algorithms", "graph matchings", "implementation", "shortest paths" ]
null
null
During the break the schoolchildren, boys and girls, formed a queue of *n* people in the canteen. Initially the children stood in the order they entered the canteen. However, after a while the boys started feeling awkward for standing in front of the girls in the queue and they started letting the girls move forward each second. Let's describe the process more precisely. Let's say that the positions in the queue are sequentially numbered by integers from 1 to *n*, at that the person in the position number 1 is served first. Then, if at time *x* a boy stands on the *i*-th position and a girl stands on the (*i*<=+<=1)-th position, then at time *x*<=+<=1 the *i*-th position will have a girl and the (*i*<=+<=1)-th position will have a boy. The time is given in seconds. You've got the initial position of the children, at the initial moment of time. Determine the way the queue is going to look after *t* seconds.
The first line contains two integers *n* and *t* (1<=≤<=*n*,<=*t*<=≤<=50), which represent the number of children in the queue and the time after which the queue will transform into the arrangement you need to find. The next line contains string *s*, which represents the schoolchildren's initial arrangement. If the *i*-th position in the queue contains a boy, then the *i*-th character of string *s* equals "B", otherwise the *i*-th character equals "G".
Print string *a*, which describes the arrangement after *t* seconds. If the *i*-th position has a boy after the needed time, then the *i*-th character *a* must equal "B", otherwise it must equal "G".
[ "5 1\nBGGBG\n", "5 2\nBGGBG\n", "4 1\nGGGB\n" ]
[ "GBGGB\n", "GGBGB\n", "GGGB\n" ]
none
500
[ { "input": "5 1\nBGGBG", "output": "GBGGB" }, { "input": "5 2\nBGGBG", "output": "GGBGB" }, { "input": "4 1\nGGGB", "output": "GGGB" }, { "input": "2 1\nBB", "output": "BB" }, { "input": "2 1\nBG", "output": "GB" }, { "input": "6 2\nBBGBBG", "output": "GBBGBB" }, { "input": "8 3\nBBGBGBGB", "output": "GGBGBBBB" }, { "input": "10 3\nBBGBBBBBBG", "output": "GBBBBBGBBB" }, { "input": "22 7\nGBGGBGGGGGBBBGGBGBGBBB", "output": "GGGGGGGGBGGBGGBBBBBBBB" }, { "input": "50 4\nGBBGBBBGGGGGBBGGBBBBGGGBBBGBBBGGBGGBGBBBGGBGGBGGBG", "output": "GGBGBGBGBGBGGGBBGBGBGBGBBBGBGBGBGBGBGBGBGBGBGGBGBB" }, { "input": "50 8\nGGGGBGGBGGGBGBBBGGGGGGGGBBGBGBGBBGGBGGBGGGGGGGGBBG", "output": "GGGGGGGGGGGGBGGBGBGBGBGBGGGGGGBGBGBGBGBGBGGBGGBGBB" }, { "input": "50 30\nBGGGGGGBGGBGBGGGGBGBBGBBBGGBBBGBGBGGGGGBGBBGBGBGGG", "output": "GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGBBBBBBBBBBBBBBBBBBBB" }, { "input": "20 20\nBBGGBGGGGBBBGBBGGGBB", "output": "GGGGGGGGGGBBBBBBBBBB" }, { "input": "27 6\nGBGBGBGGGGGGBGGBGGBBGBBBGBB", "output": "GGGGGGGBGBGBGGGGGBGBBBBBBBB" }, { "input": "46 11\nBGGGGGBGBGGBGGGBBGBBGBBGGBBGBBGBGGGGGGGBGBGBGB", "output": "GGGGGGGGGGGBGGGGGBBGBGBGBGBGBGBGBGBGBGBGBBBBBB" }, { "input": "50 6\nBGGBBBBGGBBBBBBGGBGBGBBBBGBBBBBBGBBBBBBBBBBBBBBBBB", "output": "GGGGBBBBBGBGBGBGBBBGBBBBBBGBBBBBBBBBBBBBBBBBBBBBBB" }, { "input": "50 10\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB" }, { "input": "50 8\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG", "output": "GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG" }, { "input": "50 10\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBGB", "output": "BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBGBBBBBBBBBBB" }, { "input": "50 13\nGGGBGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG", "output": "GGGGGGGGGGGGGGGGBGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG" }, { "input": "1 1\nB", "output": "B" }, { "input": "1 1\nG", "output": "G" }, { "input": "1 50\nB", "output": "B" }, { "input": "1 50\nG", "output": "G" }, { "input": "50 50\nBBBBBBBBGGBBBBBBGBBBBBBBBBBBGBBBBBBBBBBBBBBGBBBBBB", "output": "GGGGGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB" }, { "input": "50 50\nGGBBGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGBBGGGGGGBG", "output": "GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGBBBBB" }, { "input": "6 3\nGGBBBG", "output": "GGGBBB" }, { "input": "26 3\nGBBGBBBBBGGGBGBGGGBGBGGBBG", "output": "GGBBBBGBGBGBGGGBGBGGGBGBBB" }, { "input": "46 3\nGGBBGGGGBBGBGBBBBBGGGBGGGBBGGGBBBGGBGGBBBGBGBB", "output": "GGGGBGBGGGBBBBBGBGBGBGGGBGGBGBGBGBGBGBGBGBBBBB" }, { "input": "44 8\nBGBBBBBBBBBGGBBGBGBGGBBBBBGBBGBBBBBBBBBGBBGB", "output": "GBBGBGBGBGBGBGBBBBGBBGBBBBBBBBBGBBGBBBBBBBBB" }, { "input": "20 20\nBBGGBGGGGBBBGBBGGGBB", "output": "GGGGGGGGGGBBBBBBBBBB" }, { "input": "30 25\nBGGBBGBGGBGBGBBGBGGGGBGBGGBBBB", "output": "GGGGGGGGGGGGGGGBBBBBBBBBBBBBBB" }, { "input": "17 42\nBBGBGBGGGGGGBBGGG", "output": "GGGGGGGGGGGBBBBBB" }, { "input": "30 50\nBGGBBGGGGGGGGBBGGGBBGGBBBGBBGG", "output": "GGGGGGGGGGGGGGGGGGBBBBBBBBBBBB" }, { "input": "31 33\nBBGGBBGGBGBBBBGGBGBBBGBGGBBGBBB", "output": "GGGGGGGGGGGGBBBBBBBBBBBBBBBBBBB" }, { "input": "2 2\nBG", "output": "GB" }, { "input": "8 8\nGGGBGGBB", "output": "GGGGGBBB" }, { "input": "34 34\nBGGBBBBGGBBGBGGGGGGBBGGGGGBGGBGGGB", "output": "GGGGGGGGGGGGGGGGGGGGGBBBBBBBBBBBBB" }, { "input": "34 20\nBBBBGBGGGBGGGBGBGGBBBBGGBBGGGBGBBG", "output": "GGGGGGGGGGGGGGGGGBBBBBBBBBBBBBBBBB" }, { "input": "50 50\nBBGBBBBBBBBBBBBGBBBGBBBBBBBGBBBBBBGBBBGBBGBBGBBBGG", "output": "GGGGGGGGGGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB" }, { "input": "10 10\nGGGGGGGGGG", "output": "GGGGGGGGGG" }, { "input": "10 10\nBBBBBBBBBB", "output": "BBBBBBBBBB" }, { "input": "10 10\nBGBGBGBGBG", "output": "GGGGGBBBBB" }, { "input": "1 1\nB", "output": "B" } ]
1,695,130,781
2,147,483,647
Python 3
OK
TESTS
44
62
0
s=input().split() n=int(s[0]) t=int(s[1]) q=input() for i in range(t): q=q.replace('BG','GB',n) print(q)
Title: Queue at the School Time Limit: None seconds Memory Limit: None megabytes Problem Description: During the break the schoolchildren, boys and girls, formed a queue of *n* people in the canteen. Initially the children stood in the order they entered the canteen. However, after a while the boys started feeling awkward for standing in front of the girls in the queue and they started letting the girls move forward each second. Let's describe the process more precisely. Let's say that the positions in the queue are sequentially numbered by integers from 1 to *n*, at that the person in the position number 1 is served first. Then, if at time *x* a boy stands on the *i*-th position and a girl stands on the (*i*<=+<=1)-th position, then at time *x*<=+<=1 the *i*-th position will have a girl and the (*i*<=+<=1)-th position will have a boy. The time is given in seconds. You've got the initial position of the children, at the initial moment of time. Determine the way the queue is going to look after *t* seconds. Input Specification: The first line contains two integers *n* and *t* (1<=≤<=*n*,<=*t*<=≤<=50), which represent the number of children in the queue and the time after which the queue will transform into the arrangement you need to find. The next line contains string *s*, which represents the schoolchildren's initial arrangement. If the *i*-th position in the queue contains a boy, then the *i*-th character of string *s* equals "B", otherwise the *i*-th character equals "G". Output Specification: Print string *a*, which describes the arrangement after *t* seconds. If the *i*-th position has a boy after the needed time, then the *i*-th character *a* must equal "B", otherwise it must equal "G". Demo Input: ['5 1\nBGGBG\n', '5 2\nBGGBG\n', '4 1\nGGGB\n'] Demo Output: ['GBGGB\n', 'GGBGB\n', 'GGGB\n'] Note: none
```python s=input().split() n=int(s[0]) t=int(s[1]) q=input() for i in range(t): q=q.replace('BG','GB',n) print(q) ```
3
237
C
Primes on Interval
PROGRAMMING
1,600
[ "binary search", "number theory", "two pointers" ]
null
null
You've decided to carry out a survey in the theory of prime numbers. Let us remind you that a prime number is a positive integer that has exactly two distinct positive integer divisors. Consider positive integers *a*, *a*<=+<=1, ..., *b* (*a*<=≤<=*b*). You want to find the minimum integer *l* (1<=≤<=*l*<=≤<=*b*<=-<=*a*<=+<=1) such that for any integer *x* (*a*<=≤<=*x*<=≤<=*b*<=-<=*l*<=+<=1) among *l* integers *x*, *x*<=+<=1, ..., *x*<=+<=*l*<=-<=1 there are at least *k* prime numbers. Find and print the required minimum *l*. If no value *l* meets the described limitations, print -1.
A single line contains three space-separated integers *a*,<=*b*,<=*k* (1<=≤<=*a*,<=*b*,<=*k*<=≤<=106; *a*<=≤<=*b*).
In a single line print a single integer — the required minimum *l*. If there's no solution, print -1.
[ "2 4 2\n", "6 13 1\n", "1 4 3\n" ]
[ "3\n", "4\n", "-1\n" ]
none
1,500
[ { "input": "2 4 2", "output": "3" }, { "input": "6 13 1", "output": "4" }, { "input": "1 4 3", "output": "-1" }, { "input": "5 8 2", "output": "4" }, { "input": "8 10 3", "output": "-1" }, { "input": "1 5 2", "output": "3" }, { "input": "6 8 3", "output": "-1" }, { "input": "21 29 2", "output": "9" }, { "input": "17 27 3", "output": "11" }, { "input": "1 1000000 10000", "output": "137970" }, { "input": "690059 708971 10000", "output": "-1" }, { "input": "12357 534133 2", "output": "138" }, { "input": "838069 936843 3", "output": "142" }, { "input": "339554 696485 4", "output": "168" }, { "input": "225912 522197 5", "output": "190" }, { "input": "404430 864261 6", "output": "236" }, { "input": "689973 807140 7", "output": "236" }, { "input": "177146 548389 8", "output": "240" }, { "input": "579857 857749 9", "output": "300" }, { "input": "35648 527231 10", "output": "280" }, { "input": "2 1000000 10000", "output": "137970" }, { "input": "1 999999 9999", "output": "137958" }, { "input": "5 5 10", "output": "-1" }, { "input": "11 11 6", "output": "-1" }, { "input": "4 4 95", "output": "-1" }, { "input": "1 1000000 1000000", "output": "-1" }, { "input": "1 1000000 78498", "output": "999999" }, { "input": "1 1000000 78499", "output": "-1" }, { "input": "3459 94738 1", "output": "72" }, { "input": "1 1000000 1", "output": "114" }, { "input": "1 1000000 78498", "output": "999999" }, { "input": "1 1000000 78497", "output": "999998" }, { "input": "1 1000000 78490", "output": "999978" }, { "input": "1000 10000 13", "output": "168" }, { "input": "100000 1000000 7821", "output": "108426" }, { "input": "20 1000000 40000", "output": "539580" }, { "input": "1000 900000 50000", "output": "659334" }, { "input": "10000 1000000 60000", "output": "793662" }, { "input": "9999 99999 8000", "output": "86572" }, { "input": "50 150 20", "output": "100" }, { "input": "999953 999953 1", "output": "1" }, { "input": "999953 999953 2", "output": "-1" }, { "input": "999931 999953 2", "output": "23" }, { "input": "999906 999984 4", "output": "52" }, { "input": "999940 999983 3", "output": "26" }, { "input": "1 1 1", "output": "-1" }, { "input": "1 1 1000000", "output": "-1" }, { "input": "1 2 1", "output": "2" }, { "input": "1 3 1", "output": "2" }, { "input": "1 3 2", "output": "3" }, { "input": "1 4 2", "output": "3" }, { "input": "1 5 2", "output": "3" }, { "input": "1 5 3", "output": "5" }, { "input": "2 5 2", "output": "3" }, { "input": "3 5 1", "output": "2" } ]
1,613,461,554
2,147,483,647
PyPy 3
OK
TESTS
55
171
9,523,200
from sys import stdin,stdout nmbr = lambda: int(stdin.readline()) lst = lambda: list(map(int,stdin.readline().split())) N=10**6+6 primes=[1]*N p=2 while p*p<=N: if primes[p]: for j in range(p*p,N,p): primes[j]=0 p+=1 primes[1]=primes[0]=0 def fn(x): for i in range(n-x+1): ones=aa[i+x-1]-(aa[i-1] if i>=1 else 0) if ones<k:return False return True for _ in range(1):#nmbr()): a,b,k=lst() n=b-a+1 l=1;r=b-a+1 aa=[0]*(b-a+1) c=0 for i in range(a,b+1): aa[c]=primes[i]+aa[max(0,c-1)] c+=1 # print(aa) while l<=r: mid=(l+r)>>1 # print(mid,fn(mid)) if fn(mid)==False:l=mid+1 else:r=mid-1 print(l if l<=n else -1)
Title: Primes on Interval Time Limit: None seconds Memory Limit: None megabytes Problem Description: You've decided to carry out a survey in the theory of prime numbers. Let us remind you that a prime number is a positive integer that has exactly two distinct positive integer divisors. Consider positive integers *a*, *a*<=+<=1, ..., *b* (*a*<=≤<=*b*). You want to find the minimum integer *l* (1<=≤<=*l*<=≤<=*b*<=-<=*a*<=+<=1) such that for any integer *x* (*a*<=≤<=*x*<=≤<=*b*<=-<=*l*<=+<=1) among *l* integers *x*, *x*<=+<=1, ..., *x*<=+<=*l*<=-<=1 there are at least *k* prime numbers. Find and print the required minimum *l*. If no value *l* meets the described limitations, print -1. Input Specification: A single line contains three space-separated integers *a*,<=*b*,<=*k* (1<=≤<=*a*,<=*b*,<=*k*<=≤<=106; *a*<=≤<=*b*). Output Specification: In a single line print a single integer — the required minimum *l*. If there's no solution, print -1. Demo Input: ['2 4 2\n', '6 13 1\n', '1 4 3\n'] Demo Output: ['3\n', '4\n', '-1\n'] Note: none
```python from sys import stdin,stdout nmbr = lambda: int(stdin.readline()) lst = lambda: list(map(int,stdin.readline().split())) N=10**6+6 primes=[1]*N p=2 while p*p<=N: if primes[p]: for j in range(p*p,N,p): primes[j]=0 p+=1 primes[1]=primes[0]=0 def fn(x): for i in range(n-x+1): ones=aa[i+x-1]-(aa[i-1] if i>=1 else 0) if ones<k:return False return True for _ in range(1):#nmbr()): a,b,k=lst() n=b-a+1 l=1;r=b-a+1 aa=[0]*(b-a+1) c=0 for i in range(a,b+1): aa[c]=primes[i]+aa[max(0,c-1)] c+=1 # print(aa) while l<=r: mid=(l+r)>>1 # print(mid,fn(mid)) if fn(mid)==False:l=mid+1 else:r=mid-1 print(l if l<=n else -1) ```
3
835
B
The number on the board
PROGRAMMING
1,100
[ "greedy" ]
null
null
Some natural number was written on the board. Its sum of digits was not less than *k*. But you were distracted a bit, and someone changed this number to *n*, replacing some digits with others. It's known that the length of the number didn't change. You have to find the minimum number of digits in which these two numbers can differ.
The first line contains integer *k* (1<=≤<=*k*<=≤<=109). The second line contains integer *n* (1<=≤<=*n*<=&lt;<=10100000). There are no leading zeros in *n*. It's guaranteed that this situation is possible.
Print the minimum number of digits in which the initial number and *n* can differ.
[ "3\n11\n", "3\n99\n" ]
[ "1\n", "0\n" ]
In the first example, the initial number could be 12. In the second example the sum of the digits of *n* is not less than *k*. The initial number could be equal to *n*.
750
[ { "input": "3\n11", "output": "1" }, { "input": "3\n99", "output": "0" }, { "input": "10\n5205602270", "output": "0" }, { "input": "70\n3326631213", "output": "6" }, { "input": "200\n1000000010000000000000000000010000000000000001000001000000000000000000000000000000000000000000000000", "output": "22" }, { "input": "500\n1899337170458531693764539600958943248270674811247191310452938511077656066239840703432499357537079035", "output": "6" }, { "input": "700\n9307216756404590162143344901558545760612901767837570518638460182990196397856220673189163417019781185", "output": "32" }, { "input": "900\n7570423817272967027553082464863962024635217372307919506594193055572300657732661146354209508997483330", "output": "91" }, { "input": "18\n900", "output": "1" }, { "input": "23\n12138", "output": "1" }, { "input": "16\n333", "output": "2" }, { "input": "3\n12", "output": "0" }, { "input": "3\n111", "output": "0" }, { "input": "1\n100", "output": "0" }, { "input": "17\n89", "output": "0" }, { "input": "18\n99", "output": "0" }, { "input": "42\n97779", "output": "2" }, { "input": "2\n11", "output": "0" }, { "input": "6\n33", "output": "0" }, { "input": "45\n23456", "output": "5" }, { "input": "3\n21", "output": "0" }, { "input": "2\n2", "output": "0" }, { "input": "108\n199999899899", "output": "3" }, { "input": "6\n222", "output": "0" }, { "input": "1\n1", "output": "0" }, { "input": "9\n9", "output": "0" }, { "input": "5\n5", "output": "0" }, { "input": "27\n888", "output": "3" } ]
1,601,023,283
2,147,483,647
PyPy 3
OK
TESTS
48
171
4,710,400
k = int(input()) n = list(input()) n.sort() sum=0 for i in n: sum+=int(i) m=0 if k>sum: j=0 while sum<k: sum+=9-int(n[j]) j+=1 m+=1 print(m)
Title: The number on the board Time Limit: None seconds Memory Limit: None megabytes Problem Description: Some natural number was written on the board. Its sum of digits was not less than *k*. But you were distracted a bit, and someone changed this number to *n*, replacing some digits with others. It's known that the length of the number didn't change. You have to find the minimum number of digits in which these two numbers can differ. Input Specification: The first line contains integer *k* (1<=≤<=*k*<=≤<=109). The second line contains integer *n* (1<=≤<=*n*<=&lt;<=10100000). There are no leading zeros in *n*. It's guaranteed that this situation is possible. Output Specification: Print the minimum number of digits in which the initial number and *n* can differ. Demo Input: ['3\n11\n', '3\n99\n'] Demo Output: ['1\n', '0\n'] Note: In the first example, the initial number could be 12. In the second example the sum of the digits of *n* is not less than *k*. The initial number could be equal to *n*.
```python k = int(input()) n = list(input()) n.sort() sum=0 for i in n: sum+=int(i) m=0 if k>sum: j=0 while sum<k: sum+=9-int(n[j]) j+=1 m+=1 print(m) ```
3
47
B
Coins
PROGRAMMING
1,200
[ "implementation" ]
B. Coins
2
256
One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal.
The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters «A», «B» and «C». Each result is a line that appears as (letter)(&gt; or &lt; sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A&lt;B.
It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters «A», «B» and «C» which represent the coins in the increasing order of their weights.
[ "A&gt;B\nC&lt;B\nA&gt;C\n", "A&lt;B\nB&gt;C\nC&gt;A\n" ]
[ "CBA", "ACB" ]
none
1,000
[ { "input": "A>B\nC<B\nA>C", "output": "CBA" }, { "input": "A<B\nB>C\nC>A", "output": "ACB" }, { "input": "A<C\nB<A\nB>C", "output": "Impossible" }, { "input": "A<B\nA<C\nB>C", "output": "ACB" }, { "input": "B>A\nC<B\nC>A", "output": "ACB" }, { "input": "A>B\nB>C\nC<A", "output": "CBA" }, { "input": "A>C\nA>B\nB<C", "output": "BCA" }, { "input": "C<B\nB>A\nA<C", "output": "ACB" }, { "input": "C<B\nA>B\nC<A", "output": "CBA" }, { "input": "C>B\nB>A\nA<C", "output": "ABC" }, { "input": "C<B\nB<A\nC>A", "output": "Impossible" }, { "input": "B<C\nC<A\nA>B", "output": "BCA" }, { "input": "A>B\nC<B\nC<A", "output": "CBA" }, { "input": "B>A\nC>B\nA>C", "output": "Impossible" }, { "input": "B<A\nC>B\nC>A", "output": "BAC" }, { "input": "A<B\nC>B\nA<C", "output": "ABC" }, { "input": "A<B\nC<A\nB<C", "output": "Impossible" }, { "input": "A>C\nC<B\nB>A", "output": "CAB" }, { "input": "C>A\nA<B\nB>C", "output": "ACB" }, { "input": "C>A\nC<B\nB>A", "output": "ACB" }, { "input": "B>C\nB>A\nA<C", "output": "ACB" }, { "input": "C<B\nC<A\nB<A", "output": "CBA" }, { "input": "A<C\nA<B\nB>C", "output": "ACB" }, { "input": "B>A\nA>C\nB>C", "output": "CAB" }, { "input": "B<A\nA<C\nC<B", "output": "Impossible" }, { "input": "A<C\nB>C\nA>B", "output": "Impossible" }, { "input": "B>A\nC<A\nC>B", "output": "Impossible" }, { "input": "A>C\nC>B\nB<A", "output": "BCA" }, { "input": "B<C\nB<A\nA>C", "output": "BCA" }, { "input": "A>B\nC>B\nA<C", "output": "BAC" }, { "input": "C<B\nC<A\nB<A", "output": "CBA" }, { "input": "A<C\nA>B\nB>C", "output": "Impossible" }, { "input": "B>A\nB>C\nA<C", "output": "ACB" }, { "input": "B>C\nC<A\nB<A", "output": "CBA" }, { "input": "C>A\nB>A\nB>C", "output": "ACB" }, { "input": "B<A\nB>C\nA<C", "output": "Impossible" }, { "input": "B<C\nA<B\nC>A", "output": "ABC" }, { "input": "C<B\nB>A\nA>C", "output": "CAB" }, { "input": "A>B\nC>A\nB<C", "output": "BAC" }, { "input": "A>B\nB>C\nC<A", "output": "CBA" }, { "input": "B>C\nC>A\nA>B", "output": "Impossible" }, { "input": "B<A\nB>C\nC<A", "output": "CBA" }, { "input": "C>B\nB>A\nC>A", "output": "ABC" }, { "input": "A>C\nA>B\nB>C", "output": "CBA" }, { "input": "B<C\nA>B\nA<C", "output": "BAC" }, { "input": "C>A\nC<B\nB>A", "output": "ACB" }, { "input": "C>B\nA<B\nC<A", "output": "Impossible" }, { "input": "A<C\nC<B\nA>B", "output": "Impossible" }, { "input": "B>C\nA<B\nA<C", "output": "ACB" }, { "input": "C>A\nA<B\nC>B", "output": "ABC" } ]
1,587,801,545
2,147,483,647
Python 3
OK
TESTS
50
218
307,200
d = {"A": 1 , "B" : 1 , "C" : 1} for _ in range(3): q = input() a = q[0] e= q[1] b = q[2] if(q[1]=="<"): d[a] -=1 d[b]+= 1 else: d[a] +=1 d[b] -= 1 s = "" for i in d: if d[i] == -1: s+=i break for i in d: if d[i] == 1: s+=i break for i in d: if d[i] == 3: s+=i break if(len(s)!=3): print("Impossible") else: print(s)
Title: Coins Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal. Input Specification: The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters «A», «B» and «C». Each result is a line that appears as (letter)(&gt; or &lt; sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A&lt;B. Output Specification: It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters «A», «B» and «C» which represent the coins in the increasing order of their weights. Demo Input: ['A&gt;B\nC&lt;B\nA&gt;C\n', 'A&lt;B\nB&gt;C\nC&gt;A\n'] Demo Output: ['CBA', 'ACB'] Note: none
```python d = {"A": 1 , "B" : 1 , "C" : 1} for _ in range(3): q = input() a = q[0] e= q[1] b = q[2] if(q[1]=="<"): d[a] -=1 d[b]+= 1 else: d[a] +=1 d[b] -= 1 s = "" for i in d: if d[i] == -1: s+=i break for i in d: if d[i] == 1: s+=i break for i in d: if d[i] == 3: s+=i break if(len(s)!=3): print("Impossible") else: print(s) ```
3.944928
682
A
Alyona and Numbers
PROGRAMMING
1,100
[ "constructive algorithms", "math", "number theory" ]
null
null
After finishing eating her bun, Alyona came up with two integers *n* and *m*. She decided to write down two columns of integers — the first column containing integers from 1 to *n* and the second containing integers from 1 to *m*. Now the girl wants to count how many pairs of integers she can choose, one from the first column and the other from the second column, such that their sum is divisible by 5. Formally, Alyona wants to count the number of pairs of integers (*x*,<=*y*) such that 1<=≤<=*x*<=≤<=*n*, 1<=≤<=*y*<=≤<=*m* and equals 0. As usual, Alyona has some troubles and asks you to help.
The only line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1<=000<=000).
Print the only integer — the number of pairs of integers (*x*,<=*y*) such that 1<=≤<=*x*<=≤<=*n*, 1<=≤<=*y*<=≤<=*m* and (*x*<=+<=*y*) is divisible by 5.
[ "6 12\n", "11 14\n", "1 5\n", "3 8\n", "5 7\n", "21 21\n" ]
[ "14\n", "31\n", "1\n", "5\n", "7\n", "88\n" ]
Following pairs are suitable in the first sample case: - for *x* = 1 fits *y* equal to 4 or 9; - for *x* = 2 fits *y* equal to 3 or 8; - for *x* = 3 fits *y* equal to 2, 7 or 12; - for *x* = 4 fits *y* equal to 1, 6 or 11; - for *x* = 5 fits *y* equal to 5 or 10; - for *x* = 6 fits *y* equal to 4 or 9. Only the pair (1, 4) is suitable in the third sample case.
500
[ { "input": "6 12", "output": "14" }, { "input": "11 14", "output": "31" }, { "input": "1 5", "output": "1" }, { "input": "3 8", "output": "5" }, { "input": "5 7", "output": "7" }, { "input": "21 21", "output": "88" }, { "input": "10 15", "output": "30" }, { "input": "1 1", "output": "0" }, { "input": "1 1000000", "output": "200000" }, { "input": "1000000 1", "output": "200000" }, { "input": "1000000 1000000", "output": "200000000000" }, { "input": "944 844", "output": "159348" }, { "input": "368 984", "output": "72423" }, { "input": "792 828", "output": "131155" }, { "input": "920 969", "output": "178296" }, { "input": "640 325", "output": "41600" }, { "input": "768 170", "output": "26112" }, { "input": "896 310", "output": "55552" }, { "input": "320 154", "output": "9856" }, { "input": "744 999", "output": "148652" }, { "input": "630 843", "output": "106218" }, { "input": "54 688", "output": "7431" }, { "input": "478 828", "output": "79157" }, { "input": "902 184", "output": "33194" }, { "input": "31 29", "output": "180" }, { "input": "751 169", "output": "25384" }, { "input": "879 14", "output": "2462" }, { "input": "7 858", "output": "1201" }, { "input": "431 702", "output": "60512" }, { "input": "855 355", "output": "60705" }, { "input": "553 29", "output": "3208" }, { "input": "721767 525996", "output": "75929310986" }, { "input": "805191 74841", "output": "12052259926" }, { "input": "888615 590981", "output": "105030916263" }, { "input": "4743 139826", "output": "132638943" }, { "input": "88167 721374", "output": "12720276292" }, { "input": "171591 13322", "output": "457187060" }, { "input": "287719 562167", "output": "32349225415" }, { "input": "371143 78307", "output": "5812618980" }, { "input": "487271 627151", "output": "61118498984" }, { "input": "261436 930642", "output": "48660664382" }, { "input": "377564 446782", "output": "33737759810" }, { "input": "460988 28330", "output": "2611958008" }, { "input": "544412 352983", "output": "38433636199" }, { "input": "660540 869123", "output": "114818101284" }, { "input": "743964 417967", "output": "62190480238" }, { "input": "827388 966812", "output": "159985729411" }, { "input": "910812 515656", "output": "93933134534" }, { "input": "26940 64501", "output": "347531388" }, { "input": "110364 356449", "output": "7867827488" }, { "input": "636358 355531", "output": "45248999219" }, { "input": "752486 871672", "output": "131184195318" }, { "input": "803206 420516", "output": "67552194859" }, { "input": "919334 969361", "output": "178233305115" }, { "input": "35462 261309", "output": "1853307952" }, { "input": "118887 842857", "output": "20040948031" }, { "input": "202311 358998", "output": "14525848875" }, { "input": "285735 907842", "output": "51880446774" }, { "input": "401863 456686", "output": "36705041203" }, { "input": "452583 972827", "output": "88056992428" }, { "input": "235473 715013", "output": "33673251230" }, { "input": "318897 263858", "output": "16828704925" }, { "input": "402321 812702", "output": "65393416268" }, { "input": "518449 361546", "output": "37488632431" }, { "input": "634577 910391", "output": "115542637921" }, { "input": "685297 235043", "output": "32214852554" }, { "input": "801425 751183", "output": "120403367155" }, { "input": "884849 300028", "output": "53095895155" }, { "input": "977 848872", "output": "165869588" }, { "input": "51697 397716", "output": "4112144810" }, { "input": "834588 107199", "output": "17893399803" }, { "input": "918012 688747", "output": "126455602192" }, { "input": "1436 237592", "output": "68236422" }, { "input": "117564 753732", "output": "17722349770" }, { "input": "200988 302576", "output": "12162829017" }, { "input": "284412 818717", "output": "46570587880" }, { "input": "400540 176073", "output": "14104855884" }, { "input": "483964 724917", "output": "70166746198" }, { "input": "567388 241058", "output": "27354683301" }, { "input": "650812 789902", "output": "102815540084" }, { "input": "400999 756281", "output": "60653584944" }, { "input": "100 101", "output": "2020" }, { "input": "100 102", "output": "2040" }, { "input": "103 100", "output": "2060" }, { "input": "100 104", "output": "2080" }, { "input": "3 4", "output": "3" }, { "input": "11 23", "output": "50" }, { "input": "8 14", "output": "23" }, { "input": "23423 34234", "output": "160372597" }, { "input": "1 4", "output": "1" }, { "input": "999999 999999", "output": "199999600001" }, { "input": "82 99", "output": "1624" }, { "input": "21 18", "output": "75" }, { "input": "234 234", "output": "10952" }, { "input": "4 4", "output": "4" }, { "input": "6 13", "output": "15" }, { "input": "3 9", "output": "6" }, { "input": "99999 99999", "output": "1999960001" }, { "input": "34 33", "output": "225" }, { "input": "2 2", "output": "0" }, { "input": "333 1", "output": "66" }, { "input": "3 3", "output": "2" }, { "input": "8 2", "output": "3" }, { "input": "2179 2218", "output": "966605" }, { "input": "1000000 999999", "output": "199999800000" }, { "input": "873828 774207", "output": "135304750879" }, { "input": "13 19", "output": "50" }, { "input": "1648 576469", "output": "190004183" }, { "input": "11 13", "output": "28" }, { "input": "5 8", "output": "8" }, { "input": "650074 943659", "output": "122689636154" }, { "input": "1 3", "output": "0" }, { "input": "54 43", "output": "465" }, { "input": "14 9", "output": "26" }, { "input": "2 3", "output": "1" }, { "input": "543 534", "output": "57993" }, { "input": "321 123", "output": "7896" }, { "input": "21 3", "output": "12" }, { "input": "2 1", "output": "0" }, { "input": "4 3", "output": "3" }, { "input": "47474 74747", "output": "709707816" }, { "input": "4 9", "output": "8" }, { "input": "7 4", "output": "6" }, { "input": "9 4", "output": "8" }, { "input": "12414 4214", "output": "10462520" }, { "input": "2 9", "output": "4" }, { "input": "253 821", "output": "41542" }, { "input": "2 4", "output": "2" } ]
1,612,118,404
2,147,483,647
Python 3
OK
TESTS
128
733
0
n,m = map(int,input().split()) gr = n if n>m else m sm = n+m-gr save=0 st=0 for i in range(1,sm+1): gr+=1 temp=gr//5 if i%5==0: st+=1 temp-=1*st save+=temp print(save)
Title: Alyona and Numbers Time Limit: None seconds Memory Limit: None megabytes Problem Description: After finishing eating her bun, Alyona came up with two integers *n* and *m*. She decided to write down two columns of integers — the first column containing integers from 1 to *n* and the second containing integers from 1 to *m*. Now the girl wants to count how many pairs of integers she can choose, one from the first column and the other from the second column, such that their sum is divisible by 5. Formally, Alyona wants to count the number of pairs of integers (*x*,<=*y*) such that 1<=≤<=*x*<=≤<=*n*, 1<=≤<=*y*<=≤<=*m* and equals 0. As usual, Alyona has some troubles and asks you to help. Input Specification: The only line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1<=000<=000). Output Specification: Print the only integer — the number of pairs of integers (*x*,<=*y*) such that 1<=≤<=*x*<=≤<=*n*, 1<=≤<=*y*<=≤<=*m* and (*x*<=+<=*y*) is divisible by 5. Demo Input: ['6 12\n', '11 14\n', '1 5\n', '3 8\n', '5 7\n', '21 21\n'] Demo Output: ['14\n', '31\n', '1\n', '5\n', '7\n', '88\n'] Note: Following pairs are suitable in the first sample case: - for *x* = 1 fits *y* equal to 4 or 9; - for *x* = 2 fits *y* equal to 3 or 8; - for *x* = 3 fits *y* equal to 2, 7 or 12; - for *x* = 4 fits *y* equal to 1, 6 or 11; - for *x* = 5 fits *y* equal to 5 or 10; - for *x* = 6 fits *y* equal to 4 or 9. Only the pair (1, 4) is suitable in the third sample case.
```python n,m = map(int,input().split()) gr = n if n>m else m sm = n+m-gr save=0 st=0 for i in range(1,sm+1): gr+=1 temp=gr//5 if i%5==0: st+=1 temp-=1*st save+=temp print(save) ```
3
749
A
Bachgold Problem
PROGRAMMING
800
[ "greedy", "implementation", "math", "number theory" ]
null
null
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1. Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*.
The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000).
The first line of the output contains a single integer *k* — maximum possible number of primes in representation. The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
[ "5\n", "6\n" ]
[ "2\n2 3\n", "3\n2 2 2\n" ]
none
500
[ { "input": "5", "output": "2\n2 3" }, { "input": "6", "output": "3\n2 2 2" }, { "input": "2", "output": "1\n2" }, { "input": "3", "output": "1\n3" }, { "input": "99999", "output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "100000", "output": "50000\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "7", "output": "3\n2 2 3" }, { "input": "4", "output": "2\n2 2" }, { "input": "8", "output": "4\n2 2 2 2" }, { "input": "9", "output": "4\n2 2 2 3" }, { "input": "99995", "output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "99996", "output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "10", "output": "5\n2 2 2 2 2" }, { "input": "11", "output": "5\n2 2 2 2 3" }, { "input": "99997", "output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "99998", "output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "12", "output": "6\n2 2 2 2 2 2" }, { "input": "13", "output": "6\n2 2 2 2 2 3" }, { "input": "99993", "output": "49996\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "99994", "output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "14", "output": "7\n2 2 2 2 2 2 2" }, { "input": "15", "output": "7\n2 2 2 2 2 2 3" }, { "input": "53", "output": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3" }, { "input": "57", "output": "28\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3" }, { "input": "61", "output": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3" }, { "input": "774", "output": "387\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "202", "output": "101\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2" }, { "input": "530", "output": "265\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "7166", "output": "3583\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "9294", "output": "4647\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "2422", "output": "1211\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "15326", "output": "7663\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "11454", "output": "5727\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "14878", "output": "7439\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." }, { "input": "90672", "output": "45336\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "99544", "output": "49772\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "90472", "output": "45236\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..." }, { "input": "23", "output": "11\n2 2 2 2 2 2 2 2 2 2 3" }, { "input": "93", "output": "46\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3" }, { "input": "19", "output": "9\n2 2 2 2 2 2 2 2 3" }, { "input": "11110", "output": "5555\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..." } ]
1,685,041,672
2,147,483,647
PyPy 3-64
OK
TESTS
41
62
2,150,400
def baghold(num): arr = [] if num % 2 == 0: print(num // 2) arr = ['2' for i in range(num // 2)] print(' '.join(arr)) else: print(num // 2) arr = ['2' for i in range(num // 2 -1)] arr.append('3') print(' '.join(arr)) baghold(int(input()))
Title: Bachgold Problem Time Limit: None seconds Memory Limit: None megabytes Problem Description: Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1. Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*. Input Specification: The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000). Output Specification: The first line of the output contains a single integer *k* — maximum possible number of primes in representation. The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them. Demo Input: ['5\n', '6\n'] Demo Output: ['2\n2 3\n', '3\n2 2 2\n'] Note: none
```python def baghold(num): arr = [] if num % 2 == 0: print(num // 2) arr = ['2' for i in range(num // 2)] print(' '.join(arr)) else: print(num // 2) arr = ['2' for i in range(num // 2 -1)] arr.append('3') print(' '.join(arr)) baghold(int(input())) ```
3
248
A
Cupboards
PROGRAMMING
800
[ "implementation" ]
null
null
One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house. Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find. And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open. Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position. Your task is to write a program that will determine the required number of seconds *t*.
The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero. The numbers in the lines are separated by single spaces.
In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs.
[ "5\n0 1\n1 0\n0 1\n1 1\n0 1\n" ]
[ "3\n" ]
none
500
[ { "input": "5\n0 1\n1 0\n0 1\n1 1\n0 1", "output": "3" }, { "input": "2\n0 0\n0 0", "output": "0" }, { "input": "3\n0 1\n1 1\n1 1", "output": "1" }, { "input": "8\n0 1\n1 0\n0 1\n1 1\n0 1\n1 0\n0 1\n1 0", "output": "7" }, { "input": "8\n1 0\n1 0\n1 0\n0 1\n0 1\n1 1\n1 1\n0 1", "output": "6" }, { "input": "15\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "5\n1 0\n1 0\n1 0\n0 1\n0 1", "output": "4" } ]
1,651,236,794
2,147,483,647
PyPy 3
OK
TESTS
57
436
4,812,800
import sys from collections import Counter, defaultdict, deque from heapq import heapify, heappush, heappop from functools import lru_cache from math import floor, ceil, sqrt, gcd from string import ascii_lowercase from math import gcd from bisect import bisect_left, bisect, bisect_right def read(): return input().strip() def read_int(): return int(read()) def read_str_list(): return read().split() def read_numeric_list(): return list(map(int, read_str_list())) def solve(): pass N = read_int() counts_left = Counter() counts_right = Counter() counts_left[0] = 0 counts_left[1] = 0 counts_right[0] = 0 counts_right[1] = 0 for _ in range(N): L, R = read_numeric_list() counts_left[L] += 1 counts_right[R] += 1 print(min(counts_left[0], counts_left[1]) + min(counts_right[0], counts_right[1]))
Title: Cupboards Time Limit: None seconds Memory Limit: None megabytes Problem Description: One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house. Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find. And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open. Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position. Your task is to write a program that will determine the required number of seconds *t*. Input Specification: The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero. The numbers in the lines are separated by single spaces. Output Specification: In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs. Demo Input: ['5\n0 1\n1 0\n0 1\n1 1\n0 1\n'] Demo Output: ['3\n'] Note: none
```python import sys from collections import Counter, defaultdict, deque from heapq import heapify, heappush, heappop from functools import lru_cache from math import floor, ceil, sqrt, gcd from string import ascii_lowercase from math import gcd from bisect import bisect_left, bisect, bisect_right def read(): return input().strip() def read_int(): return int(read()) def read_str_list(): return read().split() def read_numeric_list(): return list(map(int, read_str_list())) def solve(): pass N = read_int() counts_left = Counter() counts_right = Counter() counts_left[0] = 0 counts_left[1] = 0 counts_right[0] = 0 counts_right[1] = 0 for _ in range(N): L, R = read_numeric_list() counts_left[L] += 1 counts_right[R] += 1 print(min(counts_left[0], counts_left[1]) + min(counts_right[0], counts_right[1])) ```
3
268
A
Games
PROGRAMMING
800
[ "brute force" ]
null
null
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
In a single line print the number of games where the host team is going to play in the guest uniform.
[ "3\n1 2\n2 4\n3 4\n", "4\n100 42\n42 100\n5 42\n100 5\n", "2\n1 2\n1 2\n" ]
[ "1\n", "5\n", "0\n" ]
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
500
[ { "input": "3\n1 2\n2 4\n3 4", "output": "1" }, { "input": "4\n100 42\n42 100\n5 42\n100 5", "output": "5" }, { "input": "2\n1 2\n1 2", "output": "0" }, { "input": "7\n4 7\n52 55\n16 4\n55 4\n20 99\n3 4\n7 52", "output": "6" }, { "input": "10\n68 42\n1 35\n25 70\n59 79\n65 63\n46 6\n28 82\n92 62\n43 96\n37 28", "output": "1" }, { "input": "30\n10 39\n89 1\n78 58\n75 99\n36 13\n77 50\n6 97\n79 28\n27 52\n56 5\n93 96\n40 21\n33 74\n26 37\n53 59\n98 56\n61 65\n42 57\n9 7\n25 63\n74 34\n96 84\n95 47\n12 23\n34 21\n71 6\n27 13\n15 47\n64 14\n12 77", "output": "6" }, { "input": "30\n46 100\n87 53\n34 84\n44 66\n23 20\n50 34\n90 66\n17 39\n13 22\n94 33\n92 46\n63 78\n26 48\n44 61\n3 19\n41 84\n62 31\n65 89\n23 28\n58 57\n19 85\n26 60\n75 66\n69 67\n76 15\n64 15\n36 72\n90 89\n42 69\n45 35", "output": "4" }, { "input": "2\n46 6\n6 46", "output": "2" }, { "input": "29\n8 18\n33 75\n69 22\n97 95\n1 97\n78 10\n88 18\n13 3\n19 64\n98 12\n79 92\n41 72\n69 15\n98 31\n57 74\n15 56\n36 37\n15 66\n63 100\n16 42\n47 56\n6 4\n73 15\n30 24\n27 71\n12 19\n88 69\n85 6\n50 11", "output": "10" }, { "input": "23\n43 78\n31 28\n58 80\n66 63\n20 4\n51 95\n40 20\n50 14\n5 34\n36 39\n77 42\n64 97\n62 89\n16 56\n8 34\n58 16\n37 35\n37 66\n8 54\n50 36\n24 8\n68 48\n85 33", "output": "6" }, { "input": "13\n76 58\n32 85\n99 79\n23 58\n96 59\n72 35\n53 43\n96 55\n41 78\n75 10\n28 11\n72 7\n52 73", "output": "0" }, { "input": "18\n6 90\n70 79\n26 52\n67 81\n29 95\n41 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 2", "output": "1" }, { "input": "18\n6 90\n100 79\n26 100\n67 100\n29 100\n100 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 100", "output": "8" }, { "input": "30\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "450" }, { "input": "30\n100 99\n58 59\n56 57\n54 55\n52 53\n50 51\n48 49\n46 47\n44 45\n42 43\n40 41\n38 39\n36 37\n34 35\n32 33\n30 31\n28 29\n26 27\n24 25\n22 23\n20 21\n18 19\n16 17\n14 15\n12 13\n10 11\n8 9\n6 7\n4 5\n2 3", "output": "0" }, { "input": "15\n9 3\n2 6\n7 6\n5 10\n9 5\n8 1\n10 5\n2 8\n4 5\n9 8\n5 3\n3 8\n9 8\n4 10\n8 5", "output": "20" }, { "input": "15\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n1 2", "output": "108" }, { "input": "25\n2 1\n1 2\n1 2\n1 2\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n1 2\n2 1\n2 1\n2 1\n2 1\n1 2", "output": "312" }, { "input": "25\n91 57\n2 73\n54 57\n2 57\n23 57\n2 6\n57 54\n57 23\n91 54\n91 23\n57 23\n91 57\n54 2\n6 91\n57 54\n2 57\n57 91\n73 91\n57 23\n91 57\n2 73\n91 2\n23 6\n2 73\n23 6", "output": "96" }, { "input": "28\n31 66\n31 91\n91 31\n97 66\n31 66\n31 66\n66 91\n91 31\n97 31\n91 97\n97 31\n66 31\n66 97\n91 31\n31 66\n31 66\n66 31\n31 97\n66 97\n97 31\n31 91\n66 91\n91 66\n31 66\n91 66\n66 31\n66 31\n91 97", "output": "210" }, { "input": "29\n78 27\n50 68\n24 26\n68 43\n38 78\n26 38\n78 28\n28 26\n27 24\n23 38\n24 26\n24 43\n61 50\n38 78\n27 23\n61 26\n27 28\n43 23\n28 78\n43 27\n43 78\n27 61\n28 38\n61 78\n50 26\n43 27\n26 78\n28 50\n43 78", "output": "73" }, { "input": "29\n80 27\n69 80\n27 80\n69 80\n80 27\n80 27\n80 27\n80 69\n27 69\n80 69\n80 27\n27 69\n69 27\n80 69\n27 69\n69 80\n27 69\n80 69\n80 27\n69 27\n27 69\n27 80\n80 27\n69 80\n27 69\n80 69\n69 80\n69 80\n27 80", "output": "277" }, { "input": "30\n19 71\n7 89\n89 71\n21 7\n19 21\n7 89\n19 71\n89 8\n89 21\n19 8\n21 7\n8 89\n19 89\n7 21\n19 8\n19 7\n7 19\n8 21\n71 21\n71 89\n7 19\n7 19\n21 7\n21 19\n21 19\n71 8\n21 8\n71 19\n19 71\n8 21", "output": "154" }, { "input": "30\n44 17\n44 17\n44 17\n17 44\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n44 17\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n17 44\n44 17\n44 17\n44 17\n17 44\n17 44\n44 17\n17 44\n44 17\n44 17\n44 17", "output": "418" }, { "input": "22\n78 92\n15 92\n92 78\n78 80\n92 16\n24 80\n92 16\n16 92\n78 16\n24 78\n80 78\n92 80\n16 80\n80 78\n15 78\n92 16\n24 15\n24 80\n80 16\n16 80\n92 80\n24 80", "output": "74" }, { "input": "24\n9 83\n90 31\n83 3\n83 3\n21 31\n83 3\n32 31\n12 21\n31 21\n90 32\n32 21\n12 9\n12 31\n9 83\n83 12\n32 3\n32 83\n90 31\n9 32\n31 21\n83 90\n32 21\n21 3\n32 9", "output": "59" }, { "input": "30\n67 21\n85 39\n85 87\n21 39\n66 85\n10 95\n10 21\n87 85\n82 21\n67 21\n95 10\n21 39\n82 21\n21 66\n66 39\n95 30\n67 85\n66 82\n85 82\n21 66\n10 39\n67 10\n21 85\n10 82\n85 95\n10 85\n21 39\n85 39\n39 10\n95 67", "output": "100" }, { "input": "4\n8 7\n8 7\n7 8\n7 8", "output": "8" }, { "input": "6\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1", "output": "10" }, { "input": "12\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "72" }, { "input": "4\n1 2\n1 2\n2 1\n2 1", "output": "8" } ]
1,677,055,251
2,147,483,647
PyPy 3-64
OK
TESTS
31
124
0
n=int(input()) i=0 list1=[] list2=[] while i<n: h,a=(map(int, input().split())) list1.append(h) list2.append(a) i+=1 u=0 count1=0 while u<n: count1+=list2.count(list1[u]) u+=1 print(count1)
Title: Games Time Limit: None seconds Memory Limit: None megabytes Problem Description: Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question. Input Specification: The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively. Output Specification: In a single line print the number of games where the host team is going to play in the guest uniform. Demo Input: ['3\n1 2\n2 4\n3 4\n', '4\n100 42\n42 100\n5 42\n100 5\n', '2\n1 2\n1 2\n'] Demo Output: ['1\n', '5\n', '0\n'] Note: In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
```python n=int(input()) i=0 list1=[] list2=[] while i<n: h,a=(map(int, input().split())) list1.append(h) list2.append(a) i+=1 u=0 count1=0 while u<n: count1+=list2.count(list1[u]) u+=1 print(count1) ```
3
427
A
Police Recruits
PROGRAMMING
800
[ "implementation" ]
null
null
The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups. Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime. If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated. Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated.
The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers. If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time.
Print a single integer, the number of crimes which will go untreated.
[ "3\n-1 -1 1\n", "8\n1 -1 1 -1 -1 1 1 1\n", "11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n" ]
[ "2\n", "1\n", "8\n" ]
Lets consider the second example: 1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired. The answer is one, as one crime (on step 5) will go untreated.
500
[ { "input": "3\n-1 -1 1", "output": "2" }, { "input": "8\n1 -1 1 -1 -1 1 1 1", "output": "1" }, { "input": "11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1", "output": "8" }, { "input": "7\n-1 -1 1 1 -1 -1 1", "output": "2" }, { "input": "21\n-1 -1 -1 -1 -1 3 2 -1 6 -1 -1 2 1 -1 2 2 1 6 5 -1 5", "output": "5" }, { "input": "98\n-1 -1 1 -1 -1 -1 -1 1 -1 -1 1 -1 -1 1 -1 1 1 1 -1 1 1 1 1 1 -1 1 -1 -1 -1 -1 1 -1 -1 1 1 -1 1 1 1 -1 -1 -1 -1 -1 -1 1 -1 -1 -1 1 -1 1 -1 1 -1 1 1 1 1 1 1 1 -1 -1 1 1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 1 -1 1 1 1 -1 1 1 -1 -1 -1 1 1 1 -1 -1 -1 1 -1 1 1", "output": "13" }, { "input": "3\n-1 5 4", "output": "1" }, { "input": "146\n4 -1 -1 -1 -1 -1 -1 -1 -1 -1 4 -1 3 -1 3 -1 -1 1 4 -1 2 -1 -1 3 -1 -1 -1 4 1 -1 -1 -1 4 -1 -1 -1 -1 -1 -1 3 2 -1 3 2 4 5 2 4 1 5 -1 -1 2 -1 -1 1 -1 5 3 -1 1 2 2 3 5 3 -1 -1 3 -1 -1 3 5 5 -1 -1 5 -1 4 4 1 -1 -1 -1 2 1 -1 -1 -1 2 5 3 -1 -1 -1 3 -1 5 4 -1 1 -1 -1 3 -1 -1 3 1 1 2 -1 -1 -1 1 3 1 -1 2 -1 -1 5 5 -1 -1 3 4 5 1 -1 2 -1 -1 -1 3 -1 5 3 2 -1 2 -1 -1 5 -1 3 -1", "output": "5" }, { "input": "1\n2", "output": "0" }, { "input": "1\n-1", "output": "1" }, { "input": "2\n1 -1", "output": "0" }, { "input": "2\n-1 1", "output": "1" }, { "input": "2\n1 1", "output": "0" }, { "input": "2\n-1 -1", "output": "2" }, { "input": "4\n10 -1 -1 -1", "output": "0" }, { "input": "1\n1", "output": "0" }, { "input": "4\n-1 -1 1 1", "output": "2" } ]
1,699,804,756
2,147,483,647
Python 3
OK
TESTS
63
62
10,547,200
n = int(input()) n2 = list(map(int, input().split())) lose = 0 menti = 0 for i in range(len(n2)): if n2[i] < 0 and menti == 0: lose += 1 elif n2[i] < 0 and menti != 0: menti -= 1 elif n2[i] > 0: menti += n2[i] print(lose)
Title: Police Recruits Time Limit: None seconds Memory Limit: None megabytes Problem Description: The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups. Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime. If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated. Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated. Input Specification: The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers. If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time. Output Specification: Print a single integer, the number of crimes which will go untreated. Demo Input: ['3\n-1 -1 1\n', '8\n1 -1 1 -1 -1 1 1 1\n', '11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n'] Demo Output: ['2\n', '1\n', '8\n'] Note: Lets consider the second example: 1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired. The answer is one, as one crime (on step 5) will go untreated.
```python n = int(input()) n2 = list(map(int, input().split())) lose = 0 menti = 0 for i in range(len(n2)): if n2[i] < 0 and menti == 0: lose += 1 elif n2[i] < 0 and menti != 0: menti -= 1 elif n2[i] > 0: menti += n2[i] print(lose) ```
3
581
A
Vasya the Hipster
PROGRAMMING
800
[ "implementation", "math" ]
null
null
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks. According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot. Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them. Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Can you help him?
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
[ "3 1\n", "2 3\n", "7 3\n" ]
[ "1 1\n", "2 0\n", "3 2\n" ]
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
500
[ { "input": "3 1", "output": "1 1" }, { "input": "2 3", "output": "2 0" }, { "input": "7 3", "output": "3 2" }, { "input": "100 100", "output": "100 0" }, { "input": "4 10", "output": "4 3" }, { "input": "6 10", "output": "6 2" }, { "input": "6 11", "output": "6 2" }, { "input": "10 40", "output": "10 15" }, { "input": "11 56", "output": "11 22" }, { "input": "34 30", "output": "30 2" }, { "input": "33 33", "output": "33 0" }, { "input": "100 45", "output": "45 27" }, { "input": "100 23", "output": "23 38" }, { "input": "45 12", "output": "12 16" }, { "input": "1 1", "output": "1 0" }, { "input": "1 100", "output": "1 49" }, { "input": "100 1", "output": "1 49" }, { "input": "68 59", "output": "59 4" }, { "input": "45 99", "output": "45 27" }, { "input": "99 100", "output": "99 0" }, { "input": "100 98", "output": "98 1" }, { "input": "59 12", "output": "12 23" }, { "input": "86 4", "output": "4 41" }, { "input": "68 21", "output": "21 23" }, { "input": "100 11", "output": "11 44" }, { "input": "100 10", "output": "10 45" }, { "input": "15 45", "output": "15 15" }, { "input": "11 32", "output": "11 10" }, { "input": "34 96", "output": "34 31" }, { "input": "89 89", "output": "89 0" } ]
1,685,117,766
2,147,483,647
Python 3
OK
TESTS
30
46
0
num1, num2 = map(int, input().split()) if num1 >= num2: num1 -= num2 num1 //= 2 print(num2, num1) else: num2 -= num1 num2 //= 2 print(num1, num2)
Title: Vasya the Hipster Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks. According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot. Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them. Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Can you help him? Input Specification: The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got. Output Specification: Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day. Demo Input: ['3 1\n', '2 3\n', '7 3\n'] Demo Output: ['1 1\n', '2 0\n', '3 2\n'] Note: In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
```python num1, num2 = map(int, input().split()) if num1 >= num2: num1 -= num2 num1 //= 2 print(num2, num1) else: num2 -= num1 num2 //= 2 print(num1, num2) ```
3
808
B
Average Sleep Time
PROGRAMMING
1,300
[ "data structures", "implementation", "math" ]
null
null
It's been almost a week since Polycarp couldn't get rid of insomnia. And as you may already know, one week in Berland lasts *k* days! When Polycarp went to a doctor with his problem, the doctor asked him about his sleeping schedule (more specifically, the average amount of hours of sleep per week). Luckily, Polycarp kept records of sleep times for the last *n* days. So now he has a sequence *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* is the sleep time on the *i*-th day. The number of records is so large that Polycarp is unable to calculate the average value by himself. Thus he is asking you to help him with the calculations. To get the average Polycarp is going to consider *k* consecutive days as a week. So there will be *n*<=-<=*k*<=+<=1 weeks to take into consideration. For example, if *k*<==<=2, *n*<==<=3 and *a*<==<=[3,<=4,<=7], then the result is . You should write a program which will calculate average sleep times of Polycarp over all weeks.
The first line contains two integer numbers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=2·105). The second line contains *n* integer numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105).
Output average sleeping time over all weeks. The answer is considered to be correct if its absolute or relative error does not exceed 10<=-<=6. In particular, it is enough to output real number with at least 6 digits after the decimal point.
[ "3 2\n3 4 7\n", "1 1\n10\n", "8 2\n1 2 4 100000 123 456 789 1\n" ]
[ "9.0000000000\n", "10.0000000000\n", "28964.2857142857\n" ]
In the third example there are *n* - *k* + 1 = 7 weeks, so the answer is sums of all weeks divided by 7.
0
[ { "input": "3 2\n3 4 7", "output": "9.0000000000" }, { "input": "1 1\n10", "output": "10.0000000000" }, { "input": "8 2\n1 2 4 100000 123 456 789 1", "output": "28964.2857142857" }, { "input": "1 1\n1", "output": "1.0000000000" }, { "input": "1 1\n100000", "output": "100000.0000000000" }, { "input": "3 1\n1 2 3", "output": "2.0000000000" }, { "input": "10 4\n11 3 5 20 12 7 9 2 2 20", "output": "36.2857142857" }, { "input": "10 5\n15 9 3 2 17 10 9 18 4 19", "output": "50.3333333333" }, { "input": "10 6\n19 3 20 16 14 10 1 13 7 3", "output": "65.8000000000" }, { "input": "10 7\n8 16 2 13 15 9 5 13 9 2", "output": "68.2500000000" }, { "input": "10 4\n127 1459 718 1183 880 1044 1857 1340 725 1496", "output": "4574.4285714286" }, { "input": "10 5\n1384 1129 1780 1960 1567 1928 12 1523 1165 344", "output": "6931.3333333333" } ]
1,505,991,823
2,147,483,647
Python 3
OK
TESTS
29
233
14,233,600
f = lambda: map(int, input().split()) n, k = f() t = list(f()) h = s = sum(t[:k]) for i in range(n - k): s += t[k + i] - t[i] h += s print(h / (n - k + 1))
Title: Average Sleep Time Time Limit: None seconds Memory Limit: None megabytes Problem Description: It's been almost a week since Polycarp couldn't get rid of insomnia. And as you may already know, one week in Berland lasts *k* days! When Polycarp went to a doctor with his problem, the doctor asked him about his sleeping schedule (more specifically, the average amount of hours of sleep per week). Luckily, Polycarp kept records of sleep times for the last *n* days. So now he has a sequence *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* is the sleep time on the *i*-th day. The number of records is so large that Polycarp is unable to calculate the average value by himself. Thus he is asking you to help him with the calculations. To get the average Polycarp is going to consider *k* consecutive days as a week. So there will be *n*<=-<=*k*<=+<=1 weeks to take into consideration. For example, if *k*<==<=2, *n*<==<=3 and *a*<==<=[3,<=4,<=7], then the result is . You should write a program which will calculate average sleep times of Polycarp over all weeks. Input Specification: The first line contains two integer numbers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=2·105). The second line contains *n* integer numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105). Output Specification: Output average sleeping time over all weeks. The answer is considered to be correct if its absolute or relative error does not exceed 10<=-<=6. In particular, it is enough to output real number with at least 6 digits after the decimal point. Demo Input: ['3 2\n3 4 7\n', '1 1\n10\n', '8 2\n1 2 4 100000 123 456 789 1\n'] Demo Output: ['9.0000000000\n', '10.0000000000\n', '28964.2857142857\n'] Note: In the third example there are *n* - *k* + 1 = 7 weeks, so the answer is sums of all weeks divided by 7.
```python f = lambda: map(int, input().split()) n, k = f() t = list(f()) h = s = sum(t[:k]) for i in range(n - k): s += t[k + i] - t[i] h += s print(h / (n - k + 1)) ```
3
139
A
Petr and Book
PROGRAMMING
1,000
[ "implementation" ]
null
null
One Sunday Petr went to a bookshop and bought a new book on sports programming. The book had exactly *n* pages. Petr decided to start reading it starting from the next day, that is, from Monday. Petr's got a very tight schedule and for each day of the week he knows how many pages he will be able to read on that day. Some days are so busy that Petr will have no time to read whatsoever. However, we know that he will be able to read at least one page a week. Assuming that Petr will not skip days and will read as much as he can every day, determine on which day of the week he will read the last page of the book.
The first input line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of pages in the book. The second line contains seven non-negative space-separated integers that do not exceed 1000 — those integers represent how many pages Petr can read on Monday, Tuesday, Wednesday, Thursday, Friday, Saturday and Sunday correspondingly. It is guaranteed that at least one of those numbers is larger than zero.
Print a single number — the number of the day of the week, when Petr will finish reading the book. The days of the week are numbered starting with one in the natural order: Monday, Tuesday, Wednesday, Thursday, Friday, Saturday, Sunday.
[ "100\n15 20 20 15 10 30 45\n", "2\n1 0 0 0 0 0 0\n" ]
[ "6\n", "1\n" ]
Note to the first sample: By the end of Monday and therefore, by the beginning of Tuesday Petr has 85 pages left. He has 65 pages left by Wednesday, 45 by Thursday, 30 by Friday, 20 by Saturday and on Saturday Petr finishes reading the book (and he also has time to read 10 pages of something else). Note to the second sample: On Monday of the first week Petr will read the first page. On Monday of the second week Petr will read the second page and will finish reading the book.
500
[ { "input": "100\n15 20 20 15 10 30 45", "output": "6" }, { "input": "2\n1 0 0 0 0 0 0", "output": "1" }, { "input": "100\n100 200 100 200 300 400 500", "output": "1" }, { "input": "3\n1 1 1 1 1 1 1", "output": "3" }, { "input": "1\n1 1 1 1 1 1 1", "output": "1" }, { "input": "20\n5 3 7 2 1 6 4", "output": "6" }, { "input": "10\n5 1 1 1 1 1 5", "output": "6" }, { "input": "50\n10 1 10 1 10 1 10", "output": "1" }, { "input": "77\n11 11 11 11 11 11 10", "output": "1" }, { "input": "1\n1000 1000 1000 1000 1000 1000 1000", "output": "1" }, { "input": "1000\n100 100 100 100 100 100 100", "output": "3" }, { "input": "999\n10 20 10 20 30 20 10", "output": "3" }, { "input": "433\n109 58 77 10 39 125 15", "output": "7" }, { "input": "1\n0 0 0 0 0 0 1", "output": "7" }, { "input": "5\n1 0 1 0 1 0 1", "output": "1" }, { "input": "997\n1 1 0 0 1 0 1", "output": "1" }, { "input": "1000\n1 1 1 1 1 1 1", "output": "6" }, { "input": "1000\n1000 1000 1000 1000 1000 1000 1000", "output": "1" }, { "input": "1000\n1 0 0 0 0 0 0", "output": "1" }, { "input": "1000\n0 0 0 0 0 0 1", "output": "7" }, { "input": "1000\n1 0 0 1 0 0 1", "output": "1" }, { "input": "509\n105 23 98 0 7 0 155", "output": "2" }, { "input": "7\n1 1 1 1 1 1 1", "output": "7" }, { "input": "2\n1 1 0 0 0 0 0", "output": "2" }, { "input": "1\n0 0 0 0 0 1 0", "output": "6" }, { "input": "10\n0 0 0 0 0 0 1", "output": "7" }, { "input": "5\n0 0 0 0 0 6 0", "output": "6" }, { "input": "3\n0 1 0 0 0 0 0", "output": "2" }, { "input": "10\n0 0 0 0 0 0 10", "output": "7" }, { "input": "28\n1 2 3 4 5 6 7", "output": "7" }, { "input": "100\n5 5 5 5 5 5 5", "output": "6" }, { "input": "4\n1 0 0 0 0 0 1", "output": "7" }, { "input": "2\n0 0 0 0 0 0 1", "output": "7" }, { "input": "7\n0 0 0 0 0 0 7", "output": "7" }, { "input": "7\n2 1 1 1 1 1 0", "output": "6" }, { "input": "2\n0 0 1 1 0 0 0", "output": "4" }, { "input": "6\n1 1 1 1 1 1 0", "output": "6" }, { "input": "5\n1 1 1 0 0 1 1", "output": "7" }, { "input": "100\n10 20 30 10 10 10 10", "output": "7" }, { "input": "1\n0 0 0 1 0 0 0", "output": "4" }, { "input": "70\n10 10 10 10 10 10 10", "output": "7" }, { "input": "22\n1 2 3 4 5 6 10", "output": "7" }, { "input": "5\n0 0 0 1 0 0 0", "output": "4" }, { "input": "2\n0 0 0 1 0 0 0", "output": "4" }, { "input": "6\n1 0 0 0 0 0 2", "output": "7" }, { "input": "10\n1 2 2 1 2 1 1", "output": "7" }, { "input": "5\n0 0 0 0 0 0 10", "output": "7" }, { "input": "4\n0 1 1 0 0 0 0", "output": "3" }, { "input": "100\n0 0 0 0 0 1 0", "output": "6" } ]
1,695,379,595
2,147,483,647
PyPy 3-64
OK
TESTS
49
124
1,536,000
n = int(input()) d = list(map(int, input().split())) s = 0; ns=1 while ns: for i in range(1,8): s = s+d[i-1] if s >= n: print(i) ns = 0 break;
Title: Petr and Book Time Limit: None seconds Memory Limit: None megabytes Problem Description: One Sunday Petr went to a bookshop and bought a new book on sports programming. The book had exactly *n* pages. Petr decided to start reading it starting from the next day, that is, from Monday. Petr's got a very tight schedule and for each day of the week he knows how many pages he will be able to read on that day. Some days are so busy that Petr will have no time to read whatsoever. However, we know that he will be able to read at least one page a week. Assuming that Petr will not skip days and will read as much as he can every day, determine on which day of the week he will read the last page of the book. Input Specification: The first input line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of pages in the book. The second line contains seven non-negative space-separated integers that do not exceed 1000 — those integers represent how many pages Petr can read on Monday, Tuesday, Wednesday, Thursday, Friday, Saturday and Sunday correspondingly. It is guaranteed that at least one of those numbers is larger than zero. Output Specification: Print a single number — the number of the day of the week, when Petr will finish reading the book. The days of the week are numbered starting with one in the natural order: Monday, Tuesday, Wednesday, Thursday, Friday, Saturday, Sunday. Demo Input: ['100\n15 20 20 15 10 30 45\n', '2\n1 0 0 0 0 0 0\n'] Demo Output: ['6\n', '1\n'] Note: Note to the first sample: By the end of Monday and therefore, by the beginning of Tuesday Petr has 85 pages left. He has 65 pages left by Wednesday, 45 by Thursday, 30 by Friday, 20 by Saturday and on Saturday Petr finishes reading the book (and he also has time to read 10 pages of something else). Note to the second sample: On Monday of the first week Petr will read the first page. On Monday of the second week Petr will read the second page and will finish reading the book.
```python n = int(input()) d = list(map(int, input().split())) s = 0; ns=1 while ns: for i in range(1,8): s = s+d[i-1] if s >= n: print(i) ns = 0 break; ```
3
780
A
Andryusha and Socks
PROGRAMMING
800
[ "implementation" ]
null
null
Andryusha is an orderly boy and likes to keep things in their place. Today he faced a problem to put his socks in the wardrobe. He has *n* distinct pairs of socks which are initially in a bag. The pairs are numbered from 1 to *n*. Andryusha wants to put paired socks together and put them in the wardrobe. He takes the socks one by one from the bag, and for each sock he looks whether the pair of this sock has been already took out of the bag, or not. If not (that means the pair of this sock is still in the bag), he puts the current socks on the table in front of him. Otherwise, he puts both socks from the pair to the wardrobe. Andryusha remembers the order in which he took the socks from the bag. Can you tell him what is the maximum number of socks that were on the table at the same time?
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=105) — the number of sock pairs. The second line contains 2*n* integers *x*1,<=*x*2,<=...,<=*x*2*n* (1<=≤<=*x**i*<=≤<=*n*), which describe the order in which Andryusha took the socks from the bag. More precisely, *x**i* means that the *i*-th sock Andryusha took out was from pair *x**i*. It is guaranteed that Andryusha took exactly two socks of each pair.
Print single integer — the maximum number of socks that were on the table at the same time.
[ "1\n1 1\n", "3\n2 1 1 3 2 3\n" ]
[ "1\n", "2\n" ]
In the first example Andryusha took a sock from the first pair and put it on the table. Then he took the next sock which is from the first pair as well, so he immediately puts both socks to the wardrobe. Thus, at most one sock was on the table at the same time. In the second example Andryusha behaved as follows: - Initially the table was empty, he took out a sock from pair 2 and put it on the table. - Sock (2) was on the table. Andryusha took out a sock from pair 1 and put it on the table. - Socks (1, 2) were on the table. Andryusha took out a sock from pair 1, and put this pair into the wardrobe. - Sock (2) was on the table. Andryusha took out a sock from pair 3 and put it on the table. - Socks (2, 3) were on the table. Andryusha took out a sock from pair 2, and put this pair into the wardrobe. - Sock (3) was on the table. Andryusha took out a sock from pair 3 and put this pair into the wardrobe.
500
[ { "input": "1\n1 1", "output": "1" }, { "input": "3\n2 1 1 3 2 3", "output": "2" }, { "input": "5\n5 1 3 2 4 3 1 2 4 5", "output": "5" }, { "input": "10\n4 2 6 3 4 8 7 1 1 5 2 10 6 8 3 5 10 9 9 7", "output": "6" }, { "input": "50\n30 47 31 38 37 50 36 43 9 23 2 2 15 31 14 49 9 16 6 44 27 14 5 6 3 47 25 26 1 35 3 15 24 19 8 46 49 41 4 26 40 28 42 11 34 35 46 18 7 28 18 40 19 42 4 41 38 48 50 12 29 39 33 17 25 22 22 21 36 45 27 30 20 7 13 29 39 44 21 8 37 45 34 1 20 10 11 17 33 12 43 13 10 16 48 24 32 5 23 32", "output": "25" }, { "input": "50\n1 1 2 2 3 3 4 4 5 5 6 6 7 7 8 8 9 9 10 10 11 11 12 12 13 13 14 14 15 15 16 16 17 17 18 18 19 19 20 20 21 21 22 22 23 23 24 24 25 25 26 26 27 27 28 28 29 29 30 30 31 31 32 32 33 33 34 34 35 35 36 36 37 37 38 38 39 39 40 40 41 41 42 42 43 43 44 44 45 45 46 46 47 47 48 48 49 49 50 50", "output": "1" }, { "input": "50\n50 50 49 49 48 48 47 47 46 46 45 45 44 44 43 43 42 42 41 41 40 40 39 39 38 38 37 37 36 36 35 35 34 34 33 33 32 32 31 31 30 30 29 29 28 28 27 27 26 26 25 25 24 24 23 23 22 22 21 21 20 20 19 19 18 18 17 17 16 16 15 15 14 14 13 13 12 12 11 11 10 10 9 9 8 8 7 7 6 6 5 5 4 4 3 3 2 2 1 1", "output": "1" }, { "input": "50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50", "output": "50" }, { "input": "50\n50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "50" }, { "input": "10\n2 9 4 1 6 7 10 3 1 5 8 6 2 3 10 7 4 8 5 9", "output": "9" } ]
1,596,800,747
2,147,483,647
Python 3
OK
TESTS
56
249
20,992,000
a=int(input()) b=list(map(int, input().split())) cnt=0 x=set() y=[] for i in b: x^={i} if len(x)>cnt: cnt=len(x) print(cnt)
Title: Andryusha and Socks Time Limit: None seconds Memory Limit: None megabytes Problem Description: Andryusha is an orderly boy and likes to keep things in their place. Today he faced a problem to put his socks in the wardrobe. He has *n* distinct pairs of socks which are initially in a bag. The pairs are numbered from 1 to *n*. Andryusha wants to put paired socks together and put them in the wardrobe. He takes the socks one by one from the bag, and for each sock he looks whether the pair of this sock has been already took out of the bag, or not. If not (that means the pair of this sock is still in the bag), he puts the current socks on the table in front of him. Otherwise, he puts both socks from the pair to the wardrobe. Andryusha remembers the order in which he took the socks from the bag. Can you tell him what is the maximum number of socks that were on the table at the same time? Input Specification: The first line contains the single integer *n* (1<=≤<=*n*<=≤<=105) — the number of sock pairs. The second line contains 2*n* integers *x*1,<=*x*2,<=...,<=*x*2*n* (1<=≤<=*x**i*<=≤<=*n*), which describe the order in which Andryusha took the socks from the bag. More precisely, *x**i* means that the *i*-th sock Andryusha took out was from pair *x**i*. It is guaranteed that Andryusha took exactly two socks of each pair. Output Specification: Print single integer — the maximum number of socks that were on the table at the same time. Demo Input: ['1\n1 1\n', '3\n2 1 1 3 2 3\n'] Demo Output: ['1\n', '2\n'] Note: In the first example Andryusha took a sock from the first pair and put it on the table. Then he took the next sock which is from the first pair as well, so he immediately puts both socks to the wardrobe. Thus, at most one sock was on the table at the same time. In the second example Andryusha behaved as follows: - Initially the table was empty, he took out a sock from pair 2 and put it on the table. - Sock (2) was on the table. Andryusha took out a sock from pair 1 and put it on the table. - Socks (1, 2) were on the table. Andryusha took out a sock from pair 1, and put this pair into the wardrobe. - Sock (2) was on the table. Andryusha took out a sock from pair 3 and put it on the table. - Socks (2, 3) were on the table. Andryusha took out a sock from pair 2, and put this pair into the wardrobe. - Sock (3) was on the table. Andryusha took out a sock from pair 3 and put this pair into the wardrobe.
```python a=int(input()) b=list(map(int, input().split())) cnt=0 x=set() y=[] for i in b: x^={i} if len(x)>cnt: cnt=len(x) print(cnt) ```
3
612
A
The Text Splitting
PROGRAMMING
1,300
[ "brute force", "implementation", "strings" ]
null
null
You are given the string *s* of length *n* and the numbers *p*,<=*q*. Split the string *s* to pieces of length *p* and *q*. For example, the string "Hello" for *p*<==<=2, *q*<==<=3 can be split to the two strings "Hel" and "lo" or to the two strings "He" and "llo". Note it is allowed to split the string *s* to the strings only of length *p* or to the strings only of length *q* (see the second sample test).
The first line contains three positive integers *n*,<=*p*,<=*q* (1<=≤<=*p*,<=*q*<=≤<=*n*<=≤<=100). The second line contains the string *s* consists of lowercase and uppercase latin letters and digits.
If it's impossible to split the string *s* to the strings of length *p* and *q* print the only number "-1". Otherwise in the first line print integer *k* — the number of strings in partition of *s*. Each of the next *k* lines should contain the strings in partition. Each string should be of the length *p* or *q*. The string should be in order of their appearing in string *s* — from left to right. If there are several solutions print any of them.
[ "5 2 3\nHello\n", "10 9 5\nCodeforces\n", "6 4 5\nPrivet\n", "8 1 1\nabacabac\n" ]
[ "2\nHe\nllo\n", "2\nCodef\norces\n", "-1\n", "8\na\nb\na\nc\na\nb\na\nc\n" ]
none
0
[ { "input": "5 2 3\nHello", "output": "2\nHe\nllo" }, { "input": "10 9 5\nCodeforces", "output": "2\nCodef\norces" }, { "input": "6 4 5\nPrivet", "output": "-1" }, { "input": "8 1 1\nabacabac", "output": "8\na\nb\na\nc\na\nb\na\nc" }, { "input": "1 1 1\n1", "output": "1\n1" }, { "input": "10 8 1\nuTl9w4lcdo", "output": "10\nu\nT\nl\n9\nw\n4\nl\nc\nd\no" }, { "input": "20 6 4\nfmFRpk2NrzSvnQC9gB61", "output": "5\nfmFR\npk2N\nrzSv\nnQC9\ngB61" }, { "input": "30 23 6\nWXDjl9kitaDTY673R5xyTlbL9gqeQ6", "output": "5\nWXDjl9\nkitaDT\nY673R5\nxyTlbL\n9gqeQ6" }, { "input": "40 14 3\nSOHBIkWEv7ScrkHgMtFFxP9G7JQLYXFoH1sJDAde", "output": "6\nSOHBIkWEv7Scrk\nHgMtFFxP9G7JQL\nYXF\noH1\nsJD\nAde" }, { "input": "50 16 3\nXCgVJUu4aMQ7HMxZjNxe3XARNiahK303g9y7NV8oN6tWdyXrlu", "output": "8\nXCgVJUu4aMQ7HMxZ\njNxe3XARNiahK303\ng9y\n7NV\n8oN\n6tW\ndyX\nrlu" }, { "input": "60 52 8\nhae0PYwXcW2ziQCOSci5VaElHLZCZI81ULSHgpyG3fuZaP0fHjN4hCKogONj", "output": "2\nhae0PYwXcW2ziQCOSci5VaElHLZCZI81ULSHgpyG3fuZaP0fHjN4\nhCKogONj" }, { "input": "70 50 5\n1BH1ECq7hjzooQOZdbiYHTAgATcP5mxI7kLI9rqA9AriWc9kE5KoLa1zmuTDFsd2ClAPPY", "output": "14\n1BH1E\nCq7hj\nzooQO\nZdbiY\nHTAgA\nTcP5m\nxI7kL\nI9rqA\n9AriW\nc9kE5\nKoLa1\nzmuTD\nFsd2C\nlAPPY" }, { "input": "80 51 8\no2mpu1FCofuiLQb472qczCNHfVzz5TfJtVMrzgN3ff7FwlAY0fQ0ROhWmIX2bggodORNA76bHMjA5yyc", "output": "10\no2mpu1FC\nofuiLQb4\n72qczCNH\nfVzz5TfJ\ntVMrzgN3\nff7FwlAY\n0fQ0ROhW\nmIX2bggo\ndORNA76b\nHMjA5yyc" }, { "input": "90 12 7\nclcImtsw176FFOA6OHGFxtEfEyhFh5bH4iktV0Y8onIcn0soTwiiHUFRWC6Ow36tT5bsQjgrVSTcB8fAVoe7dJIWkE", "output": "10\nclcImtsw176F\nFOA6OHGFxtEf\nEyhFh5bH4ikt\nV0Y8onIcn0so\nTwiiHUF\nRWC6Ow3\n6tT5bsQ\njgrVSTc\nB8fAVoe\n7dJIWkE" }, { "input": "100 25 5\n2SRB9mRpXMRND5zQjeRxc4GhUBlEQSmLgnUtB9xTKoC5QM9uptc8dKwB88XRJy02r7edEtN2C6D60EjzK1EHPJcWNj6fbF8kECeB", "output": "20\n2SRB9\nmRpXM\nRND5z\nQjeRx\nc4GhU\nBlEQS\nmLgnU\ntB9xT\nKoC5Q\nM9upt\nc8dKw\nB88XR\nJy02r\n7edEt\nN2C6D\n60Ejz\nK1EHP\nJcWNj\n6fbF8\nkECeB" }, { "input": "100 97 74\nxL8yd8lENYnXZs28xleyci4SxqsjZqkYzkEbQXfLQ4l4gKf9QQ9xjBjeZ0f9xQySf5psDUDkJEtPLsa62n4CLc6lF6E2yEqvt4EJ", "output": "-1" }, { "input": "51 25 11\nwpk5wqrB6d3qE1slUrzJwMFafnnOu8aESlvTEb7Pp42FDG2iGQn", "output": "-1" }, { "input": "70 13 37\nfzL91QIJvNoZRP4A9aNRT2GTksd8jEb1713pnWFaCGKHQ1oYvlTHXIl95lqyZRKJ1UPYvT", "output": "-1" }, { "input": "10 3 1\nXQ2vXLPShy", "output": "10\nX\nQ\n2\nv\nX\nL\nP\nS\nh\ny" }, { "input": "4 2 3\naaaa", "output": "2\naa\naa" }, { "input": "100 1 1\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb", "output": "100\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb" }, { "input": "99 2 4\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "-1" }, { "input": "11 2 3\nhavanahavan", "output": "4\nha\nvan\naha\nvan" }, { "input": "100 2 2\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "50\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa" }, { "input": "17 3 5\ngopstopmipodoshli", "output": "5\ngop\nsto\npmi\npod\noshli" }, { "input": "5 4 3\nfoyku", "output": "-1" }, { "input": "99 2 2\n123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789", "output": "-1" }, { "input": "99 2 2\nrecursionishellrecursionishellrecursionishellrecursionishellrecursionishellrecursionishelldontuseit", "output": "-1" }, { "input": "11 2 3\nqibwnnvqqgo", "output": "4\nqi\nbwn\nnvq\nqgo" }, { "input": "4 4 3\nhhhh", "output": "1\nhhhh" }, { "input": "99 2 2\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "-1" }, { "input": "99 2 5\nhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh", "output": "21\nhh\nhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh" }, { "input": "10 5 9\nCodeforces", "output": "2\nCodef\norces" }, { "input": "10 5 9\naaaaaaaaaa", "output": "2\naaaaa\naaaaa" }, { "input": "11 3 2\nmlmqpohwtsf", "output": "5\nmlm\nqp\noh\nwt\nsf" }, { "input": "3 3 2\nzyx", "output": "1\nzyx" }, { "input": "100 3 3\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "-1" }, { "input": "4 2 3\nzyxw", "output": "2\nzy\nxw" }, { "input": "3 2 3\nejt", "output": "1\nejt" }, { "input": "5 2 4\nzyxwv", "output": "-1" }, { "input": "100 1 1\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "100\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na" }, { "input": "100 5 4\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "25\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa" }, { "input": "3 2 2\nzyx", "output": "-1" }, { "input": "99 2 2\nhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh", "output": "-1" }, { "input": "26 8 9\nabcabcabcabcabcabcabcabcab", "output": "3\nabcabcab\ncabcabcab\ncabcabcab" }, { "input": "6 3 5\naaaaaa", "output": "2\naaa\naaa" }, { "input": "3 2 3\nzyx", "output": "1\nzyx" }, { "input": "5 5 2\naaaaa", "output": "1\naaaaa" }, { "input": "4 3 2\nzyxw", "output": "2\nzy\nxw" }, { "input": "5 4 3\nzyxwv", "output": "-1" }, { "input": "95 3 29\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab", "output": "23\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabcabcabcabcabcabcabcabcabcab" }, { "input": "3 2 2\naaa", "output": "-1" }, { "input": "91 62 3\nfjzhkfwzoabaauvbkuzaahkozofaophaafhfpuhobufawkzbavaazwavwppfwapkapaofbfjwaavajojgjguahphofj", "output": "-1" }, { "input": "99 2 2\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabc", "output": "-1" }, { "input": "56 13 5\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab", "output": "8\nabcabcabcabca\nbcabcabcabcab\ncabca\nbcabc\nabcab\ncabca\nbcabc\nabcab" }, { "input": "79 7 31\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca", "output": "-1" }, { "input": "92 79 6\nxlvplpckwnhmctoethhslkcyashqtsoeltriddglfwtgkfvkvgytygbcyohrvcxvosdioqvackxiuifmkgdngvbbudcb", "output": "-1" }, { "input": "48 16 13\nibhfinipihcbsqnvtgsbkobepmwymlyfmlfgblvhlfhyojsy", "output": "3\nibhfinipihcbsqnv\ntgsbkobepmwymlyf\nmlfgblvhlfhyojsy" }, { "input": "16 3 7\naaaaaaaaaaaaaaaa", "output": "4\naaa\naaa\naaa\naaaaaaa" }, { "input": "11 10 3\naaaaaaaaaaa", "output": "-1" }, { "input": "11 8 8\naaaaaaaaaaa", "output": "-1" }, { "input": "11 7 3\naaaaaaaaaaa", "output": "-1" }, { "input": "41 3 4\nabcabcabcabcabcabcabcabcabcabcabcabcabcab", "output": "11\nabc\nabc\nabc\nabca\nbcab\ncabc\nabca\nbcab\ncabc\nabca\nbcab" }, { "input": "11 3 2\naaaaaaaaaaa", "output": "5\naaa\naa\naa\naa\naa" }, { "input": "14 9 4\nabcdefghijklmn", "output": "-1" }, { "input": "9 9 5\n123456789", "output": "1\n123456789" }, { "input": "92 10 41\nmeotryyfneonmnrvfnhqlehlxtvpracifpadcofecvbikoitrlgeftiqofpvacgocrdiquhatlqosqvtduenaqkwrnnw", "output": "3\nmeotryyfne\nonmnrvfnhqlehlxtvpracifpadcofecvbikoitrlg\neftiqofpvacgocrdiquhatlqosqvtduenaqkwrnnw" }, { "input": "17 16 3\ndxyhgtsxtuyljmclj", "output": "-1" }, { "input": "82 13 30\nfmtwumakkejtolxqxrnydhqoufwtdwldfxcfjrndauqcarhbwmdwxsxfbqjsfspuxobywhcrvlndsdmkqd", "output": "5\nfmtwumakkejto\nlxqxrnydhqouf\nwtdwldfxcfjrn\ndauqcarhbwmdw\nxsxfbqjsfspuxobywhcrvlndsdmkqd" }, { "input": "95 3 3\nihnfqcswushyoirjxlxxnwqtwtaowounkumxukwpacxwatimhhhoggqwkkspcplvyndfukbxickcixidgxkjtnpkoeiwlor", "output": "-1" }, { "input": "7 5 3\nzyxwvut", "output": "-1" }, { "input": "17 16 4\nctvfhkiakagcilrdw", "output": "-1" } ]
1,685,454,887
2,147,483,647
Python 3
OK
TESTS
72
46
0
n,p,q=map(int,input().split()) s=str(input()) mi=min(p,q) mx=max(p,q) for i in range(0,n//mi+1): nimi=n-i*mi if 0==nimi%mx: print(nimi//mx+i) for j in range(0,i): print(s[j*mi:(j+1)*mi]) s=s[i*mi:] for j in range(0,nimi//mx): print(s[j*mx:(j+1)*mx]) exit() print(-1)
Title: The Text Splitting Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given the string *s* of length *n* and the numbers *p*,<=*q*. Split the string *s* to pieces of length *p* and *q*. For example, the string "Hello" for *p*<==<=2, *q*<==<=3 can be split to the two strings "Hel" and "lo" or to the two strings "He" and "llo". Note it is allowed to split the string *s* to the strings only of length *p* or to the strings only of length *q* (see the second sample test). Input Specification: The first line contains three positive integers *n*,<=*p*,<=*q* (1<=≤<=*p*,<=*q*<=≤<=*n*<=≤<=100). The second line contains the string *s* consists of lowercase and uppercase latin letters and digits. Output Specification: If it's impossible to split the string *s* to the strings of length *p* and *q* print the only number "-1". Otherwise in the first line print integer *k* — the number of strings in partition of *s*. Each of the next *k* lines should contain the strings in partition. Each string should be of the length *p* or *q*. The string should be in order of their appearing in string *s* — from left to right. If there are several solutions print any of them. Demo Input: ['5 2 3\nHello\n', '10 9 5\nCodeforces\n', '6 4 5\nPrivet\n', '8 1 1\nabacabac\n'] Demo Output: ['2\nHe\nllo\n', '2\nCodef\norces\n', '-1\n', '8\na\nb\na\nc\na\nb\na\nc\n'] Note: none
```python n,p,q=map(int,input().split()) s=str(input()) mi=min(p,q) mx=max(p,q) for i in range(0,n//mi+1): nimi=n-i*mi if 0==nimi%mx: print(nimi//mx+i) for j in range(0,i): print(s[j*mi:(j+1)*mi]) s=s[i*mi:] for j in range(0,nimi//mx): print(s[j*mx:(j+1)*mx]) exit() print(-1) ```
3