contestId
int64
0
1.01k
index
stringclasses
40 values
name
stringlengths
2
54
type
stringclasses
2 values
rating
int64
0
3.4k
tags
listlengths
0
7
title
stringclasses
393 values
time-limit
stringclasses
7 values
memory-limit
stringclasses
6 values
problem-description
stringlengths
0
2.97k
input-specification
stringlengths
4
1.87k
output-specification
stringlengths
4
1.12k
demo-input
listlengths
0
7
demo-output
listlengths
0
7
note
stringlengths
0
5.24k
points
float64
0
3.5k
test_cases
listlengths
0
402
creationTimeSeconds
int64
1.37B
1.7B
relativeTimeSeconds
int64
8
2.15B
programmingLanguage
stringclasses
3 values
verdict
stringclasses
1 value
testset
stringclasses
9 values
passedTestCount
int64
1
402
timeConsumedMillis
int64
15
8.06k
memoryConsumedBytes
int64
0
514M
code
stringlengths
11
61.4k
prompt
stringlengths
297
7.35k
response
stringlengths
25
61.4k
score
float64
2.82
3.99
136
A
Presents
PROGRAMMING
800
[ "implementation" ]
null
null
Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there. If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift. Now Petya wants to know for each friend *i* the number of a friend who has given him a gift.
The first line contains one integer *n* (1<=≀<=*n*<=≀<=100) β€” the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* β€” the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves.
Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*.
[ "4\n2 3 4 1\n", "3\n1 3 2\n", "2\n1 2\n" ]
[ "4 1 2 3\n", "1 3 2\n", "1 2\n" ]
none
500
[ { "input": "4\n2 3 4 1", "output": "4 1 2 3" }, { "input": "3\n1 3 2", "output": "1 3 2" }, { "input": "2\n1 2", "output": "1 2" }, { "input": "1\n1", "output": "1" }, { "input": "10\n1 3 2 6 4 5 7 9 8 10", "output": "1 3 2 5 6 4 7 9 8 10" }, { "input": "5\n5 4 3 2 1", "output": "5 4 3 2 1" }, { "input": "20\n2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19" }, { "input": "21\n3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19", "output": "3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19" }, { "input": "10\n3 4 5 6 7 8 9 10 1 2", "output": "9 10 1 2 3 4 5 6 7 8" }, { "input": "8\n1 5 3 7 2 6 4 8", "output": "1 5 3 7 2 6 4 8" }, { "input": "50\n49 22 4 2 20 46 7 32 5 19 48 24 26 15 45 21 44 11 50 43 39 17 31 1 42 34 3 27 36 25 12 30 13 33 28 35 18 6 8 37 38 14 10 9 29 16 40 23 41 47", "output": "24 4 27 3 9 38 7 39 44 43 18 31 33 42 14 46 22 37 10 5 16 2 48 12 30 13 28 35 45 32 23 8 34 26 36 29 40 41 21 47 49 25 20 17 15 6 50 11 1 19" }, { "input": "34\n13 20 33 30 15 11 27 4 8 2 29 25 24 7 3 22 18 10 26 16 5 1 32 9 34 6 12 14 28 19 31 21 23 17", "output": "22 10 15 8 21 26 14 9 24 18 6 27 1 28 5 20 34 17 30 2 32 16 33 13 12 19 7 29 11 4 31 23 3 25" }, { "input": "92\n23 1 6 4 84 54 44 76 63 34 61 20 48 13 28 78 26 46 90 72 24 55 91 89 53 38 82 5 79 92 29 32 15 64 11 88 60 70 7 66 18 59 8 57 19 16 42 21 80 71 62 27 75 86 36 9 83 73 74 50 43 31 56 30 17 33 40 81 49 12 10 41 22 77 25 68 51 2 47 3 58 69 87 67 39 37 35 65 14 45 52 85", "output": "2 78 80 4 28 3 39 43 56 71 35 70 14 89 33 46 65 41 45 12 48 73 1 21 75 17 52 15 31 64 62 32 66 10 87 55 86 26 85 67 72 47 61 7 90 18 79 13 69 60 77 91 25 6 22 63 44 81 42 37 11 51 9 34 88 40 84 76 82 38 50 20 58 59 53 8 74 16 29 49 68 27 57 5 92 54 83 36 24 19 23 30" }, { "input": "49\n30 24 33 48 7 3 17 2 8 35 10 39 23 40 46 32 18 21 26 22 1 16 47 45 41 28 31 6 12 43 27 11 13 37 19 15 44 5 29 42 4 38 20 34 14 9 25 36 49", "output": "21 8 6 41 38 28 5 9 46 11 32 29 33 45 36 22 7 17 35 43 18 20 13 2 47 19 31 26 39 1 27 16 3 44 10 48 34 42 12 14 25 40 30 37 24 15 23 4 49" }, { "input": "12\n3 8 7 4 6 5 2 1 11 9 10 12", "output": "8 7 1 4 6 5 3 2 10 11 9 12" }, { "input": "78\n16 56 36 78 21 14 9 77 26 57 70 61 41 47 18 44 5 31 50 74 65 52 6 39 22 62 67 69 43 7 64 29 24 40 48 51 73 54 72 12 19 34 4 25 55 33 17 35 23 53 10 8 27 32 42 68 20 63 3 2 1 71 58 46 13 30 49 11 37 66 38 60 28 75 15 59 45 76", "output": "61 60 59 43 17 23 30 52 7 51 68 40 65 6 75 1 47 15 41 57 5 25 49 33 44 9 53 73 32 66 18 54 46 42 48 3 69 71 24 34 13 55 29 16 77 64 14 35 67 19 36 22 50 38 45 2 10 63 76 72 12 26 58 31 21 70 27 56 28 11 62 39 37 20 74 78 8 4" }, { "input": "64\n64 57 40 3 15 8 62 18 33 59 51 19 22 13 4 37 47 45 50 35 63 11 58 42 46 21 7 2 41 48 32 23 28 38 17 12 24 27 49 31 60 6 30 25 61 52 26 54 9 14 29 20 44 39 55 10 34 16 5 56 1 36 53 43", "output": "61 28 4 15 59 42 27 6 49 56 22 36 14 50 5 58 35 8 12 52 26 13 32 37 44 47 38 33 51 43 40 31 9 57 20 62 16 34 54 3 29 24 64 53 18 25 17 30 39 19 11 46 63 48 55 60 2 23 10 41 45 7 21 1" }, { "input": "49\n38 20 49 32 14 41 39 45 25 48 40 19 26 43 34 12 10 3 35 42 5 7 46 47 4 2 13 22 16 24 33 15 11 18 29 31 23 9 44 36 6 17 37 1 30 28 8 21 27", "output": "44 26 18 25 21 41 22 47 38 17 33 16 27 5 32 29 42 34 12 2 48 28 37 30 9 13 49 46 35 45 36 4 31 15 19 40 43 1 7 11 6 20 14 39 8 23 24 10 3" }, { "input": "78\n17 50 30 48 33 12 42 4 18 53 76 67 38 3 20 72 51 55 60 63 46 10 57 45 54 32 24 62 8 11 35 44 65 74 58 28 2 6 56 52 39 23 47 49 61 1 66 41 15 77 7 27 78 13 14 34 5 31 37 21 40 16 29 69 59 43 64 36 70 19 25 73 71 75 9 68 26 22", "output": "46 37 14 8 57 38 51 29 75 22 30 6 54 55 49 62 1 9 70 15 60 78 42 27 71 77 52 36 63 3 58 26 5 56 31 68 59 13 41 61 48 7 66 32 24 21 43 4 44 2 17 40 10 25 18 39 23 35 65 19 45 28 20 67 33 47 12 76 64 69 73 16 72 34 74 11 50 53" }, { "input": "29\n14 21 27 1 4 18 10 17 20 23 2 24 7 9 28 22 8 25 12 15 11 6 16 29 3 26 19 5 13", "output": "4 11 25 5 28 22 13 17 14 7 21 19 29 1 20 23 8 6 27 9 2 16 10 12 18 26 3 15 24" }, { "input": "82\n6 1 10 75 28 66 61 81 78 63 17 19 58 34 49 12 67 50 41 44 3 15 59 38 51 72 36 11 46 29 18 64 27 23 13 53 56 68 2 25 47 40 69 54 42 5 60 55 4 16 24 79 57 20 7 73 32 80 76 52 82 37 26 31 65 8 39 62 33 71 30 9 77 43 48 74 70 22 14 45 35 21", "output": "2 39 21 49 46 1 55 66 72 3 28 16 35 79 22 50 11 31 12 54 82 78 34 51 40 63 33 5 30 71 64 57 69 14 81 27 62 24 67 42 19 45 74 20 80 29 41 75 15 18 25 60 36 44 48 37 53 13 23 47 7 68 10 32 65 6 17 38 43 77 70 26 56 76 4 59 73 9 52 58 8 61" }, { "input": "82\n74 18 15 69 71 77 19 26 80 20 66 7 30 82 22 48 21 44 52 65 64 61 35 49 12 8 53 81 54 16 11 9 40 46 13 1 29 58 5 41 55 4 78 60 6 51 56 2 38 36 34 62 63 25 17 67 45 14 32 37 75 79 10 47 27 39 31 68 59 24 50 43 72 70 42 28 76 23 57 3 73 33", "output": "36 48 80 42 39 45 12 26 32 63 31 25 35 58 3 30 55 2 7 10 17 15 78 70 54 8 65 76 37 13 67 59 82 51 23 50 60 49 66 33 40 75 72 18 57 34 64 16 24 71 46 19 27 29 41 47 79 38 69 44 22 52 53 21 20 11 56 68 4 74 5 73 81 1 61 77 6 43 62 9 28 14" }, { "input": "45\n2 32 34 13 3 15 16 33 22 12 31 38 42 14 27 7 36 8 4 19 45 41 5 35 10 11 39 20 29 44 17 9 6 40 37 28 25 21 1 30 24 18 43 26 23", "output": "39 1 5 19 23 33 16 18 32 25 26 10 4 14 6 7 31 42 20 28 38 9 45 41 37 44 15 36 29 40 11 2 8 3 24 17 35 12 27 34 22 13 43 30 21" }, { "input": "45\n4 32 33 39 43 21 22 35 45 7 14 5 16 9 42 31 24 36 17 29 41 25 37 34 27 20 11 44 3 13 19 2 1 10 26 30 38 18 6 8 15 23 40 28 12", "output": "33 32 29 1 12 39 10 40 14 34 27 45 30 11 41 13 19 38 31 26 6 7 42 17 22 35 25 44 20 36 16 2 3 24 8 18 23 37 4 43 21 15 5 28 9" }, { "input": "74\n48 72 40 67 17 4 27 53 11 32 25 9 74 2 41 24 56 22 14 21 33 5 18 55 20 7 29 36 69 13 52 19 38 30 68 59 66 34 63 6 47 45 54 44 62 12 50 71 16 10 8 64 57 73 46 26 49 42 3 23 35 1 61 39 70 60 65 43 15 28 37 51 58 31", "output": "62 14 59 6 22 40 26 51 12 50 9 46 30 19 69 49 5 23 32 25 20 18 60 16 11 56 7 70 27 34 74 10 21 38 61 28 71 33 64 3 15 58 68 44 42 55 41 1 57 47 72 31 8 43 24 17 53 73 36 66 63 45 39 52 67 37 4 35 29 65 48 2 54 13" }, { "input": "47\n9 26 27 10 6 34 28 42 39 22 45 21 11 43 14 47 38 15 40 32 46 1 36 29 17 25 2 23 31 5 24 4 7 8 12 19 16 44 37 20 18 33 30 13 35 41 3", "output": "22 27 47 32 30 5 33 34 1 4 13 35 44 15 18 37 25 41 36 40 12 10 28 31 26 2 3 7 24 43 29 20 42 6 45 23 39 17 9 19 46 8 14 38 11 21 16" }, { "input": "49\n14 38 6 29 9 49 36 43 47 3 44 20 34 15 7 11 1 28 12 40 16 37 31 10 42 41 33 21 18 30 5 27 17 35 25 26 45 19 2 13 23 32 4 22 46 48 24 39 8", "output": "17 39 10 43 31 3 15 49 5 24 16 19 40 1 14 21 33 29 38 12 28 44 41 47 35 36 32 18 4 30 23 42 27 13 34 7 22 2 48 20 26 25 8 11 37 45 9 46 6" }, { "input": "100\n78 56 31 91 90 95 16 65 58 77 37 89 33 61 10 76 62 47 35 67 69 7 63 83 22 25 49 8 12 30 39 44 57 64 48 42 32 11 70 43 55 50 99 24 85 73 45 14 54 21 98 84 74 2 26 18 9 36 80 53 75 46 66 86 59 93 87 68 94 13 72 28 79 88 92 29 52 82 34 97 19 38 1 41 27 4 40 5 96 100 51 6 20 23 81 15 17 3 60 71", "output": "83 54 98 86 88 92 22 28 57 15 38 29 70 48 96 7 97 56 81 93 50 25 94 44 26 55 85 72 76 30 3 37 13 79 19 58 11 82 31 87 84 36 40 32 47 62 18 35 27 42 91 77 60 49 41 2 33 9 65 99 14 17 23 34 8 63 20 68 21 39 100 71 46 53 61 16 10 1 73 59 95 78 24 52 45 64 67 74 12 5 4 75 66 69 6 89 80 51 43 90" }, { "input": "22\n12 8 11 2 16 7 13 6 22 21 20 10 4 14 18 1 5 15 3 19 17 9", "output": "16 4 19 13 17 8 6 2 22 12 3 1 7 14 18 5 21 15 20 11 10 9" }, { "input": "72\n16 11 49 51 3 27 60 55 23 40 66 7 53 70 13 5 15 32 18 72 33 30 8 31 46 12 28 67 25 38 50 22 69 34 71 52 58 39 24 35 42 9 41 26 62 1 63 65 36 64 68 61 37 14 45 47 6 57 54 20 17 2 56 59 29 10 4 48 21 43 19 44", "output": "46 62 5 67 16 57 12 23 42 66 2 26 15 54 17 1 61 19 71 60 69 32 9 39 29 44 6 27 65 22 24 18 21 34 40 49 53 30 38 10 43 41 70 72 55 25 56 68 3 31 4 36 13 59 8 63 58 37 64 7 52 45 47 50 48 11 28 51 33 14 35 20" }, { "input": "63\n21 56 11 10 62 24 20 42 28 52 38 2 37 43 48 22 7 8 40 14 13 46 53 1 23 4 60 63 51 36 25 12 39 32 49 16 58 44 31 61 33 50 55 54 45 6 47 41 9 57 30 29 26 18 19 27 15 34 3 35 59 5 17", "output": "24 12 59 26 62 46 17 18 49 4 3 32 21 20 57 36 63 54 55 7 1 16 25 6 31 53 56 9 52 51 39 34 41 58 60 30 13 11 33 19 48 8 14 38 45 22 47 15 35 42 29 10 23 44 43 2 50 37 61 27 40 5 28" }, { "input": "18\n2 16 8 4 18 12 3 6 5 9 10 15 11 17 14 13 1 7", "output": "17 1 7 4 9 8 18 3 10 11 13 6 16 15 12 2 14 5" }, { "input": "47\n6 9 10 41 25 3 4 37 20 1 36 22 29 27 11 24 43 31 12 17 34 42 38 39 13 2 7 21 18 5 15 35 44 26 33 46 19 40 30 14 28 23 47 32 45 8 16", "output": "10 26 6 7 30 1 27 46 2 3 15 19 25 40 31 47 20 29 37 9 28 12 42 16 5 34 14 41 13 39 18 44 35 21 32 11 8 23 24 38 4 22 17 33 45 36 43" }, { "input": "96\n41 91 48 88 29 57 1 19 44 43 37 5 10 75 25 63 30 78 76 53 8 92 18 70 39 17 49 60 9 16 3 34 86 59 23 79 55 45 72 51 28 33 96 40 26 54 6 32 89 61 85 74 7 82 52 31 64 66 94 95 11 22 2 73 35 13 42 71 14 47 84 69 50 67 58 12 77 46 38 68 15 36 20 93 27 90 83 56 87 4 21 24 81 62 80 65", "output": "7 63 31 90 12 47 53 21 29 13 61 76 66 69 81 30 26 23 8 83 91 62 35 92 15 45 85 41 5 17 56 48 42 32 65 82 11 79 25 44 1 67 10 9 38 78 70 3 27 73 40 55 20 46 37 88 6 75 34 28 50 94 16 57 96 58 74 80 72 24 68 39 64 52 14 19 77 18 36 95 93 54 87 71 51 33 89 4 49 86 2 22 84 59 60 43" }, { "input": "73\n67 24 39 22 23 20 48 34 42 40 19 70 65 69 64 21 53 11 59 15 26 10 30 33 72 29 55 25 56 71 8 9 57 49 41 61 13 12 6 27 66 36 47 50 73 60 2 37 7 4 51 17 1 46 14 62 35 3 45 63 43 58 54 32 31 5 28 44 18 52 68 38 16", "output": "53 47 58 50 66 39 49 31 32 22 18 38 37 55 20 73 52 69 11 6 16 4 5 2 28 21 40 67 26 23 65 64 24 8 57 42 48 72 3 10 35 9 61 68 59 54 43 7 34 44 51 70 17 63 27 29 33 62 19 46 36 56 60 15 13 41 1 71 14 12 30 25 45" }, { "input": "81\n25 2 78 40 12 80 69 13 49 43 17 33 23 54 32 61 77 66 27 71 24 26 42 55 60 9 5 30 7 37 45 63 53 11 38 44 68 34 28 52 67 22 57 46 47 50 8 16 79 62 4 36 20 14 73 64 6 76 35 74 58 10 29 81 59 31 19 1 75 39 70 18 41 21 72 65 3 48 15 56 51", "output": "68 2 77 51 27 57 29 47 26 62 34 5 8 54 79 48 11 72 67 53 74 42 13 21 1 22 19 39 63 28 66 15 12 38 59 52 30 35 70 4 73 23 10 36 31 44 45 78 9 46 81 40 33 14 24 80 43 61 65 25 16 50 32 56 76 18 41 37 7 71 20 75 55 60 69 58 17 3 49 6 64" }, { "input": "12\n12 3 1 5 11 6 7 10 2 8 9 4", "output": "3 9 2 12 4 6 7 10 11 8 5 1" }, { "input": "47\n7 21 41 18 40 31 12 28 24 14 43 23 33 10 19 38 26 8 34 15 29 44 5 13 39 25 3 27 20 42 35 9 2 1 30 46 36 32 4 22 37 45 6 47 11 16 17", "output": "34 33 27 39 23 43 1 18 32 14 45 7 24 10 20 46 47 4 15 29 2 40 12 9 26 17 28 8 21 35 6 38 13 19 31 37 41 16 25 5 3 30 11 22 42 36 44" }, { "input": "8\n1 3 5 2 4 8 6 7", "output": "1 4 2 5 3 7 8 6" }, { "input": "38\n28 8 2 33 20 32 26 29 23 31 15 38 11 37 18 21 22 19 4 34 1 35 16 7 17 6 27 30 36 12 9 24 25 13 5 3 10 14", "output": "21 3 36 19 35 26 24 2 31 37 13 30 34 38 11 23 25 15 18 5 16 17 9 32 33 7 27 1 8 28 10 6 4 20 22 29 14 12" }, { "input": "10\n2 9 4 6 10 1 7 5 3 8", "output": "6 1 9 3 8 4 7 10 2 5" }, { "input": "23\n20 11 15 1 5 12 23 9 2 22 13 19 16 14 7 4 8 21 6 17 18 10 3", "output": "4 9 23 16 5 19 15 17 8 22 2 6 11 14 3 13 20 21 12 1 18 10 7" }, { "input": "10\n2 4 9 3 6 8 10 5 1 7", "output": "9 1 4 2 8 5 10 6 3 7" }, { "input": "55\n9 48 23 49 11 24 4 22 34 32 17 45 39 13 14 21 19 25 2 31 37 7 55 36 20 51 5 12 54 10 35 40 43 1 46 18 53 41 38 26 29 50 3 42 52 27 8 28 47 33 6 16 30 44 15", "output": "34 19 43 7 27 51 22 47 1 30 5 28 14 15 55 52 11 36 17 25 16 8 3 6 18 40 46 48 41 53 20 10 50 9 31 24 21 39 13 32 38 44 33 54 12 35 49 2 4 42 26 45 37 29 23" }, { "input": "58\n49 13 12 54 2 38 56 11 33 25 26 19 28 8 23 41 20 36 46 55 15 35 9 7 32 37 58 6 3 14 47 31 40 30 53 44 4 50 29 34 10 43 39 57 5 22 27 45 51 42 24 16 18 21 52 17 48 1", "output": "58 5 29 37 45 28 24 14 23 41 8 3 2 30 21 52 56 53 12 17 54 46 15 51 10 11 47 13 39 34 32 25 9 40 22 18 26 6 43 33 16 50 42 36 48 19 31 57 1 38 49 55 35 4 20 7 44 27" }, { "input": "34\n20 25 2 3 33 29 1 16 14 7 21 9 32 31 6 26 22 4 27 23 24 10 34 12 19 15 5 18 28 17 13 8 11 30", "output": "7 3 4 18 27 15 10 32 12 22 33 24 31 9 26 8 30 28 25 1 11 17 20 21 2 16 19 29 6 34 14 13 5 23" }, { "input": "53\n47 29 46 25 23 13 7 31 33 4 38 11 35 16 42 14 15 43 34 39 28 18 6 45 30 1 40 20 2 37 5 32 24 12 44 26 27 3 19 51 36 21 22 9 10 50 41 48 49 53 8 17 52", "output": "26 29 38 10 31 23 7 51 44 45 12 34 6 16 17 14 52 22 39 28 42 43 5 33 4 36 37 21 2 25 8 32 9 19 13 41 30 11 20 27 47 15 18 35 24 3 1 48 49 46 40 53 50" }, { "input": "99\n77 87 90 48 53 38 68 6 28 57 35 82 63 71 60 41 3 12 86 65 10 59 22 67 33 74 93 27 24 1 61 43 25 4 51 52 15 88 9 31 30 42 89 49 23 21 29 32 46 73 37 16 5 69 56 26 92 64 20 54 75 14 98 13 94 2 95 7 36 66 58 8 50 78 84 45 11 96 76 62 97 80 40 39 47 85 34 79 83 17 91 72 19 44 70 81 55 99 18", "output": "30 66 17 34 53 8 68 72 39 21 77 18 64 62 37 52 90 99 93 59 46 23 45 29 33 56 28 9 47 41 40 48 25 87 11 69 51 6 84 83 16 42 32 94 76 49 85 4 44 73 35 36 5 60 97 55 10 71 22 15 31 80 13 58 20 70 24 7 54 95 14 92 50 26 61 79 1 74 88 82 96 12 89 75 86 19 2 38 43 3 91 57 27 65 67 78 81 63 98" }, { "input": "32\n17 29 2 6 30 8 26 7 1 27 10 9 13 24 31 21 15 19 22 18 4 11 25 28 32 3 23 12 5 14 20 16", "output": "9 3 26 21 29 4 8 6 12 11 22 28 13 30 17 32 1 20 18 31 16 19 27 14 23 7 10 24 2 5 15 25" }, { "input": "65\n18 40 1 60 17 19 4 6 12 49 28 58 2 25 13 14 64 56 61 34 62 30 59 51 26 8 33 63 36 48 46 7 43 21 31 27 11 44 29 5 32 23 35 9 53 57 52 50 15 38 42 3 54 65 55 41 20 24 22 47 45 10 39 16 37", "output": "3 13 52 7 40 8 32 26 44 62 37 9 15 16 49 64 5 1 6 57 34 59 42 58 14 25 36 11 39 22 35 41 27 20 43 29 65 50 63 2 56 51 33 38 61 31 60 30 10 48 24 47 45 53 55 18 46 12 23 4 19 21 28 17 54" }, { "input": "71\n35 50 55 58 25 32 26 40 63 34 44 53 24 18 37 7 64 27 56 65 1 19 2 43 42 14 57 47 22 13 59 61 39 67 30 45 54 38 33 48 6 5 3 69 36 21 41 4 16 46 20 17 15 12 10 70 68 23 60 31 52 29 66 28 51 49 62 11 8 9 71", "output": "21 23 43 48 42 41 16 69 70 55 68 54 30 26 53 49 52 14 22 51 46 29 58 13 5 7 18 64 62 35 60 6 39 10 1 45 15 38 33 8 47 25 24 11 36 50 28 40 66 2 65 61 12 37 3 19 27 4 31 59 32 67 9 17 20 63 34 57 44 56 71" }, { "input": "74\n33 8 42 63 64 61 31 74 11 50 68 14 36 25 57 30 7 44 21 15 6 9 23 59 46 3 73 16 62 51 40 60 41 54 5 39 35 28 48 4 58 12 66 69 13 26 71 1 24 19 29 52 37 2 20 43 18 72 17 56 34 38 65 67 27 10 47 70 53 32 45 55 49 22", "output": "48 54 26 40 35 21 17 2 22 66 9 42 45 12 20 28 59 57 50 55 19 74 23 49 14 46 65 38 51 16 7 70 1 61 37 13 53 62 36 31 33 3 56 18 71 25 67 39 73 10 30 52 69 34 72 60 15 41 24 32 6 29 4 5 63 43 64 11 44 68 47 58 27 8" }, { "input": "96\n78 10 82 46 38 91 77 69 2 27 58 80 79 44 59 41 6 31 76 11 42 48 51 37 19 87 43 25 52 32 1 39 63 29 21 65 53 74 92 16 15 95 90 83 30 73 71 5 50 17 96 33 86 60 67 64 20 26 61 40 55 88 94 93 9 72 47 57 14 45 22 3 54 68 13 24 4 7 56 81 89 70 49 8 84 28 18 62 35 36 75 23 66 85 34 12", "output": "31 9 72 77 48 17 78 84 65 2 20 96 75 69 41 40 50 87 25 57 35 71 92 76 28 58 10 86 34 45 18 30 52 95 89 90 24 5 32 60 16 21 27 14 70 4 67 22 83 49 23 29 37 73 61 79 68 11 15 54 59 88 33 56 36 93 55 74 8 82 47 66 46 38 91 19 7 1 13 12 80 3 44 85 94 53 26 62 81 43 6 39 64 63 42 51" }, { "input": "7\n2 1 5 7 3 4 6", "output": "2 1 5 6 3 7 4" }, { "input": "51\n8 33 37 2 16 22 24 30 4 9 5 15 27 3 18 39 31 26 10 17 46 41 25 14 6 1 29 48 36 20 51 49 21 43 19 13 38 50 47 34 11 23 28 12 42 7 32 40 44 45 35", "output": "26 4 14 9 11 25 46 1 10 19 41 44 36 24 12 5 20 15 35 30 33 6 42 7 23 18 13 43 27 8 17 47 2 40 51 29 3 37 16 48 22 45 34 49 50 21 39 28 32 38 31" }, { "input": "27\n12 14 7 3 20 21 25 13 22 15 23 4 2 24 10 17 19 8 26 11 27 18 9 5 6 1 16", "output": "26 13 4 12 24 25 3 18 23 15 20 1 8 2 10 27 16 22 17 5 6 9 11 14 7 19 21" }, { "input": "71\n51 13 20 48 54 23 24 64 14 62 71 67 57 53 3 30 55 43 33 25 39 40 66 6 46 18 5 19 61 16 32 68 70 41 60 44 29 49 27 69 50 38 10 17 45 56 9 21 26 63 28 35 7 59 1 65 2 15 8 11 12 34 37 47 58 22 31 4 36 42 52", "output": "55 57 15 68 27 24 53 59 47 43 60 61 2 9 58 30 44 26 28 3 48 66 6 7 20 49 39 51 37 16 67 31 19 62 52 69 63 42 21 22 34 70 18 36 45 25 64 4 38 41 1 71 14 5 17 46 13 65 54 35 29 10 50 8 56 23 12 32 40 33 11" }, { "input": "9\n8 5 2 6 1 9 4 7 3", "output": "5 3 9 7 2 4 8 1 6" }, { "input": "29\n10 24 11 5 26 25 2 9 22 15 8 14 29 21 4 1 23 17 3 12 13 16 18 28 19 20 7 6 27", "output": "16 7 19 15 4 28 27 11 8 1 3 20 21 12 10 22 18 23 25 26 14 9 17 2 6 5 29 24 13" }, { "input": "60\n39 25 42 4 55 60 16 18 47 1 11 40 7 50 19 35 49 54 12 3 30 38 2 58 17 26 45 6 33 43 37 32 52 36 15 23 27 59 24 20 28 14 8 9 13 29 44 46 41 21 5 48 51 22 31 56 57 53 10 34", "output": "10 23 20 4 51 28 13 43 44 59 11 19 45 42 35 7 25 8 15 40 50 54 36 39 2 26 37 41 46 21 55 32 29 60 16 34 31 22 1 12 49 3 30 47 27 48 9 52 17 14 53 33 58 18 5 56 57 24 38 6" }, { "input": "50\n37 45 22 5 12 21 28 24 18 47 20 25 8 50 14 2 34 43 11 16 49 41 48 1 19 31 39 46 32 23 15 42 3 35 38 30 44 26 10 9 40 36 7 17 33 4 27 6 13 29", "output": "24 16 33 46 4 48 43 13 40 39 19 5 49 15 31 20 44 9 25 11 6 3 30 8 12 38 47 7 50 36 26 29 45 17 34 42 1 35 27 41 22 32 18 37 2 28 10 23 21 14" }, { "input": "30\n8 29 28 16 17 25 27 15 21 11 6 20 2 13 1 30 5 4 24 10 14 3 23 18 26 9 12 22 19 7", "output": "15 13 22 18 17 11 30 1 26 20 10 27 14 21 8 4 5 24 29 12 9 28 23 19 6 25 7 3 2 16" }, { "input": "46\n15 2 44 43 38 19 31 42 4 37 29 30 24 45 27 41 8 20 33 7 35 3 18 46 36 26 1 28 21 40 16 22 32 11 14 13 12 9 25 39 10 6 23 17 5 34", "output": "27 2 22 9 45 42 20 17 38 41 34 37 36 35 1 31 44 23 6 18 29 32 43 13 39 26 15 28 11 12 7 33 19 46 21 25 10 5 40 30 16 8 4 3 14 24" }, { "input": "9\n4 8 6 5 3 9 2 7 1", "output": "9 7 5 1 4 3 8 2 6" }, { "input": "46\n31 30 33 23 45 7 36 8 11 3 32 39 41 20 1 28 6 27 18 24 17 5 16 37 26 13 22 14 2 38 15 46 9 4 19 21 12 44 10 35 25 34 42 43 40 29", "output": "15 29 10 34 22 17 6 8 33 39 9 37 26 28 31 23 21 19 35 14 36 27 4 20 41 25 18 16 46 2 1 11 3 42 40 7 24 30 12 45 13 43 44 38 5 32" }, { "input": "66\n27 12 37 48 46 21 34 58 38 28 66 2 64 32 44 31 13 36 40 15 19 11 22 5 30 29 6 7 61 39 20 42 23 54 51 33 50 9 60 8 57 45 49 10 62 41 59 3 55 63 52 24 25 26 43 56 65 4 16 14 1 35 18 17 53 47", "output": "61 12 48 58 24 27 28 40 38 44 22 2 17 60 20 59 64 63 21 31 6 23 33 52 53 54 1 10 26 25 16 14 36 7 62 18 3 9 30 19 46 32 55 15 42 5 66 4 43 37 35 51 65 34 49 56 41 8 47 39 29 45 50 13 57 11" }, { "input": "13\n3 12 9 2 8 5 13 4 11 1 10 7 6", "output": "10 4 1 8 6 13 12 5 3 11 9 2 7" }, { "input": "80\n21 25 56 50 20 61 7 74 51 69 8 2 46 57 45 71 14 52 17 43 9 30 70 78 31 10 38 13 23 15 37 79 6 16 77 73 80 4 49 48 18 28 26 58 33 41 64 22 54 72 59 60 40 63 53 27 1 5 75 67 62 34 19 39 68 65 44 55 3 32 11 42 76 12 35 47 66 36 24 29", "output": "57 12 69 38 58 33 7 11 21 26 71 74 28 17 30 34 19 41 63 5 1 48 29 79 2 43 56 42 80 22 25 70 45 62 75 78 31 27 64 53 46 72 20 67 15 13 76 40 39 4 9 18 55 49 68 3 14 44 51 52 6 61 54 47 66 77 60 65 10 23 16 50 36 8 59 73 35 24 32 37" }, { "input": "63\n9 49 53 25 40 46 43 51 54 22 58 16 23 26 10 47 5 27 2 8 61 59 19 35 63 56 28 20 34 4 62 38 6 55 36 31 57 15 29 33 1 48 50 37 7 30 18 42 32 52 12 41 14 21 45 11 24 17 39 13 44 60 3", "output": "41 19 63 30 17 33 45 20 1 15 56 51 60 53 38 12 58 47 23 28 54 10 13 57 4 14 18 27 39 46 36 49 40 29 24 35 44 32 59 5 52 48 7 61 55 6 16 42 2 43 8 50 3 9 34 26 37 11 22 62 21 31 25" }, { "input": "26\n11 4 19 13 17 9 2 24 6 5 22 23 14 15 3 25 16 8 18 10 21 1 12 26 7 20", "output": "22 7 15 2 10 9 25 18 6 20 1 23 4 13 14 17 5 19 3 26 21 11 12 8 16 24" }, { "input": "69\n40 22 11 66 4 27 31 29 64 53 37 55 51 2 7 36 18 52 6 1 30 21 17 20 14 9 59 62 49 68 3 50 65 57 44 5 67 46 33 13 34 15 24 48 63 58 38 25 41 35 16 54 32 10 60 61 39 12 69 8 23 45 26 47 56 43 28 19 42", "output": "20 14 31 5 36 19 15 60 26 54 3 58 40 25 42 51 23 17 68 24 22 2 61 43 48 63 6 67 8 21 7 53 39 41 50 16 11 47 57 1 49 69 66 35 62 38 64 44 29 32 13 18 10 52 12 65 34 46 27 55 56 28 45 9 33 4 37 30 59" }, { "input": "6\n4 3 6 5 1 2", "output": "5 6 2 1 4 3" }, { "input": "9\n7 8 5 3 1 4 2 9 6", "output": "5 7 4 6 3 9 1 2 8" }, { "input": "41\n27 24 16 30 25 8 32 2 26 20 39 33 41 22 40 14 36 9 28 4 34 11 31 23 19 18 17 35 3 10 6 13 5 15 29 38 7 21 1 12 37", "output": "39 8 29 20 33 31 37 6 18 30 22 40 32 16 34 3 27 26 25 10 38 14 24 2 5 9 1 19 35 4 23 7 12 21 28 17 41 36 11 15 13" }, { "input": "1\n1", "output": "1" }, { "input": "20\n2 6 4 18 7 10 17 13 16 8 14 9 20 5 19 12 1 3 15 11", "output": "17 1 18 3 14 2 5 10 12 6 20 16 8 11 19 9 7 4 15 13" }, { "input": "2\n2 1", "output": "2 1" }, { "input": "60\n2 4 31 51 11 7 34 20 3 14 18 23 48 54 15 36 38 60 49 40 5 33 41 26 55 58 10 8 13 9 27 30 37 1 21 59 44 57 35 19 46 43 42 45 12 22 39 32 24 16 6 56 53 52 25 17 47 29 50 28", "output": "34 1 9 2 21 51 6 28 30 27 5 45 29 10 15 50 56 11 40 8 35 46 12 49 55 24 31 60 58 32 3 48 22 7 39 16 33 17 47 20 23 43 42 37 44 41 57 13 19 59 4 54 53 14 25 52 38 26 36 18" }, { "input": "14\n14 6 3 12 11 2 7 1 10 9 8 5 4 13", "output": "8 6 3 13 12 2 7 11 10 9 5 4 14 1" }, { "input": "81\n13 43 79 8 7 21 73 46 63 4 62 78 56 11 70 68 61 53 60 49 16 27 59 47 69 5 22 44 77 57 52 48 1 9 72 81 28 55 58 33 51 18 31 17 41 20 42 3 32 54 19 2 75 34 64 10 65 50 30 29 67 12 71 66 74 15 26 23 6 38 25 35 37 24 80 76 40 45 39 36 14", "output": "33 52 48 10 26 69 5 4 34 56 14 62 1 81 66 21 44 42 51 46 6 27 68 74 71 67 22 37 60 59 43 49 40 54 72 80 73 70 79 77 45 47 2 28 78 8 24 32 20 58 41 31 18 50 38 13 30 39 23 19 17 11 9 55 57 64 61 16 25 15 63 35 7 65 53 76 29 12 3 75 36" }, { "input": "42\n41 11 10 8 21 37 32 19 31 25 1 15 36 5 6 27 4 3 13 7 16 17 2 23 34 24 38 28 12 20 30 42 18 26 39 35 33 40 9 14 22 29", "output": "11 23 18 17 14 15 20 4 39 3 2 29 19 40 12 21 22 33 8 30 5 41 24 26 10 34 16 28 42 31 9 7 37 25 36 13 6 27 35 38 1 32" }, { "input": "97\n20 6 76 42 4 18 35 59 39 63 27 7 66 47 61 52 15 36 88 93 19 33 10 92 1 34 46 86 78 57 51 94 77 29 26 73 41 2 58 97 43 65 17 74 21 49 25 3 91 82 95 12 96 13 84 90 69 24 72 37 16 55 54 71 64 62 48 89 11 70 80 67 30 40 44 85 53 83 79 9 56 45 75 87 22 14 81 68 8 38 60 50 28 23 31 32 5", "output": "25 38 48 5 97 2 12 89 80 23 69 52 54 86 17 61 43 6 21 1 45 85 94 58 47 35 11 93 34 73 95 96 22 26 7 18 60 90 9 74 37 4 41 75 82 27 14 67 46 92 31 16 77 63 62 81 30 39 8 91 15 66 10 65 42 13 72 88 57 70 64 59 36 44 83 3 33 29 79 71 87 50 78 55 76 28 84 19 68 56 49 24 20 32 51 53 40" }, { "input": "62\n15 27 46 6 8 51 14 56 23 48 42 49 52 22 20 31 29 12 47 3 62 34 37 35 32 57 19 25 5 60 61 38 18 10 11 55 45 53 17 30 9 36 4 50 41 16 44 28 40 59 24 1 13 39 26 7 33 58 2 43 21 54", "output": "52 59 20 43 29 4 56 5 41 34 35 18 53 7 1 46 39 33 27 15 61 14 9 51 28 55 2 48 17 40 16 25 57 22 24 42 23 32 54 49 45 11 60 47 37 3 19 10 12 44 6 13 38 62 36 8 26 58 50 30 31 21" }, { "input": "61\n35 27 4 61 52 32 41 46 14 37 17 54 55 31 11 26 44 49 15 30 9 50 45 39 7 38 53 3 58 40 13 56 18 19 28 6 43 5 21 42 20 34 2 25 36 12 33 57 16 60 1 8 59 10 22 23 24 48 51 47 29", "output": "51 43 28 3 38 36 25 52 21 54 15 46 31 9 19 49 11 33 34 41 39 55 56 57 44 16 2 35 61 20 14 6 47 42 1 45 10 26 24 30 7 40 37 17 23 8 60 58 18 22 59 5 27 12 13 32 48 29 53 50 4" }, { "input": "59\n31 26 36 15 17 19 10 53 11 34 13 46 55 9 44 7 8 37 32 52 47 25 51 22 35 39 41 4 43 24 5 27 20 57 6 38 3 28 21 40 50 18 14 56 33 45 12 2 49 59 54 29 16 48 42 58 1 30 23", "output": "57 48 37 28 31 35 16 17 14 7 9 47 11 43 4 53 5 42 6 33 39 24 59 30 22 2 32 38 52 58 1 19 45 10 25 3 18 36 26 40 27 55 29 15 46 12 21 54 49 41 23 20 8 51 13 44 34 56 50" }, { "input": "10\n2 10 7 4 1 5 8 6 3 9", "output": "5 1 9 4 6 8 3 7 10 2" }, { "input": "14\n14 2 1 8 6 12 11 10 9 7 3 4 5 13", "output": "3 2 11 12 13 5 10 4 9 8 7 6 14 1" }, { "input": "43\n28 38 15 14 31 42 27 30 19 33 43 26 22 29 18 32 3 13 1 8 35 34 4 12 11 17 41 21 5 25 39 37 20 23 7 24 16 10 40 9 6 36 2", "output": "19 43 17 23 29 41 35 20 40 38 25 24 18 4 3 37 26 15 9 33 28 13 34 36 30 12 7 1 14 8 5 16 10 22 21 42 32 2 31 39 27 6 11" }, { "input": "86\n39 11 20 31 28 76 29 64 35 21 41 71 12 82 5 37 80 73 38 26 79 75 23 15 59 45 47 6 3 62 50 49 51 22 2 65 86 60 70 42 74 17 1 30 55 44 8 66 81 27 57 77 43 13 54 32 72 46 48 56 14 34 78 52 36 85 24 19 69 83 25 61 7 4 84 33 63 58 18 40 68 10 67 9 16 53", "output": "43 35 29 74 15 28 73 47 84 82 2 13 54 61 24 85 42 79 68 3 10 34 23 67 71 20 50 5 7 44 4 56 76 62 9 65 16 19 1 80 11 40 53 46 26 58 27 59 32 31 33 64 86 55 45 60 51 78 25 38 72 30 77 8 36 48 83 81 69 39 12 57 18 41 22 6 52 63 21 17 49 14 70 75 66 37" }, { "input": "99\n65 78 56 98 33 24 61 40 29 93 1 64 57 22 25 52 67 95 50 3 31 15 90 68 71 83 38 36 6 46 89 26 4 87 14 88 72 37 23 43 63 12 80 96 5 34 73 86 9 48 92 62 99 10 16 20 66 27 28 2 82 70 30 94 49 8 84 69 18 60 58 59 44 39 21 7 91 76 54 19 75 85 74 47 55 32 97 77 51 13 35 79 45 42 11 41 17 81 53", "output": "11 60 20 33 45 29 76 66 49 54 95 42 90 35 22 55 97 69 80 56 75 14 39 6 15 32 58 59 9 63 21 86 5 46 91 28 38 27 74 8 96 94 40 73 93 30 84 50 65 19 89 16 99 79 85 3 13 71 72 70 7 52 41 12 1 57 17 24 68 62 25 37 47 83 81 78 88 2 92 43 98 61 26 67 82 48 34 36 31 23 77 51 10 64 18 44 87 4 53" }, { "input": "100\n42 23 48 88 36 6 18 70 96 1 34 40 46 22 39 55 85 93 45 67 71 75 59 9 21 3 86 63 65 68 20 38 73 31 84 90 50 51 56 95 72 33 49 19 83 76 54 74 100 30 17 98 15 94 4 97 5 99 81 27 92 32 89 12 13 91 87 29 60 11 52 43 35 58 10 25 16 80 28 2 44 61 8 82 66 69 41 24 57 62 78 37 79 77 53 7 14 47 26 64", "output": "10 80 26 55 57 6 96 83 24 75 70 64 65 97 53 77 51 7 44 31 25 14 2 88 76 99 60 79 68 50 34 62 42 11 73 5 92 32 15 12 87 1 72 81 19 13 98 3 43 37 38 71 95 47 16 39 89 74 23 69 82 90 28 100 29 85 20 30 86 8 21 41 33 48 22 46 94 91 93 78 59 84 45 35 17 27 67 4 63 36 66 61 18 54 40 9 56 52 58 49" }, { "input": "99\n8 68 94 75 71 60 57 58 6 11 5 48 65 41 49 12 46 72 95 59 13 70 74 7 84 62 17 36 55 76 38 79 2 85 23 10 32 99 87 50 83 28 54 91 53 51 1 3 97 81 21 89 93 78 61 26 82 96 4 98 25 40 31 44 24 47 30 52 14 16 39 27 9 29 45 18 67 63 37 43 90 66 19 69 88 22 92 77 34 42 73 80 56 64 20 35 15 33 86", "output": "47 33 48 59 11 9 24 1 73 36 10 16 21 69 97 70 27 76 83 95 51 86 35 65 61 56 72 42 74 67 63 37 98 89 96 28 79 31 71 62 14 90 80 64 75 17 66 12 15 40 46 68 45 43 29 93 7 8 20 6 55 26 78 94 13 82 77 2 84 22 5 18 91 23 4 30 88 54 32 92 50 57 41 25 34 99 39 85 52 81 44 87 53 3 19 58 49 60 38" }, { "input": "99\n12 99 88 13 7 19 74 47 23 90 16 29 26 11 58 60 64 98 37 18 82 67 72 46 51 85 17 92 87 20 77 36 78 71 57 35 80 54 73 15 14 62 97 45 31 79 94 56 76 96 28 63 8 44 38 86 49 2 52 66 61 59 10 43 55 50 22 34 83 53 95 40 81 21 30 42 27 3 5 41 1 70 69 25 93 48 65 6 24 89 91 33 39 68 9 4 32 84 75", "output": "81 58 78 96 79 88 5 53 95 63 14 1 4 41 40 11 27 20 6 30 74 67 9 89 84 13 77 51 12 75 45 97 92 68 36 32 19 55 93 72 80 76 64 54 44 24 8 86 57 66 25 59 70 38 65 48 35 15 62 16 61 42 52 17 87 60 22 94 83 82 34 23 39 7 99 49 31 33 46 37 73 21 69 98 26 56 29 3 90 10 91 28 85 47 71 50 43 18 2" }, { "input": "99\n20 79 26 75 99 69 98 47 93 62 18 42 43 38 90 66 67 8 13 84 76 58 81 60 64 46 56 23 78 17 86 36 19 52 85 39 48 27 96 49 37 95 5 31 10 24 12 1 80 35 92 33 16 68 57 54 32 29 45 88 72 77 4 87 97 89 59 3 21 22 61 94 83 15 44 34 70 91 55 9 51 50 73 11 14 6 40 7 63 25 2 82 41 65 28 74 71 30 53", "output": "48 91 68 63 43 86 88 18 80 45 84 47 19 85 74 53 30 11 33 1 69 70 28 46 90 3 38 95 58 98 44 57 52 76 50 32 41 14 36 87 93 12 13 75 59 26 8 37 40 82 81 34 99 56 79 27 55 22 67 24 71 10 89 25 94 16 17 54 6 77 97 61 83 96 4 21 62 29 2 49 23 92 73 20 35 31 64 60 66 15 78 51 9 72 42 39 65 7 5" }, { "input": "99\n74 20 9 1 60 85 65 13 4 25 40 99 5 53 64 3 36 31 73 44 55 50 45 63 98 51 68 6 47 37 71 82 88 34 84 18 19 12 93 58 86 7 11 46 90 17 33 27 81 69 42 59 56 32 95 52 76 61 96 62 78 43 66 21 49 97 75 14 41 72 89 16 30 79 22 23 15 83 91 38 48 2 87 26 28 80 94 70 54 92 57 10 8 35 67 77 29 24 39", "output": "4 82 16 9 13 28 42 93 3 92 43 38 8 68 77 72 46 36 37 2 64 75 76 98 10 84 48 85 97 73 18 54 47 34 94 17 30 80 99 11 69 51 62 20 23 44 29 81 65 22 26 56 14 89 21 53 91 40 52 5 58 60 24 15 7 63 95 27 50 88 31 70 19 1 67 57 96 61 74 86 49 32 78 35 6 41 83 33 71 45 79 90 39 87 55 59 66 25 12" }, { "input": "99\n50 94 2 18 69 90 59 83 75 68 77 97 39 78 25 7 16 9 49 4 42 89 44 48 17 96 61 70 3 10 5 81 56 57 88 6 98 1 46 67 92 37 11 30 85 41 8 36 51 29 20 71 19 79 74 93 43 34 55 40 38 21 64 63 32 24 72 14 12 86 82 15 65 23 66 22 28 53 13 26 95 99 91 52 76 27 60 45 47 33 73 84 31 35 54 80 58 62 87", "output": "38 3 29 20 31 36 16 47 18 30 43 69 79 68 72 17 25 4 53 51 62 76 74 66 15 80 86 77 50 44 93 65 90 58 94 48 42 61 13 60 46 21 57 23 88 39 89 24 19 1 49 84 78 95 59 33 34 97 7 87 27 98 64 63 73 75 40 10 5 28 52 67 91 55 9 85 11 14 54 96 32 71 8 92 45 70 99 35 22 6 83 41 56 2 81 26 12 37 82" }, { "input": "99\n19 93 14 34 39 37 33 15 52 88 7 43 69 27 9 77 94 31 48 22 63 70 79 17 50 6 81 8 76 58 23 74 86 11 57 62 41 87 75 51 12 18 68 56 95 3 80 83 84 29 24 61 71 78 59 96 20 85 90 28 45 36 38 97 1 49 40 98 44 67 13 73 72 91 47 10 30 54 35 42 4 2 92 26 64 60 53 21 5 82 46 32 55 66 16 89 99 65 25", "output": "65 82 46 81 89 26 11 28 15 76 34 41 71 3 8 95 24 42 1 57 88 20 31 51 99 84 14 60 50 77 18 92 7 4 79 62 6 63 5 67 37 80 12 69 61 91 75 19 66 25 40 9 87 78 93 44 35 30 55 86 52 36 21 85 98 94 70 43 13 22 53 73 72 32 39 29 16 54 23 47 27 90 48 49 58 33 38 10 96 59 74 83 2 17 45 56 64 68 97" }, { "input": "99\n86 25 50 51 62 39 41 67 44 20 45 14 80 88 66 7 36 59 13 84 78 58 96 75 2 43 48 47 69 12 19 98 22 38 28 55 11 76 68 46 53 70 85 34 16 33 91 30 8 40 74 60 94 82 87 32 37 4 5 10 89 73 90 29 35 26 23 57 27 65 24 3 9 83 77 72 6 31 15 92 93 79 64 18 63 42 56 1 52 97 17 81 71 21 49 99 54 95 61", "output": "88 25 72 58 59 77 16 49 73 60 37 30 19 12 79 45 91 84 31 10 94 33 67 71 2 66 69 35 64 48 78 56 46 44 65 17 57 34 6 50 7 86 26 9 11 40 28 27 95 3 4 89 41 97 36 87 68 22 18 52 99 5 85 83 70 15 8 39 29 42 93 76 62 51 24 38 75 21 82 13 92 54 74 20 43 1 55 14 61 63 47 80 81 53 98 23 90 32 96" }, { "input": "100\n66 44 99 15 43 79 28 33 88 90 49 68 82 38 9 74 4 58 29 81 31 94 10 42 89 21 63 40 62 61 18 6 84 72 48 25 67 69 71 85 98 34 83 70 65 78 91 77 93 41 23 24 87 11 55 12 59 73 36 97 7 14 26 39 30 27 45 20 50 17 53 2 57 47 95 56 75 19 37 96 16 35 8 3 76 60 13 86 5 32 64 80 46 51 54 100 1 22 52 92", "output": "97 72 84 17 89 32 61 83 15 23 54 56 87 62 4 81 70 31 78 68 26 98 51 52 36 63 66 7 19 65 21 90 8 42 82 59 79 14 64 28 50 24 5 2 67 93 74 35 11 69 94 99 71 95 55 76 73 18 57 86 30 29 27 91 45 1 37 12 38 44 39 34 58 16 77 85 48 46 6 92 20 13 43 33 40 88 53 9 25 10 47 100 49 22 75 80 60 41 3 96" }, { "input": "99\n3 73 32 37 25 15 93 63 85 8 91 78 80 5 39 48 46 7 83 70 23 96 9 29 77 53 30 20 56 50 13 45 21 76 87 99 65 31 16 18 14 72 51 28 43 2 81 34 38 40 66 54 74 26 71 4 61 17 58 24 22 33 49 36 42 11 12 55 60 27 62 90 79 92 94 68 1 52 84 41 86 35 69 75 47 10 64 88 97 98 67 19 89 95 59 82 57 44 6", "output": "77 46 1 56 14 99 18 10 23 86 66 67 31 41 6 39 58 40 92 28 33 61 21 60 5 54 70 44 24 27 38 3 62 48 82 64 4 49 15 50 80 65 45 98 32 17 85 16 63 30 43 78 26 52 68 29 97 59 95 69 57 71 8 87 37 51 91 76 83 20 55 42 2 53 84 34 25 12 73 13 47 96 19 79 9 81 35 88 93 72 11 74 7 75 94 22 89 90 36" }, { "input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1" } ]
1,693,231,426
2,147,483,647
PyPy 3-64
OK
TESTS
101
124
0
n = int(input()) arr = list(map(int,input().split(" "))) for i in range(1, n + 1): print(arr.index(i) + 1, end=" ")
Title: Presents Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there. If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift. Now Petya wants to know for each friend *i* the number of a friend who has given him a gift. Input Specification: The first line contains one integer *n* (1<=≀<=*n*<=≀<=100) β€” the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* β€” the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves. Output Specification: Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*. Demo Input: ['4\n2 3 4 1\n', '3\n1 3 2\n', '2\n1 2\n'] Demo Output: ['4 1 2 3\n', '1 3 2\n', '1 2\n'] Note: none
```python n = int(input()) arr = list(map(int,input().split(" "))) for i in range(1, n + 1): print(arr.index(i) + 1, end=" ") ```
3
379
A
New Year Candles
PROGRAMMING
1,000
[ "implementation" ]
null
null
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles. Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle. Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
The single line contains two integers, *a* and *b* (1<=≀<=*a*<=≀<=1000;Β 2<=≀<=*b*<=≀<=1000).
Print a single integer β€” the number of hours Vasily can light up the room for.
[ "4 2\n", "6 3\n" ]
[ "7\n", "8\n" ]
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
500
[ { "input": "4 2", "output": "7" }, { "input": "6 3", "output": "8" }, { "input": "1000 1000", "output": "1001" }, { "input": "123 5", "output": "153" }, { "input": "1000 2", "output": "1999" }, { "input": "1 2", "output": "1" }, { "input": "1 3", "output": "1" }, { "input": "1 4", "output": "1" }, { "input": "2 2", "output": "3" }, { "input": "3 2", "output": "5" }, { "input": "3 3", "output": "4" }, { "input": "999 2", "output": "1997" }, { "input": "1000 3", "output": "1499" }, { "input": "1000 4", "output": "1333" }, { "input": "1 1000", "output": "1" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "10 4", "output": "13" }, { "input": "4 3", "output": "5" }, { "input": "91 5", "output": "113" }, { "input": "777 17", "output": "825" }, { "input": "100 4", "output": "133" }, { "input": "5 3", "output": "7" }, { "input": "6 4", "output": "7" }, { "input": "26 8", "output": "29" }, { "input": "9 4", "output": "11" }, { "input": "20 3", "output": "29" }, { "input": "17 3", "output": "25" } ]
1,674,814,581
2,147,483,647
Python 3
OK
TESTS
32
46
0
n , m = map(int,input().split()) ans = n + n//m x = n while(x!=ans): x = ans ans = n + ans//m print(ans)
Title: New Year Candles Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles. Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle. Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number. Input Specification: The single line contains two integers, *a* and *b* (1<=≀<=*a*<=≀<=1000;Β 2<=≀<=*b*<=≀<=1000). Output Specification: Print a single integer β€” the number of hours Vasily can light up the room for. Demo Input: ['4 2\n', '6 3\n'] Demo Output: ['7\n', '8\n'] Note: Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
```python n , m = map(int,input().split()) ans = n + n//m x = n while(x!=ans): x = ans ans = n + ans//m print(ans) ```
3
337
A
Puzzles
PROGRAMMING
900
[ "greedy" ]
null
null
The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces). The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on. Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*.
The first line contains space-separated integers *n* and *m* (2<=≀<=*n*<=≀<=*m*<=≀<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≀<=*f**i*<=≀<=1000) β€” the quantities of pieces in the puzzles sold in the shop.
Print a single integer β€” the least possible difference the teacher can obtain.
[ "4 6\n10 12 10 7 5 22\n" ]
[ "5\n" ]
Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
500
[ { "input": "4 6\n10 12 10 7 5 22", "output": "5" }, { "input": "2 2\n4 4", "output": "0" }, { "input": "2 10\n4 5 6 7 8 9 10 11 12 12", "output": "0" }, { "input": "4 5\n818 136 713 59 946", "output": "759" }, { "input": "3 20\n446 852 783 313 549 965 40 88 86 617 479 118 768 34 47 826 366 957 463 903", "output": "13" }, { "input": "2 25\n782 633 152 416 432 825 115 97 386 357 836 310 530 413 354 373 847 882 913 682 729 582 671 674 94", "output": "3" }, { "input": "4 25\n226 790 628 528 114 64 239 279 619 39 894 763 763 847 525 93 882 697 999 643 650 244 159 884 190", "output": "31" }, { "input": "2 50\n971 889 628 39 253 157 925 694 129 516 660 272 738 319 611 816 142 717 514 392 41 105 132 676 958 118 306 768 600 685 103 857 704 346 857 309 23 718 618 161 176 379 846 834 640 468 952 878 164 997", "output": "0" }, { "input": "25 50\n582 146 750 905 313 509 402 21 488 512 32 898 282 64 579 869 37 996 377 929 975 697 666 837 311 205 116 992 533 298 648 268 54 479 792 595 152 69 267 417 184 433 894 603 988 712 24 414 301 176", "output": "412" }, { "input": "49 50\n58 820 826 960 271 294 473 102 925 318 729 672 244 914 796 646 868 6 893 882 726 203 528 498 271 195 355 459 721 680 547 147 631 116 169 804 145 996 133 559 110 257 771 476 576 251 607 314 427 886", "output": "938" }, { "input": "50 50\n374 573 323 744 190 806 485 247 628 336 491 606 702 321 991 678 337 579 86 240 993 208 668 686 855 205 363 177 719 249 896 919 782 434 59 647 787 996 286 216 636 212 546 903 958 559 544 126 608 993", "output": "937" }, { "input": "6 50\n6 8 7 8 5 4 4 5 7 8 6 5 7 4 7 7 7 8 6 4 6 6 8 8 7 7 8 7 5 8 5 4 4 7 8 4 4 6 6 6 8 7 4 7 6 6 5 8 4 7", "output": "0" }, { "input": "37 50\n14 5 11 17 8 20 19 16 20 11 17 20 16 9 14 14 13 18 11 20 8 8 8 5 19 17 6 18 10 20 9 7 12 6 14 17 4 4 10 13 7 4 11 6 20 19 12 12 15 19", "output": "12" }, { "input": "40 50\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "0" }, { "input": "40 50\n17 20 43 26 41 37 14 8 30 35 30 24 43 8 42 9 41 50 41 35 27 32 35 43 28 36 31 16 5 7 23 16 14 29 8 39 12 16 36 18 49 39 33 37 38 6 6 27 23 17", "output": "31" }, { "input": "2 2\n1000 4", "output": "996" }, { "input": "2 3\n4 502 1000", "output": "498" }, { "input": "3 3\n4 1000 4", "output": "996" } ]
1,681,111,577
2,147,483,647
Python 3
OK
TESTS
18
92
0
n, m = map(int, input().split()) puzzles = list(map(int, input().split())) # sort the puzzles in non-decreasing order puzzles.sort() # initialize the minimum difference with a large value min_diff = float('inf') # iterate through all possible pairs of puzzles for i in range(m - n + 1): diff = puzzles[i+n-1] - puzzles[i] if diff < min_diff: min_diff = diff print(min_diff)
Title: Puzzles Time Limit: None seconds Memory Limit: None megabytes Problem Description: The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces). The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on. Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*. Input Specification: The first line contains space-separated integers *n* and *m* (2<=≀<=*n*<=≀<=*m*<=≀<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≀<=*f**i*<=≀<=1000) β€” the quantities of pieces in the puzzles sold in the shop. Output Specification: Print a single integer β€” the least possible difference the teacher can obtain. Demo Input: ['4 6\n10 12 10 7 5 22\n'] Demo Output: ['5\n'] Note: Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
```python n, m = map(int, input().split()) puzzles = list(map(int, input().split())) # sort the puzzles in non-decreasing order puzzles.sort() # initialize the minimum difference with a large value min_diff = float('inf') # iterate through all possible pairs of puzzles for i in range(m - n + 1): diff = puzzles[i+n-1] - puzzles[i] if diff < min_diff: min_diff = diff print(min_diff) ```
3
454
A
Little Pony and Crystal Mine
PROGRAMMING
800
[ "implementation" ]
null
null
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=&gt;<=1) is an *n*<=Γ—<=*n* matrix with a diamond inscribed into it. You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
The only line contains an integer *n* (3<=≀<=*n*<=≀<=101; *n* is odd).
Output a crystal of size *n*.
[ "3\n", "5\n", "7\n" ]
[ "*D*\nDDD\n*D*\n", "**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n", "***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n" ]
none
500
[ { "input": "3", "output": "*D*\nDDD\n*D*" }, { "input": "5", "output": "**D**\n*DDD*\nDDDDD\n*DDD*\n**D**" }, { "input": "7", "output": "***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***" }, { "input": "11", "output": "*****D*****\n****DDD****\n***DDDDD***\n**DDDDDDD**\n*DDDDDDDDD*\nDDDDDDDDDDD\n*DDDDDDDDD*\n**DDDDDDD**\n***DDDDD***\n****DDD****\n*****D*****" }, { "input": "15", "output": "*******D*******\n******DDD******\n*****DDDDD*****\n****DDDDDDD****\n***DDDDDDDDD***\n**DDDDDDDDDDD**\n*DDDDDDDDDDDDD*\nDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDD*\n**DDDDDDDDDDD**\n***DDDDDDDDD***\n****DDDDDDD****\n*****DDDDD*****\n******DDD******\n*******D*******" }, { "input": "21", "output": "**********D**********\n*********DDD*********\n********DDDDD********\n*******DDDDDDD*******\n******DDDDDDDDD******\n*****DDDDDDDDDDD*****\n****DDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDD**\n*DDDDDDDDDDDDDDDDDDD*\nDDDDDDDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDDDDDDDD*\n**DDDDDDDDDDDDDDDDD**\n***DDDDDDDDDDDDDDD***\n****DDDDDDDDDDDDD****\n*****DDDDDDDDDDD*****\n******DDDDDDDDD******\n*******DDDDDDD*******\n********DDDDD********\n*********DDD*********\n**********D**********" }, { "input": "33", "output": "****************D****************\n***************DDD***************\n**************DDDDD**************\n*************DDDDDDD*************\n************DDDDDDDDD************\n***********DDDDDDDDDDD***********\n**********DDDDDDDDDDDDD**********\n*********DDDDDDDDDDDDDDD*********\n********DDDDDDDDDDDDDDDDD********\n*******DDDDDDDDDDDDDDDDDDD*******\n******DDDDDDDDDDDDDDDDDDDDD******\n*****DDDDDDDDDDDDDDDDDDDDDDD*****\n****DDDDDDDDDDDDDDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDDDD..." }, { "input": "57", "output": "****************************D****************************\n***************************DDD***************************\n**************************DDDDD**************************\n*************************DDDDDDD*************************\n************************DDDDDDDDD************************\n***********************DDDDDDDDDDD***********************\n**********************DDDDDDDDDDDDD**********************\n*********************DDDDDDDDDDDDDDD*********************\n********************DDDDDDDDDDDDDDDDD**..." }, { "input": "69", "output": "**********************************D**********************************\n*********************************DDD*********************************\n********************************DDDDD********************************\n*******************************DDDDDDD*******************************\n******************************DDDDDDDDD******************************\n*****************************DDDDDDDDDDD*****************************\n****************************DDDDDDDDDDDDD****************************\n**************..." }, { "input": "81", "output": "****************************************D****************************************\n***************************************DDD***************************************\n**************************************DDDDD**************************************\n*************************************DDDDDDD*************************************\n************************************DDDDDDDDD************************************\n***********************************DDDDDDDDDDD***********************************\n*************..." }, { "input": "91", "output": "*********************************************D*********************************************\n********************************************DDD********************************************\n*******************************************DDDDD*******************************************\n******************************************DDDDDDD******************************************\n*****************************************DDDDDDDDD*****************************************\n****************************************DDDDDD..." }, { "input": "101", "output": "**************************************************D**************************************************\n*************************************************DDD*************************************************\n************************************************DDDDD************************************************\n***********************************************DDDDDDD***********************************************\n**********************************************DDDDDDDDD********************************************..." } ]
1,613,799,293
2,147,483,647
Python 3
OK
TESTS
12
62
0
n = int(input()) x = 'D' z='' for i in range(0,n+1): if i%2: print((x * i).center(n, '*')) for i in range(n-1,0,-1): if i%2: print((x * i).center(n, '*'))
Title: Little Pony and Crystal Mine Time Limit: None seconds Memory Limit: None megabytes Problem Description: Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=&gt;<=1) is an *n*<=Γ—<=*n* matrix with a diamond inscribed into it. You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw. Input Specification: The only line contains an integer *n* (3<=≀<=*n*<=≀<=101; *n* is odd). Output Specification: Output a crystal of size *n*. Demo Input: ['3\n', '5\n', '7\n'] Demo Output: ['*D*\nDDD\n*D*\n', '**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n', '***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n'] Note: none
```python n = int(input()) x = 'D' z='' for i in range(0,n+1): if i%2: print((x * i).center(n, '*')) for i in range(n-1,0,-1): if i%2: print((x * i).center(n, '*')) ```
3
61
A
Ultra-Fast Mathematician
PROGRAMMING
800
[ "implementation" ]
A. Ultra-Fast Mathematician
2
256
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Write one line β€” the corresponding answer. Do not omit the leading 0s.
[ "1010100\n0100101\n", "000\n111\n", "1110\n1010\n", "01110\n01100\n" ]
[ "1110001\n", "111\n", "0100\n", "00010\n" ]
none
500
[ { "input": "1010100\n0100101", "output": "1110001" }, { "input": "000\n111", "output": "111" }, { "input": "1110\n1010", "output": "0100" }, { "input": "01110\n01100", "output": "00010" }, { "input": "011101\n000001", "output": "011100" }, { "input": "10\n01", "output": "11" }, { "input": "00111111\n11011101", "output": "11100010" }, { "input": "011001100\n101001010", "output": "110000110" }, { "input": "1100100001\n0110101100", "output": "1010001101" }, { "input": "00011101010\n10010100101", "output": "10001001111" }, { "input": "100000101101\n111010100011", "output": "011010001110" }, { "input": "1000001111010\n1101100110001", "output": "0101101001011" }, { "input": "01011111010111\n10001110111010", "output": "11010001101101" }, { "input": "110010000111100\n001100101011010", "output": "111110101100110" }, { "input": "0010010111110000\n0000000011010110", "output": "0010010100100110" }, { "input": "00111110111110000\n01111100001100000", "output": "01000010110010000" }, { "input": "101010101111010001\n001001111101111101", "output": "100011010010101100" }, { "input": "0110010101111100000\n0011000101000000110", "output": "0101010000111100110" }, { "input": "11110100011101010111\n00001000011011000000", "output": "11111100000110010111" }, { "input": "101010101111101101001\n111010010010000011111", "output": "010000111101101110110" }, { "input": "0000111111100011000010\n1110110110110000001010", "output": "1110001001010011001000" }, { "input": "10010010101000110111000\n00101110100110111000111", "output": "10111100001110001111111" }, { "input": "010010010010111100000111\n100100111111100011001110", "output": "110110101101011111001001" }, { "input": "0101110100100111011010010\n0101100011010111001010001", "output": "0000010111110000010000011" }, { "input": "10010010100011110111111011\n10000110101100000001000100", "output": "00010100001111110110111111" }, { "input": "000001111000000100001000000\n011100111101111001110110001", "output": "011101000101111101111110001" }, { "input": "0011110010001001011001011100\n0000101101000011101011001010", "output": "0011011111001010110010010110" }, { "input": "11111000000000010011001101111\n11101110011001010100010000000", "output": "00010110011001000111011101111" }, { "input": "011001110000110100001100101100\n001010000011110000001000101001", "output": "010011110011000100000100000101" }, { "input": "1011111010001100011010110101111\n1011001110010000000101100010101", "output": "0000110100011100011111010111010" }, { "input": "10111000100001000001010110000001\n10111000001100101011011001011000", "output": "00000000101101101010001111011001" }, { "input": "000001010000100001000000011011100\n111111111001010100100001100000111", "output": "111110101001110101100001111011011" }, { "input": "1101000000000010011011101100000110\n1110000001100010011010000011011110", "output": "0011000001100000000001101111011000" }, { "input": "01011011000010100001100100011110001\n01011010111000001010010100001110000", "output": "00000001111010101011110000010000001" }, { "input": "000011111000011001000110111100000100\n011011000110000111101011100111000111", "output": "011000111110011110101101011011000011" }, { "input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000", "output": "1011001001111001001011101010101000010" }, { "input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011", "output": "10001110000010101110000111000011111110" }, { "input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100", "output": "000100001011110000011101110111010001110" }, { "input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001", "output": "1101110101010110000011000000101011110011" }, { "input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100", "output": "11001011110010010000010111001100001001110" }, { "input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110", "output": "001100101000011111111101111011101010111001" }, { "input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001", "output": "0111010010100110110101100010000100010100000" }, { "input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100", "output": "11111110000000100101000100110111001100011001" }, { "input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011", "output": "101011011100100010100011011001101010100100010" }, { "input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001", "output": "1101001100111011010111110110101111001011110111" }, { "input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001", "output": "10010101000101000000011010011110011110011110001" }, { "input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100", "output": "011011011100000000010101110010000000101000111101" }, { "input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100", "output": "0101010111101001011011110110011101010101010100011" }, { "input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011", "output": "11001011010010111000010110011101100100001110111111" }, { "input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011", "output": "111011101010011100001111101001101011110010010110001" }, { "input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001", "output": "0100111110110011111110010010010000110111100101101101" }, { "input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100", "output": "01011001110111010111001100010011010100010000111011000" }, { "input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111", "output": "100011101001001000011011011001111000100000010100100100" }, { "input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110", "output": "1100110010000101101010111111101001001001110101110010110" }, { "input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110", "output": "01000111100111001011110010100011111111110010101100001101" }, { "input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010", "output": "110001010001000011000101110101000100001011111001011001001" }, { "input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111", "output": "1110100010111000101001001011101110011111100111000011011011" }, { "input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110", "output": "01110110101110100100110011010000001000101100101111000111011" }, { "input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011", "output": "111100101000000011101011011001110010101111000110010010000000" }, { "input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111", "output": "0100100010111110010011101010000011111110001110010110010111001" }, { "input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111", "output": "00110100000011001101101100100010110010001100000001100110011101" }, { "input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011", "output": "000000011000111011110011101000010000010100101000000011010110010" }, { "input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010", "output": "0010100110110100111100100100101101010100100111011010001001010101" }, { "input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111", "output": "11010110111100101111101001100001110100010110010110110111100110100" }, { "input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111", "output": "111111010011011100101110100110111111111001111110011010111111110000" }, { "input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110", "output": "1010101010100010001001001001100000111000010010010100010011000100000" }, { "input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000", "output": "00011111011111001000011100010011100011010100101011011000001001111110" }, { "input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111", "output": "001111000011001110100111010101111111011100110011001010010010000111011" }, { "input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101", "output": "0110001100110100010000110111000010011010011000011001010011010100010100" }, { "input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010", "output": "00010000000110110101000011001000000100100110111010011111101010001010000" }, { "input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001", "output": "000100100000000110011100100001010110101001100101110010010011111001110111" }, { "input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000", "output": "1000111100010011010110011101000000101010101100011111100001101111001010010" }, { "input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011", "output": "01000010011110111001011011110000001011000111101101101010010110001010100100" }, { "input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101", "output": "101101110110110010011100001011111100100001110000101100110000100011011100110" }, { "input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001", "output": "1110111111110010111000001100101010101011010100101010100101100011001001111111" }, { "input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111", "output": "10111011000111000101110100101000100111011011100011110110000101010001111010111" }, { "input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110", "output": "110100100110000101010010011010011001100110000111010000010100001011110111111101" }, { "input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111", "output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111" }, { "input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001", "output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001" }, { "input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110", "output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011" }, { "input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111", "output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101" }, { "input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010", "output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101" }, { "input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000", "output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001" }, { "input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011", "output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110" }, { "input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011", "output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011" }, { "input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011", "output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011" }, { "input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010", "output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011" }, { "input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001", "output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110" }, { "input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111", "output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010" }, { "input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011", "output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011" }, { "input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100", "output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000" }, { "input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001", "output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101" }, { "input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110", "output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101" }, { "input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011", "output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110" }, { "input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111", "output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110" }, { "input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000", "output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001" }, { "input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010", "output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101" }, { "input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101", "output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011" }, { "input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011", "output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010" }, { "input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010", "output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011" }, { "input": "0\n0", "output": "0" }, { "input": "0\n1", "output": "1" } ]
1,628,360,138
2,147,483,647
Python 3
OK
TESTS
102
77
6,758,400
# -*- coding: utf-8 -*- """ Created on Sun Aug 8 00:06:02 2021 @author: nijhum """ n = list(input()) m=list(input()) for i in range(len(n)) : if n[i] == m[i]: print('0',end='') else: print('1',end='')
Title: Ultra-Fast Mathematician Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate. Input Specification: There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. Output Specification: Write one line β€” the corresponding answer. Do not omit the leading 0s. Demo Input: ['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n'] Demo Output: ['1110001\n', '111\n', '0100\n', '00010\n'] Note: none
```python # -*- coding: utf-8 -*- """ Created on Sun Aug 8 00:06:02 2021 @author: nijhum """ n = list(input()) m=list(input()) for i in range(len(n)) : if n[i] == m[i]: print('0',end='') else: print('1',end='') ```
3.968161
707
A
Brain's Photos
PROGRAMMING
800
[ "implementation" ]
null
null
Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead. As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such). Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour! As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white. Photo can be represented as a matrix sized *n*<=Γ—<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors: - 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black) The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored.
The first line of the input contains two integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=100)Β β€” the number of photo pixel matrix rows and columns respectively. Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'.
Print the "#Black&amp;White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line.
[ "2 2\nC M\nY Y\n", "3 2\nW W\nW W\nB B\n", "1 1\nW\n" ]
[ "#Color", "#Black&amp;White", "#Black&amp;White" ]
none
500
[ { "input": "2 2\nC M\nY Y", "output": "#Color" }, { "input": "3 2\nW W\nW W\nB B", "output": "#Black&White" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "2 3\nW W W\nB G Y", "output": "#Color" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "5 5\nW G B Y M\nG B Y M C\nB Y M C W\nY M C W G\nM C W G B", "output": "#Color" }, { "input": "1 6\nC M Y W G B", "output": "#Color" }, { "input": "1 3\nW G B", "output": "#Black&White" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "5 5\nW G B W G\nG B W G B\nB W G B W\nW G B W G\nG B W G B", "output": "#Black&White" }, { "input": "2 3\nW W W\nB G C", "output": "#Color" }, { "input": "2 3\nW W W\nB G M", "output": "#Color" }, { "input": "3 3\nC B W\nB Y M\nB B W", "output": "#Color" }, { "input": "1 3\nW C W", "output": "#Color" }, { "input": "3 3\nB W B\nB C W\nB W W", "output": "#Color" }, { "input": "1 2\nW Y", "output": "#Color" }, { "input": "1 1\nG", "output": "#Black&White" }, { "input": "1 3\nB G W", "output": "#Black&White" }, { "input": "2 2\nW W\nB C", "output": "#Color" }, { "input": "1 1\nM", "output": "#Color" }, { "input": "1 2\nW C", "output": "#Color" }, { "input": "2 3\nW W M\nW W M", "output": "#Color" }, { "input": "3 2\nW W\nW W\nB C", "output": "#Color" }, { "input": "2 3\nW W C\nW W W", "output": "#Color" }, { "input": "1 3\nG G G", "output": "#Black&White" }, { "input": "1 1\nC", "output": "#Color" }, { "input": "1 2\nC W", "output": "#Color" }, { "input": "1 3\nW W C", "output": "#Color" }, { "input": "2 2\nW B\nB G", "output": "#Black&White" }, { "input": "2 2\nB B\nY Y", "output": "#Color" }, { "input": "2 2\nG G\nC C", "output": "#Color" }, { "input": "1 2\nB C", "output": "#Color" }, { "input": "1 4\nG G G C", "output": "#Color" }, { "input": "1 1\nB", "output": "#Black&White" }, { "input": "2 1\nY\nB", "output": "#Color" } ]
1,693,718,301
2,147,483,647
Python 3
OK
TESTS
50
46
102,400
a,b= map(int,input().split()) l=[] while(a!=0): x=list(map(str,input().split())) l.extend(x) a=a-1 #print(l) if ('C' in l) or('M' in l) or('Y' in l): print("#Color") else: print("#Black&White")
Title: Brain's Photos Time Limit: None seconds Memory Limit: None megabytes Problem Description: Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead. As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such). Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour! As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white. Photo can be represented as a matrix sized *n*<=Γ—<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors: - 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black) The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored. Input Specification: The first line of the input contains two integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=100)Β β€” the number of photo pixel matrix rows and columns respectively. Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'. Output Specification: Print the "#Black&amp;White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line. Demo Input: ['2 2\nC M\nY Y\n', '3 2\nW W\nW W\nB B\n', '1 1\nW\n'] Demo Output: ['#Color', '#Black&amp;White', '#Black&amp;White'] Note: none
```python a,b= map(int,input().split()) l=[] while(a!=0): x=list(map(str,input().split())) l.extend(x) a=a-1 #print(l) if ('C' in l) or('M' in l) or('Y' in l): print("#Color") else: print("#Black&White") ```
3
0
none
none
none
0
[ "none" ]
null
null
Vlad likes to eat in cafes very much. During his life, he has visited cafes *n* times. Unfortunately, Vlad started to feel that his last visits are not any different from each other. To fix that Vlad had a small research. First of all, Vlad assigned individual indices to all cafes. Then, he wrote down indices of cafes he visited in a row, in order of visiting them. Now, Vlad wants to find such a cafe that his last visit to that cafe was before his last visits to every other cafe. In other words, he wants to find such a cafe that he hasn't been there for as long as possible. Help Vlad to find that cafe.
In first line there is one integer *n* (1<=≀<=*n*<=≀<=2Β·105)Β β€” number of cafes indices written by Vlad. In second line, *n* numbers *a*1,<=*a*2,<=...,<=*a**n* (0<=≀<=*a**i*<=≀<=2Β·105) are writtenΒ β€” indices of cafes in order of being visited by Vlad. Vlad could visit some cafes more than once. Note that in numeration, some indices could be omitted.
Print one integerΒ β€” index of the cafe that Vlad hasn't visited for as long as possible.
[ "5\n1 3 2 1 2\n", "6\n2 1 2 2 4 1\n" ]
[ "3\n", "2\n" ]
In first test, there are three cafes, and the last visits to cafes with indices 1 and 2 were after the last visit to cafe with index 3; so this cafe is the answer. In second test case, there are also three cafes, but with indices 1, 2 and 4. Cafes with indices 1 and 4 were visited after the last visit of cafe with index 2, so the answer is 2. Note that Vlad could omit some numbers while numerating the cafes.
0
[ { "input": "5\n1 3 2 1 2", "output": "3" }, { "input": "6\n2 1 2 2 4 1", "output": "2" }, { "input": "1\n0", "output": "0" }, { "input": "1\n200000", "output": "200000" }, { "input": "2\n2018 2017", "output": "2018" }, { "input": "5\n100 1000 1000 1000 1000", "output": "100" }, { "input": "8\n200000 1 200000 1 200000 1 200000 2", "output": "1" }, { "input": "5\n20000 1 2 3 4", "output": "20000" }, { "input": "2\n200000 1", "output": "200000" }, { "input": "3\n2 100 2", "output": "100" }, { "input": "2\n10 1", "output": "10" }, { "input": "11\n1 1 1 1 1 1 1 1 1 1 1", "output": "1" }, { "input": "3\n5 5 5", "output": "5" }, { "input": "2\n5 1", "output": "5" } ]
1,510,510,375
7,675
Python 3
OK
TESTS
33
202
18,329,600
#Bε•ι‘Œ N = int(input()) a = list(map(int,input().split(" "))) index = {} for i in range(N): index[a[i]] = i print(min(index.items(), key=lambda x:x[1])[0])
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vlad likes to eat in cafes very much. During his life, he has visited cafes *n* times. Unfortunately, Vlad started to feel that his last visits are not any different from each other. To fix that Vlad had a small research. First of all, Vlad assigned individual indices to all cafes. Then, he wrote down indices of cafes he visited in a row, in order of visiting them. Now, Vlad wants to find such a cafe that his last visit to that cafe was before his last visits to every other cafe. In other words, he wants to find such a cafe that he hasn't been there for as long as possible. Help Vlad to find that cafe. Input Specification: In first line there is one integer *n* (1<=≀<=*n*<=≀<=2Β·105)Β β€” number of cafes indices written by Vlad. In second line, *n* numbers *a*1,<=*a*2,<=...,<=*a**n* (0<=≀<=*a**i*<=≀<=2Β·105) are writtenΒ β€” indices of cafes in order of being visited by Vlad. Vlad could visit some cafes more than once. Note that in numeration, some indices could be omitted. Output Specification: Print one integerΒ β€” index of the cafe that Vlad hasn't visited for as long as possible. Demo Input: ['5\n1 3 2 1 2\n', '6\n2 1 2 2 4 1\n'] Demo Output: ['3\n', '2\n'] Note: In first test, there are three cafes, and the last visits to cafes with indices 1 and 2 were after the last visit to cafe with index 3; so this cafe is the answer. In second test case, there are also three cafes, but with indices 1, 2 and 4. Cafes with indices 1 and 4 were visited after the last visit of cafe with index 2, so the answer is 2. Note that Vlad could omit some numbers while numerating the cafes.
```python #Bε•ι‘Œ N = int(input()) a = list(map(int,input().split(" "))) index = {} for i in range(N): index[a[i]] = i print(min(index.items(), key=lambda x:x[1])[0]) ```
3
131
A
cAPS lOCK
PROGRAMMING
1,000
[ "implementation", "strings" ]
null
null
wHAT DO WE NEED cAPS LOCK FOR? Caps lock is a computer keyboard key. Pressing it sets an input mode in which typed letters are capital by default. If it is pressed by accident, it leads to accidents like the one we had in the first passage. Let's consider that a word has been typed with the Caps lock key accidentally switched on, if: - either it only contains uppercase letters; - or all letters except for the first one are uppercase. In this case we should automatically change the case of all letters. For example, the case of the letters that form words "hELLO", "HTTP", "z" should be changed. Write a program that applies the rule mentioned above. If the rule cannot be applied, the program should leave the word unchanged.
The first line of the input data contains a word consisting of uppercase and lowercase Latin letters. The word's length is from 1 to 100 characters, inclusive.
Print the result of the given word's processing.
[ "cAPS\n", "Lock\n" ]
[ "Caps", "Lock\n" ]
none
500
[ { "input": "cAPS", "output": "Caps" }, { "input": "Lock", "output": "Lock" }, { "input": "cAPSlOCK", "output": "cAPSlOCK" }, { "input": "CAPs", "output": "CAPs" }, { "input": "LoCK", "output": "LoCK" }, { "input": "OOPS", "output": "oops" }, { "input": "oops", "output": "oops" }, { "input": "a", "output": "A" }, { "input": "A", "output": "a" }, { "input": "aA", "output": "Aa" }, { "input": "Zz", "output": "Zz" }, { "input": "Az", "output": "Az" }, { "input": "zA", "output": "Za" }, { "input": "AAA", "output": "aaa" }, { "input": "AAa", "output": "AAa" }, { "input": "AaR", "output": "AaR" }, { "input": "Tdr", "output": "Tdr" }, { "input": "aTF", "output": "Atf" }, { "input": "fYd", "output": "fYd" }, { "input": "dsA", "output": "dsA" }, { "input": "fru", "output": "fru" }, { "input": "hYBKF", "output": "Hybkf" }, { "input": "XweAR", "output": "XweAR" }, { "input": "mogqx", "output": "mogqx" }, { "input": "eOhEi", "output": "eOhEi" }, { "input": "nkdku", "output": "nkdku" }, { "input": "zcnko", "output": "zcnko" }, { "input": "lcccd", "output": "lcccd" }, { "input": "vwmvg", "output": "vwmvg" }, { "input": "lvchf", "output": "lvchf" }, { "input": "IUNVZCCHEWENCHQQXQYPUJCRDZLUXCLJHXPHBXEUUGNXOOOPBMOBRIBHHMIRILYJGYYGFMTMFSVURGYHUWDRLQVIBRLPEVAMJQYO", "output": "iunvzcchewenchqqxqypujcrdzluxcljhxphbxeuugnxooopbmobribhhmirilyjgyygfmtmfsvurgyhuwdrlqvibrlpevamjqyo" }, { "input": "OBHSZCAMDXEJWOZLKXQKIVXUUQJKJLMMFNBPXAEFXGVNSKQLJGXHUXHGCOTESIVKSFMVVXFVMTEKACRIWALAGGMCGFEXQKNYMRTG", "output": "obhszcamdxejwozlkxqkivxuuqjkjlmmfnbpxaefxgvnskqljgxhuxhgcotesivksfmvvxfvmtekacriwalaggmcgfexqknymrtg" }, { "input": "IKJYZIKROIYUUCTHSVSKZTETNNOCMAUBLFJCEVANCADASMZRCNLBZPQRXESHEEMOMEPCHROSRTNBIDXYMEPJSIXSZQEBTEKKUHFS", "output": "ikjyzikroiyuucthsvskztetnnocmaublfjcevancadasmzrcnlbzpqrxesheemomepchrosrtnbidxymepjsixszqebtekkuhfs" }, { "input": "cTKDZNWVYRTFPQLDAUUNSPKTDJTUPPFPRXRSINTVFVNNQNKXWUZUDHZBUSOKTABUEDQKUIVRTTVUREEOBJTSDKJKVEGFXVHXEYPE", "output": "Ctkdznwvyrtfpqldauunspktdjtuppfprxrsintvfvnnqnkxwuzudhzbusoktabuedqkuivrttvureeobjtsdkjkvegfxvhxeype" }, { "input": "uCKJZRGZJCPPLEEYJTUNKOQSWGBMTBQEVPYFPIPEKRVYQNTDPANOIXKMPINNFUSZWCURGBDPYTEKBEKCPMVZPMWAOSHJYMGKOMBQ", "output": "Uckjzrgzjcppleeyjtunkoqswgbmtbqevpyfpipekrvyqntdpanoixkmpinnfuszwcurgbdpytekbekcpmvzpmwaoshjymgkombq" }, { "input": "KETAXTSWAAOBKUOKUQREHIOMVMMRSAEWKGXZKRASwTVNSSFSNIWYNPSTMRADOADEEBURRHPOOBIEUIBGYDJCEKPNLEUCANZYJKMR", "output": "KETAXTSWAAOBKUOKUQREHIOMVMMRSAEWKGXZKRASwTVNSSFSNIWYNPSTMRADOADEEBURRHPOOBIEUIBGYDJCEKPNLEUCANZYJKMR" }, { "input": "ZEKGDMWJPVUWFlNXRLUmWKLMMYSLRQQIBRWDPKWITUIMZYYKOEYGREKHHZRZZUFPVTNIHKGTCCTLOKSZITXXZDMPITHNZUIGDZLE", "output": "ZEKGDMWJPVUWFlNXRLUmWKLMMYSLRQQIBRWDPKWITUIMZYYKOEYGREKHHZRZZUFPVTNIHKGTCCTLOKSZITXXZDMPITHNZUIGDZLE" }, { "input": "TcMbVPCFvnNkCEUUCIFLgBJeCOKuJhIGwXFrhAZjuAhBraMSchBfWwIuHAEbgJOFzGtxDLDXzDSaPCFujGGxgxdlHUIQYRrMFCgJ", "output": "TcMbVPCFvnNkCEUUCIFLgBJeCOKuJhIGwXFrhAZjuAhBraMSchBfWwIuHAEbgJOFzGtxDLDXzDSaPCFujGGxgxdlHUIQYRrMFCgJ" }, { "input": "xFGqoLILNvxARKuIntPfeukFtMbvzDezKpPRAKkIoIvwqNXnehRVwkkXYvuRCeoieBaBfTjwsYhDeCLvBwktntyluoxCYVioXGdm", "output": "xFGqoLILNvxARKuIntPfeukFtMbvzDezKpPRAKkIoIvwqNXnehRVwkkXYvuRCeoieBaBfTjwsYhDeCLvBwktntyluoxCYVioXGdm" }, { "input": "udvqolbxdwbkijwvhlyaelhynmnfgszbhgshlcwdkaibceqomzujndixuzivlsjyjqxzxodzbukxxhwwultvekdfntwpzlhhrIjm", "output": "udvqolbxdwbkijwvhlyaelhynmnfgszbhgshlcwdkaibceqomzujndixuzivlsjyjqxzxodzbukxxhwwultvekdfntwpzlhhrIjm" }, { "input": "jgpwhetqqoncighgzbbaLwwwxkxivuwtokehrgprfgewzcwxkavwoflcgsgbhoeamzbefzoonwsyzisetoydrpufktzgbaycgaeg", "output": "jgpwhetqqoncighgzbbaLwwwxkxivuwtokehrgprfgewzcwxkavwoflcgsgbhoeamzbefzoonwsyzisetoydrpufktzgbaycgaeg" }, { "input": "vyujsazdstbnkxeunedfbolicojzjpufgfemhtmdrswvmuhoivjvonacefqenbqudelmdegxqtbwezsbydmanzutvdgkgrjxzlnc", "output": "vyujsazdstbnkxeunedfbolicojzjpufgfemhtmdrswvmuhoivjvonacefqenbqudelmdegxqtbwezsbydmanzutvdgkgrjxzlnc" }, { "input": "pivqnuqkaofcduvbttztjbuavrqwiqrwkfncmvatoxruelyoecnkpqraiahumiaiqeyjapbqyrsxcdgjbihivtqezvasfmzntdfv", "output": "pivqnuqkaofcduvbttztjbuavrqwiqrwkfncmvatoxruelyoecnkpqraiahumiaiqeyjapbqyrsxcdgjbihivtqezvasfmzntdfv" }, { "input": "upvtbsxswbohxshdrbjxcungzquhuomgxwlryvshshsfvqbrxvcikbglietlpqkiwbhiqpmdwuqosbtdvyxekkaqiwrbsibpoect", "output": "upvtbsxswbohxshdrbjxcungzquhuomgxwlryvshshsfvqbrxvcikbglietlpqkiwbhiqpmdwuqosbtdvyxekkaqiwrbsibpoect" }, { "input": "cTKDZNWVYRTFPQLDAUUNSPKTDJTUPPFPRXRSINTVFVNNQNKXWUZUDHZBUSOKTABUEDQKUIVRTTVUREEOBJTSDKJKVEGFXVHXEYPE", "output": "Ctkdznwvyrtfpqldauunspktdjtuppfprxrsintvfvnnqnkxwuzudhzbusoktabuedqkuivrttvureeobjtsdkjkvegfxvhxeype" }, { "input": "JEGDOFJOFGJHFROGHOFGMHOFGHORGFHMOu", "output": "JEGDOFJOFGJHFROGHOFGMHOFGHORGFHMOu" }, { "input": "aBACABa", "output": "aBACABa" }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAaa", "output": "AAAAAAAAAAAAAAAAAAAAAAAAaa" }, { "input": "aaAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "aaAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA" }, { "input": "dDDDDDDDDDDDDD", "output": "Dddddddddddddd" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa" }, { "input": "z", "output": "Z" }, { "input": "AZ", "output": "az" }, { "input": "Z", "output": "z" }, { "input": "aAAAA", "output": "Aaaaa" }, { "input": "F", "output": "f" } ]
1,698,238,799
2,147,483,647
Python 3
OK
TESTS
56
46
0
n=input() flag=True arr=[] for num in n: arr.append(num) for i in range(1,len(arr)): if arr[i].islower(): flag=False if flag==True: if arr[0].isupper(): for i in range(0,len(arr)): arr[i]=arr[i].lower() else: arr[0]=arr[0].upper() for i in range (1,len(arr)): arr[i]=arr[i].lower() brr="" for b in arr : brr=brr+b print(brr)
Title: cAPS lOCK Time Limit: None seconds Memory Limit: None megabytes Problem Description: wHAT DO WE NEED cAPS LOCK FOR? Caps lock is a computer keyboard key. Pressing it sets an input mode in which typed letters are capital by default. If it is pressed by accident, it leads to accidents like the one we had in the first passage. Let's consider that a word has been typed with the Caps lock key accidentally switched on, if: - either it only contains uppercase letters; - or all letters except for the first one are uppercase. In this case we should automatically change the case of all letters. For example, the case of the letters that form words "hELLO", "HTTP", "z" should be changed. Write a program that applies the rule mentioned above. If the rule cannot be applied, the program should leave the word unchanged. Input Specification: The first line of the input data contains a word consisting of uppercase and lowercase Latin letters. The word's length is from 1 to 100 characters, inclusive. Output Specification: Print the result of the given word's processing. Demo Input: ['cAPS\n', 'Lock\n'] Demo Output: ['Caps', 'Lock\n'] Note: none
```python n=input() flag=True arr=[] for num in n: arr.append(num) for i in range(1,len(arr)): if arr[i].islower(): flag=False if flag==True: if arr[0].isupper(): for i in range(0,len(arr)): arr[i]=arr[i].lower() else: arr[0]=arr[0].upper() for i in range (1,len(arr)): arr[i]=arr[i].lower() brr="" for b in arr : brr=brr+b print(brr) ```
3
651
B
Beautiful Paintings
PROGRAMMING
1,200
[ "greedy", "sortings" ]
null
null
There are *n* pictures delivered for the new exhibition. The *i*-th painting has beauty *a**i*. We know that a visitor becomes happy every time he passes from a painting to a more beautiful one. We are allowed to arranged pictures in any order. What is the maximum possible number of times the visitor may become happy while passing all pictures from first to last? In other words, we are allowed to rearrange elements of *a* in any order. What is the maximum possible number of indices *i* (1<=≀<=*i*<=≀<=*n*<=-<=1), such that *a**i*<=+<=1<=&gt;<=*a**i*.
The first line of the input contains integer *n* (1<=≀<=*n*<=≀<=1000)Β β€” the number of painting. The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=1000), where *a**i* means the beauty of the *i*-th painting.
Print one integerΒ β€” the maximum possible number of neighbouring pairs, such that *a**i*<=+<=1<=&gt;<=*a**i*, after the optimal rearrangement.
[ "5\n20 30 10 50 40\n", "4\n200 100 100 200\n" ]
[ "4\n", "2\n" ]
In the first sample, the optimal order is: 10, 20, 30, 40, 50. In the second sample, the optimal order is: 100, 200, 100, 200.
1,000
[ { "input": "5\n20 30 10 50 40", "output": "4" }, { "input": "4\n200 100 100 200", "output": "2" }, { "input": "10\n2 2 2 2 2 2 2 2 2 2", "output": "0" }, { "input": "1\n1000", "output": "0" }, { "input": "2\n444 333", "output": "1" }, { "input": "100\n9 9 72 55 14 8 55 58 35 67 3 18 73 92 41 49 15 60 18 66 9 26 97 47 43 88 71 97 19 34 48 96 79 53 8 24 69 49 12 23 77 12 21 88 66 9 29 13 61 69 54 77 41 13 4 68 37 74 7 6 29 76 55 72 89 4 78 27 29 82 18 83 12 4 32 69 89 85 66 13 92 54 38 5 26 56 17 55 29 4 17 39 29 94 3 67 85 98 21 14", "output": "95" }, { "input": "1\n995", "output": "0" }, { "input": "10\n103 101 103 103 101 102 100 100 101 104", "output": "7" }, { "input": "20\n102 100 102 104 102 101 104 103 100 103 105 105 100 105 100 100 101 105 105 102", "output": "15" }, { "input": "20\n990 994 996 999 997 994 990 992 990 993 992 990 999 999 992 994 997 990 993 998", "output": "15" }, { "input": "100\n1 8 3 8 10 8 5 3 10 3 5 8 4 5 5 5 10 3 6 6 6 6 6 7 2 7 2 4 7 8 3 8 7 2 5 6 1 5 5 7 9 7 6 9 1 8 1 3 6 5 1 3 6 9 5 6 8 4 8 6 10 9 2 9 3 8 7 5 2 10 2 10 3 6 5 5 3 5 10 2 3 7 10 8 8 4 3 4 9 6 10 7 6 6 6 4 9 9 8 9", "output": "84" } ]
1,585,931,040
2,147,483,647
Python 3
OK
TESTS
31
109
307,200
picture_quantity = int(input()) picture_beauty_list = list(map(int, input().split())) c = [] # try before b.sort() while len(picture_beauty_list) > 0: a = set(picture_beauty_list) b = list(a) b.sort() c += b for del_el in b: picture_beauty_list.remove(del_el) b = [] satisfied = 0 for i in range(len(c)): if i != len(c) - 1: if c[i] < c[i + 1]: satisfied += 1 print(satisfied)
Title: Beautiful Paintings Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are *n* pictures delivered for the new exhibition. The *i*-th painting has beauty *a**i*. We know that a visitor becomes happy every time he passes from a painting to a more beautiful one. We are allowed to arranged pictures in any order. What is the maximum possible number of times the visitor may become happy while passing all pictures from first to last? In other words, we are allowed to rearrange elements of *a* in any order. What is the maximum possible number of indices *i* (1<=≀<=*i*<=≀<=*n*<=-<=1), such that *a**i*<=+<=1<=&gt;<=*a**i*. Input Specification: The first line of the input contains integer *n* (1<=≀<=*n*<=≀<=1000)Β β€” the number of painting. The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=1000), where *a**i* means the beauty of the *i*-th painting. Output Specification: Print one integerΒ β€” the maximum possible number of neighbouring pairs, such that *a**i*<=+<=1<=&gt;<=*a**i*, after the optimal rearrangement. Demo Input: ['5\n20 30 10 50 40\n', '4\n200 100 100 200\n'] Demo Output: ['4\n', '2\n'] Note: In the first sample, the optimal order is: 10, 20, 30, 40, 50. In the second sample, the optimal order is: 100, 200, 100, 200.
```python picture_quantity = int(input()) picture_beauty_list = list(map(int, input().split())) c = [] # try before b.sort() while len(picture_beauty_list) > 0: a = set(picture_beauty_list) b = list(a) b.sort() c += b for del_el in b: picture_beauty_list.remove(del_el) b = [] satisfied = 0 for i in range(len(c)): if i != len(c) - 1: if c[i] < c[i + 1]: satisfied += 1 print(satisfied) ```
3
617
A
Elephant
PROGRAMMING
800
[ "math" ]
null
null
An elephant decided to visit his friend. It turned out that the elephant's house is located at point 0 and his friend's house is located at point *x*(*x*<=&gt;<=0) of the coordinate line. In one step the elephant can move 1, 2, 3, 4 or 5 positions forward. Determine, what is the minimum number of steps he need to make in order to get to his friend's house.
The first line of the input contains an integer *x* (1<=≀<=*x*<=≀<=1<=000<=000)Β β€” The coordinate of the friend's house.
Print the minimum number of steps that elephant needs to make to get from point 0 to point *x*.
[ "5\n", "12\n" ]
[ "1\n", "3\n" ]
In the first sample the elephant needs to make one step of length 5 to reach the point *x*. In the second sample the elephant can get to point *x* if he moves by 3, 5 and 4. There are other ways to get the optimal answer but the elephant cannot reach *x* in less than three moves.
500
[ { "input": "5", "output": "1" }, { "input": "12", "output": "3" }, { "input": "999999", "output": "200000" }, { "input": "41", "output": "9" }, { "input": "1000000", "output": "200000" }, { "input": "1", "output": "1" }, { "input": "2", "output": "1" }, { "input": "3", "output": "1" }, { "input": "4", "output": "1" }, { "input": "534204", "output": "106841" }, { "input": "469569", "output": "93914" }, { "input": "502877", "output": "100576" }, { "input": "942212", "output": "188443" }, { "input": "97", "output": "20" }, { "input": "53", "output": "11" }, { "input": "89", "output": "18" }, { "input": "574", "output": "115" }, { "input": "716", "output": "144" }, { "input": "729", "output": "146" }, { "input": "8901", "output": "1781" }, { "input": "3645", "output": "729" }, { "input": "4426", "output": "886" }, { "input": "46573", "output": "9315" }, { "input": "86380", "output": "17276" }, { "input": "94190", "output": "18838" }, { "input": "999990", "output": "199998" }, { "input": "999991", "output": "199999" }, { "input": "999992", "output": "199999" }, { "input": "999993", "output": "199999" }, { "input": "999994", "output": "199999" }, { "input": "999995", "output": "199999" }, { "input": "999996", "output": "200000" }, { "input": "999997", "output": "200000" }, { "input": "999998", "output": "200000" } ]
1,698,165,923
2,147,483,647
Python 3
OK
TESTS
34
62
0
x=int(input()) s=0 while(x>=5): x=x-5 s+=1 if(x>=1 and x<=4): s+=1 print(s)
Title: Elephant Time Limit: None seconds Memory Limit: None megabytes Problem Description: An elephant decided to visit his friend. It turned out that the elephant's house is located at point 0 and his friend's house is located at point *x*(*x*<=&gt;<=0) of the coordinate line. In one step the elephant can move 1, 2, 3, 4 or 5 positions forward. Determine, what is the minimum number of steps he need to make in order to get to his friend's house. Input Specification: The first line of the input contains an integer *x* (1<=≀<=*x*<=≀<=1<=000<=000)Β β€” The coordinate of the friend's house. Output Specification: Print the minimum number of steps that elephant needs to make to get from point 0 to point *x*. Demo Input: ['5\n', '12\n'] Demo Output: ['1\n', '3\n'] Note: In the first sample the elephant needs to make one step of length 5 to reach the point *x*. In the second sample the elephant can get to point *x* if he moves by 3, 5 and 4. There are other ways to get the optimal answer but the elephant cannot reach *x* in less than three moves.
```python x=int(input()) s=0 while(x>=5): x=x-5 s+=1 if(x>=1 and x<=4): s+=1 print(s) ```
3
922
C
Cave Painting
PROGRAMMING
1,600
[ "brute force", "number theory" ]
null
null
Imp is watching a documentary about cave painting. Some numbers, carved in chaotic order, immediately attracted his attention. Imp rapidly proposed a guess that they are the remainders of division of a number *n* by all integers *i* from 1 to *k*. Unfortunately, there are too many integers to analyze for Imp. Imp wants you to check whether all these remainders are distinct. Formally, he wants to check, if all , 1<=≀<=*i*<=≀<=*k*, are distinct, i.Β e. there is no such pair (*i*,<=*j*) that: - 1<=≀<=*i*<=&lt;<=*j*<=≀<=*k*, - , where is the remainder of division *x* by *y*.
The only line contains two integers *n*, *k* (1<=≀<=*n*,<=*k*<=≀<=1018).
Print "Yes", if all the remainders are distinct, and "No" otherwise. You can print each letter in arbitrary case (lower or upper).
[ "4 4\n", "5 3\n" ]
[ "No\n", "Yes\n" ]
In the first sample remainders modulo 1 and 4 coincide.
1,250
[ { "input": "4 4", "output": "No" }, { "input": "5 3", "output": "Yes" }, { "input": "1 1", "output": "Yes" }, { "input": "744 18", "output": "No" }, { "input": "47879 10", "output": "Yes" }, { "input": "1000000000000000000 1000000000000000000", "output": "No" }, { "input": "657180569218773599 42", "output": "Yes" }, { "input": "442762254977842799 30", "output": "Yes" }, { "input": "474158606260730555 1", "output": "Yes" }, { "input": "807873101233533988 39", "output": "No" }, { "input": "423 7", "output": "No" }, { "input": "264306177888923090 5", "output": "No" }, { "input": "998857801526481788 87", "output": "No" }, { "input": "999684044704565212 28", "output": "No" }, { "input": "319575605003866172 71", "output": "No" }, { "input": "755804560577415016 17", "output": "No" }, { "input": "72712630136142067 356370939", "output": "No" }, { "input": "807264258068668062 33080422", "output": "No" }, { "input": "808090496951784190 311661970", "output": "No" }, { "input": "808916740129867614 180178111", "output": "No" }, { "input": "1 2", "output": "Yes" }, { "input": "2 1", "output": "Yes" }, { "input": "57334064998850639 19", "output": "Yes" }, { "input": "144353716412182199 11", "output": "Yes" }, { "input": "411002215096001759 11", "output": "Yes" }, { "input": "347116374613371527 3", "output": "Yes" }, { "input": "518264351335130399 37", "output": "Yes" }, { "input": "192435891235905239 11", "output": "Yes" }, { "input": "491802505049361659 7", "output": "Yes" }, { "input": "310113769227703889 3", "output": "Yes" }, { "input": "876240758958364799 41", "output": "Yes" }, { "input": "173284263472319999 33", "output": "Yes" }, { "input": "334366426725130799 29", "output": "Yes" }, { "input": "415543470272330399 26", "output": "Yes" }, { "input": "631689521541558479 22", "output": "Yes" }, { "input": "581859366558790319 14", "output": "Yes" }, { "input": "224113913709159599 10", "output": "Yes" }, { "input": "740368848764104559 21", "output": "Yes" }, { "input": "895803074828822159 17", "output": "Yes" }, { "input": "400349974997012039 13", "output": "Yes" }, { "input": "205439024252247599 5", "output": "Yes" }, { "input": "197688463911338399 39", "output": "Yes" }, { "input": "283175367224349599 39", "output": "Yes" }, { "input": "893208176423362799 31", "output": "Yes" }, { "input": "440681012669897999 27", "output": "Yes" }, { "input": "947403664618451039 19", "output": "Yes" }, { "input": "232435556779345919 19", "output": "Yes" }, { "input": "504428493840551279 23", "output": "Yes" }, { "input": "30019549241681999 20", "output": "Yes" }, { "input": "648000813924303839 16", "output": "Yes" }, { "input": "763169499725761451 488954176053755860", "output": "No" }, { "input": "199398459594277592 452260924647536414", "output": "No" }, { "input": "635627415167826436 192195636386541160", "output": "No" }, { "input": "71856370741375281 155502380685354417", "output": "No" }, { "input": "731457367464667229 118809129279134971", "output": "No" }, { "input": "167686318743248777 858743836723172421", "output": "No" }, { "input": "603915274316797622 822050585316952974", "output": "No" }, { "input": "647896534275160623 65689274138731296", "output": "No" }, { "input": "648722777453244047 501918229712280140", "output": "No" }, { "input": "649549020631327471 41923378183538525", "output": "No" }, { "input": "650375259514443599 597748177714153637", "output": "No" }, { "input": "651201506987494319 33977137582669778", "output": "No" }, { "input": "652027745870610447 470206093156218622", "output": "No" }, { "input": "652853989048693871 906435048729767466", "output": "No" }, { "input": "653680227931809999 342664004303316311", "output": "No" }, { "input": "654506475404860719 375019787446735639", "output": "No" }, { "input": "655332714287976847 438493956600157103", "output": "No" }, { "input": "166512305365727033 900267947832156186", "output": "No" }, { "input": "167338548543810457 336496907700672326", "output": "No" }, { "input": "168164787426926585 772725863274221171", "output": "No" }, { "input": "523 3", "output": "No" }, { "input": "39211 6", "output": "No" }, { "input": "22151 9", "output": "No" }, { "input": "1 3", "output": "No" }, { "input": "47 5", "output": "No" }, { "input": "999999998999999999 1000000000", "output": "No" }, { "input": "11 6", "output": "No" }, { "input": "7 4", "output": "No" }, { "input": "1 10", "output": "No" }, { "input": "9 5", "output": "No" }, { "input": "2519 20", "output": "No" }, { "input": "700001 3", "output": "Yes" }, { "input": "13 7", "output": "No" }, { "input": "999999 10000", "output": "No" }, { "input": "1 4", "output": "No" }, { "input": "232792559 30", "output": "No" }, { "input": "1 5", "output": "No" }, { "input": "5 4", "output": "No" }, { "input": "5 8", "output": "No" }, { "input": "55 4", "output": "No" } ]
1,603,468,382
2,147,483,647
PyPy 3
OK
TESTS
90
155
0
from sys import stdin,stdout n,k=map(int,input().split()) print(["Yes","No"][any((n+1)%i for i in range(2,k+1))])
Title: Cave Painting Time Limit: None seconds Memory Limit: None megabytes Problem Description: Imp is watching a documentary about cave painting. Some numbers, carved in chaotic order, immediately attracted his attention. Imp rapidly proposed a guess that they are the remainders of division of a number *n* by all integers *i* from 1 to *k*. Unfortunately, there are too many integers to analyze for Imp. Imp wants you to check whether all these remainders are distinct. Formally, he wants to check, if all , 1<=≀<=*i*<=≀<=*k*, are distinct, i.Β e. there is no such pair (*i*,<=*j*) that: - 1<=≀<=*i*<=&lt;<=*j*<=≀<=*k*, - , where is the remainder of division *x* by *y*. Input Specification: The only line contains two integers *n*, *k* (1<=≀<=*n*,<=*k*<=≀<=1018). Output Specification: Print "Yes", if all the remainders are distinct, and "No" otherwise. You can print each letter in arbitrary case (lower or upper). Demo Input: ['4 4\n', '5 3\n'] Demo Output: ['No\n', 'Yes\n'] Note: In the first sample remainders modulo 1 and 4 coincide.
```python from sys import stdin,stdout n,k=map(int,input().split()) print(["Yes","No"][any((n+1)%i for i in range(2,k+1))]) ```
3
296
A
Yaroslav and Permutations
PROGRAMMING
1,100
[ "greedy", "math" ]
null
null
Yaroslav has an array that consists of *n* integers. In one second Yaroslav can swap two neighboring array elements. Now Yaroslav is wondering if he can obtain an array where any two neighboring elements would be distinct in a finite time. Help Yaroslav.
The first line contains integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of elements in the array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=1000) β€” the array elements.
In the single line print "YES" (without the quotes) if Yaroslav can obtain the array he needs, and "NO" (without the quotes) otherwise.
[ "1\n1\n", "3\n1 1 2\n", "4\n7 7 7 7\n" ]
[ "YES\n", "YES\n", "NO\n" ]
In the first sample the initial array fits well. In the second sample Yaroslav can get array: 1, 2, 1. He can swap the last and the second last elements to obtain it. In the third sample Yarosav can't get the array he needs.
500
[ { "input": "1\n1", "output": "YES" }, { "input": "3\n1 1 2", "output": "YES" }, { "input": "4\n7 7 7 7", "output": "NO" }, { "input": "4\n479 170 465 146", "output": "YES" }, { "input": "5\n996 437 605 996 293", "output": "YES" }, { "input": "6\n727 539 896 668 36 896", "output": "YES" }, { "input": "7\n674 712 674 674 674 674 674", "output": "NO" }, { "input": "8\n742 742 742 742 742 289 742 742", "output": "NO" }, { "input": "9\n730 351 806 806 806 630 85 757 967", "output": "YES" }, { "input": "10\n324 539 83 440 834 640 440 440 440 440", "output": "YES" }, { "input": "7\n925 830 925 98 987 162 356", "output": "YES" }, { "input": "68\n575 32 53 351 151 942 725 967 431 108 192 8 338 458 288 754 384 946 910 210 759 222 589 423 947 507 31 414 169 901 592 763 656 411 360 625 538 549 484 596 42 603 351 292 837 375 21 597 22 349 200 669 485 282 735 54 1000 419 939 901 789 128 468 729 894 649 484 808", "output": "YES" }, { "input": "22\n618 814 515 310 617 936 452 601 250 520 557 799 304 225 9 845 610 990 703 196 486 94", "output": "YES" }, { "input": "44\n459 581 449 449 449 449 449 449 449 623 449 449 449 449 449 449 449 449 889 449 203 273 329 449 449 449 449 449 449 845 882 323 22 449 449 893 449 449 449 449 449 870 449 402", "output": "NO" }, { "input": "90\n424 3 586 183 286 89 427 618 758 833 933 170 155 722 190 977 330 369 693 426 556 435 550 442 513 146 61 719 754 140 424 280 997 688 530 550 438 867 950 194 196 298 417 287 106 489 283 456 735 115 702 317 672 787 264 314 356 186 54 913 809 833 946 314 757 322 559 647 983 482 145 197 223 130 162 536 451 174 467 45 660 293 440 254 25 155 511 746 650 187", "output": "YES" }, { "input": "14\n959 203 478 315 788 788 373 834 488 519 774 764 193 103", "output": "YES" }, { "input": "81\n544 528 528 528 528 4 506 528 32 528 528 528 528 528 528 528 528 975 528 528 528 528 528 528 528 528 528 528 528 528 528 20 528 528 528 528 528 528 528 528 852 528 528 120 528 528 61 11 528 528 528 228 528 165 883 528 488 475 628 528 528 528 528 528 528 597 528 528 528 528 528 528 528 528 528 528 528 412 528 521 925", "output": "NO" }, { "input": "89\n354 356 352 355 355 355 352 354 354 352 355 356 355 352 354 356 354 355 355 354 353 352 352 355 355 356 352 352 353 356 352 353 354 352 355 352 353 353 353 354 353 354 354 353 356 353 353 354 354 354 354 353 352 353 355 356 356 352 356 354 353 352 355 354 356 356 356 354 354 356 354 355 354 355 353 352 354 355 352 355 355 354 356 353 353 352 356 352 353", "output": "YES" }, { "input": "71\n284 284 285 285 285 284 285 284 284 285 284 285 284 284 285 284 285 285 285 285 284 284 285 285 284 284 284 285 284 285 284 285 285 284 284 284 285 284 284 285 285 285 284 284 285 284 285 285 284 285 285 284 285 284 284 284 285 285 284 285 284 285 285 285 285 284 284 285 285 284 285", "output": "NO" }, { "input": "28\n602 216 214 825 814 760 814 28 76 814 814 288 814 814 222 707 11 490 814 543 914 705 814 751 976 814 814 99", "output": "YES" }, { "input": "48\n546 547 914 263 986 945 914 914 509 871 324 914 153 571 914 914 914 528 970 566 544 914 914 914 410 914 914 589 609 222 914 889 691 844 621 68 914 36 914 39 630 749 914 258 945 914 727 26", "output": "YES" }, { "input": "56\n516 76 516 197 516 427 174 516 706 813 94 37 516 815 516 516 937 483 16 516 842 516 638 691 516 635 516 516 453 263 516 516 635 257 125 214 29 81 516 51 362 516 677 516 903 516 949 654 221 924 516 879 516 516 972 516", "output": "YES" }, { "input": "46\n314 723 314 314 314 235 314 314 314 314 270 314 59 972 314 216 816 40 314 314 314 314 314 314 314 381 314 314 314 314 314 314 314 789 314 957 114 942 314 314 29 314 314 72 314 314", "output": "NO" }, { "input": "72\n169 169 169 599 694 81 250 529 865 406 817 169 667 169 965 169 169 663 65 169 903 169 942 763 169 807 169 603 169 169 13 169 169 810 169 291 169 169 169 169 169 169 169 713 169 440 169 169 169 169 169 480 169 169 867 169 169 169 169 169 169 169 169 393 169 169 459 169 99 169 601 800", "output": "NO" }, { "input": "100\n317 316 317 316 317 316 317 316 317 316 316 317 317 316 317 316 316 316 317 316 317 317 316 317 316 316 316 316 316 316 317 316 317 317 317 317 317 317 316 316 316 317 316 317 316 317 316 317 317 316 317 316 317 317 316 317 316 317 316 317 316 316 316 317 317 317 317 317 316 317 317 316 316 316 316 317 317 316 317 316 316 316 316 316 316 317 316 316 317 317 317 317 317 317 317 317 317 316 316 317", "output": "NO" }, { "input": "100\n510 510 510 162 969 32 510 511 510 510 911 183 496 875 903 461 510 510 123 578 510 510 510 510 510 755 510 673 510 510 763 510 510 909 510 435 487 959 807 510 368 788 557 448 284 332 510 949 510 510 777 112 857 926 487 510 510 510 678 510 510 197 829 427 698 704 409 509 510 238 314 851 510 651 510 455 682 510 714 635 973 510 443 878 510 510 510 591 510 24 596 510 43 183 510 510 671 652 214 784", "output": "YES" }, { "input": "100\n476 477 474 476 476 475 473 476 474 475 473 477 476 476 474 476 474 475 476 477 473 473 473 474 474 476 473 473 476 476 475 476 473 474 473 473 477 475 475 475 476 475 477 477 477 476 475 475 475 473 476 477 475 476 477 473 474 477 473 475 476 476 474 477 476 474 473 477 473 475 477 473 476 474 477 473 475 477 473 476 476 475 476 475 474 473 477 473 475 473 477 473 473 474 475 473 477 476 477 474", "output": "YES" }, { "input": "100\n498 498 498 498 498 499 498 499 499 499 498 498 498 498 499 498 499 499 498 499 498 498 498 499 499 499 498 498 499 499 498 498 498 499 498 499 498 498 498 499 498 499 498 498 498 498 499 498 498 499 498 498 499 498 499 499 498 499 499 499 498 498 498 498 499 498 499 498 499 499 499 499 498 498 499 499 498 499 499 498 498 499 499 498 498 499 499 499 498 498 499 498 498 498 499 499 499 498 498 499", "output": "NO" }, { "input": "100\n858 53 816 816 816 816 816 816 816 181 816 816 816 816 579 879 816 948 171 816 816 150 866 816 816 816 897 816 816 816 816 816 816 706 816 539 816 816 816 816 816 816 423 487 816 615 254 816 816 816 816 83 816 816 816 816 816 816 816 816 816 816 816 136 775 999 816 816 816 644 816 816 816 816 927 816 802 816 856 816 816 816 816 816 816 816 816 816 816 700 816 816 816 816 982 477 816 891 806 816", "output": "NO" }, { "input": "100\n167 169 169 167 169 169 167 167 167 167 168 166 170 170 169 170 170 170 169 168 166 167 170 169 167 169 168 169 166 170 166 167 170 166 166 167 169 166 166 169 166 167 168 168 170 167 168 166 168 170 167 168 167 169 169 166 168 167 170 168 167 169 168 169 166 168 168 169 169 166 170 168 167 169 170 168 167 169 168 167 168 168 166 169 170 170 166 166 167 170 167 168 167 167 169 169 166 166 169 167", "output": "YES" }, { "input": "100\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000", "output": "NO" }, { "input": "99\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000", "output": "NO" }, { "input": "100\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "YES" }, { "input": "99\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "YES" }, { "input": "2\n1 1", "output": "NO" }, { "input": "1\n1000", "output": "YES" }, { "input": "12\n2 2 4 4 4 4 6 6 6 6 6 6", "output": "YES" } ]
1,519,032,705
2,147,483,647
Python 3
OK
TESTS
37
124
5,734,400
import math n=int(input()) a=list(map(int,input().split())) b=[0]*1005 for i in a: b[i]+=1 if max(b)<=(math.ceil(n/2)): print("YES") else: print("NO")
Title: Yaroslav and Permutations Time Limit: None seconds Memory Limit: None megabytes Problem Description: Yaroslav has an array that consists of *n* integers. In one second Yaroslav can swap two neighboring array elements. Now Yaroslav is wondering if he can obtain an array where any two neighboring elements would be distinct in a finite time. Help Yaroslav. Input Specification: The first line contains integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of elements in the array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=1000) β€” the array elements. Output Specification: In the single line print "YES" (without the quotes) if Yaroslav can obtain the array he needs, and "NO" (without the quotes) otherwise. Demo Input: ['1\n1\n', '3\n1 1 2\n', '4\n7 7 7 7\n'] Demo Output: ['YES\n', 'YES\n', 'NO\n'] Note: In the first sample the initial array fits well. In the second sample Yaroslav can get array: 1, 2, 1. He can swap the last and the second last elements to obtain it. In the third sample Yarosav can't get the array he needs.
```python import math n=int(input()) a=list(map(int,input().split())) b=[0]*1005 for i in a: b[i]+=1 if max(b)<=(math.ceil(n/2)): print("YES") else: print("NO") ```
3
586
A
Alena's Schedule
PROGRAMMING
900
[ "implementation" ]
null
null
Alena has successfully passed the entrance exams to the university and is now looking forward to start studying. One two-hour lesson at the Russian university is traditionally called a pair, it lasts for two academic hours (an academic hour is equal to 45 minutes). The University works in such a way that every day it holds exactly *n* lessons. Depending on the schedule of a particular group of students, on a given day, some pairs may actually contain classes, but some may be empty (such pairs are called breaks). The official website of the university has already published the schedule for tomorrow for Alena's group. Thus, for each of the *n* pairs she knows if there will be a class at that time or not. Alena's House is far from the university, so if there are breaks, she doesn't always go home. Alena has time to go home only if the break consists of at least two free pairs in a row, otherwise she waits for the next pair at the university. Of course, Alena does not want to be sleepy during pairs, so she will sleep as long as possible, and will only come to the first pair that is presented in her schedule. Similarly, if there are no more pairs, then Alena immediately goes home. Alena appreciates the time spent at home, so she always goes home when it is possible, and returns to the university only at the beginning of the next pair. Help Alena determine for how many pairs she will stay at the university. Note that during some pairs Alena may be at the university waiting for the upcoming pair.
The first line of the input contains a positive integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of lessons at the university. The second line contains *n* numbers *a**i* (0<=≀<=*a**i*<=≀<=1). Number *a**i* equals 0, if Alena doesn't have the *i*-th pairs, otherwise it is equal to 1. Numbers *a*1,<=*a*2,<=...,<=*a**n* are separated by spaces.
Print a single number β€” the number of pairs during which Alena stays at the university.
[ "5\n0 1 0 1 1\n", "7\n1 0 1 0 0 1 0\n", "1\n0\n" ]
[ "4\n", "4\n", "0\n" ]
In the first sample Alena stays at the university from the second to the fifth pair, inclusive, during the third pair she will be it the university waiting for the next pair. In the last sample Alena doesn't have a single pair, so she spends all the time at home.
500
[ { "input": "5\n0 1 0 1 1", "output": "4" }, { "input": "7\n1 0 1 0 0 1 0", "output": "4" }, { "input": "1\n0", "output": "0" }, { "input": "1\n1", "output": "1" }, { "input": "2\n0 0", "output": "0" }, { "input": "2\n0 1", "output": "1" }, { "input": "2\n1 0", "output": "1" }, { "input": "2\n1 1", "output": "2" }, { "input": "10\n0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "9\n1 1 1 1 1 1 1 1 1", "output": "9" }, { "input": "11\n0 0 0 0 0 0 0 0 0 0 1", "output": "1" }, { "input": "12\n1 0 0 0 0 0 0 0 0 0 0 0", "output": "1" }, { "input": "20\n1 1 0 1 1 1 1 1 1 1 1 0 1 1 1 0 0 1 0 0", "output": "16" }, { "input": "41\n1 1 0 1 0 1 0 0 1 0 1 1 1 0 0 0 1 1 1 0 1 0 1 1 0 1 0 1 0 0 0 0 0 0 1 0 0 1 0 1 1", "output": "28" }, { "input": "63\n1 1 0 1 1 0 0 0 1 1 0 0 1 1 1 1 0 1 1 0 1 0 1 1 1 1 1 0 0 0 0 0 0 1 0 0 1 0 0 1 0 1 1 0 0 1 1 0 0 1 1 1 1 0 0 1 1 0 0 1 0 1 0", "output": "39" }, { "input": "80\n0 1 1 1 0 1 1 1 1 1 0 0 1 0 1 1 0 1 1 1 0 1 1 1 1 0 1 0 1 0 0 0 1 1 0 1 1 0 0 0 0 1 1 1 0 0 0 1 0 0 1 1 1 0 0 0 0 0 0 1 0 1 0 0 1 0 1 1 1 1 1 0 0 0 1 1 0 0 1 1", "output": "52" }, { "input": "99\n1 1 0 0 0 1 0 0 1 1 1 1 0 0 0 1 0 1 1 0 1 1 1 1 0 0 0 0 1 1 1 1 0 1 0 1 0 1 1 1 0 0 1 1 1 0 0 0 1 1 1 0 1 1 1 0 1 0 0 1 1 0 1 0 0 1 1 1 1 0 0 1 1 0 0 1 0 1 1 1 0 1 1 0 1 0 0 1 0 1 0 1 0 1 1 0 1 0 1", "output": "72" }, { "input": "100\n0 1 1 0 1 1 0 0 1 1 0 1 1 1 1 1 0 0 1 1 1 0 0 0 0 1 1 0 0 1 0 0 1 0 0 0 0 1 1 1 1 1 1 0 0 1 1 0 0 0 0 1 0 1 1 1 0 1 1 0 1 0 0 0 0 0 1 0 1 1 0 0 1 1 0 1 1 0 0 1 1 1 0 1 1 1 1 1 1 0 0 1 1 1 1 0 1 1 1 0", "output": "65" }, { "input": "11\n0 1 1 0 0 0 0 0 0 0 0", "output": "2" }, { "input": "11\n0 1 0 1 0 0 1 1 0 1 1", "output": "8" }, { "input": "11\n1 0 1 0 1 1 0 1 1 1 0", "output": "10" }, { "input": "11\n1 0 0 0 0 0 1 0 1 1 1", "output": "6" }, { "input": "22\n0 1 1 0 0 0 0 0 1 0 0 0 0 1 1 0 0 1 0 0 1 0", "output": "7" }, { "input": "22\n0 1 0 1 0 1 1 1 1 0 0 1 1 1 0 1 1 1 0 0 0 1", "output": "16" }, { "input": "22\n1 0 1 0 1 0 0 0 0 0 0 1 0 0 0 0 1 1 0 1 1 0", "output": "11" }, { "input": "22\n1 0 1 0 0 0 1 0 0 1 1 0 1 0 1 1 0 0 0 1 0 1", "output": "14" }, { "input": "33\n0 1 1 0 1 1 0 1 0 1 1 0 1 1 1 1 0 1 1 1 0 0 1 1 0 0 1 1 0 1 1 0 0", "output": "26" }, { "input": "33\n0 1 0 1 0 1 1 0 0 0 1 1 1 0 1 0 1 1 0 1 0 1 0 0 1 1 1 0 1 1 1 0 1", "output": "27" }, { "input": "33\n1 0 1 0 1 0 0 0 1 0 1 1 1 0 0 0 0 1 1 0 1 0 1 1 0 1 0 1 1 1 1 1 0", "output": "25" }, { "input": "33\n1 0 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 0 1 0 0 0 1 0 1 0 1 0 0 0 0 1 1", "output": "24" }, { "input": "44\n0 1 1 0 1 0 0 0 0 1 1 0 0 0 0 0 1 1 1 0 0 0 0 0 1 0 0 1 1 0 0 0 0 1 1 1 0 0 1 0 1 1 0 0", "output": "19" }, { "input": "44\n0 1 1 1 1 0 1 0 0 1 0 1 0 0 1 1 0 1 1 0 0 1 0 1 0 1 1 0 1 0 1 0 1 0 1 0 0 0 0 0 1 0 1 1", "output": "32" }, { "input": "44\n1 0 1 0 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 1 0 0 1 0 0 1 0", "output": "23" }, { "input": "44\n1 0 1 0 1 1 1 0 0 0 0 0 0 1 0 0 0 1 1 1 0 0 0 1 0 1 0 1 1 0 1 1 0 1 0 1 1 0 1 0 1 1 1 1", "output": "32" }, { "input": "55\n0 1 1 0 1 0 0 0 1 0 0 0 1 0 1 0 0 1 0 0 0 0 1 1 1 0 0 1 1 0 0 0 0 0 1 0 1 1 1 0 0 0 0 0 1 0 0 0 0 1 1 0 0 1 0", "output": "23" }, { "input": "55\n0 1 1 0 1 0 1 1 1 1 0 1 1 0 0 1 1 1 0 0 0 1 1 0 0 1 0 1 0 1 0 0 1 1 1 1 1 0 0 0 1 1 1 1 1 1 1 1 0 1 1 0 0 0 1", "output": "39" }, { "input": "55\n1 0 1 0 0 1 0 0 1 1 0 1 0 1 0 0 1 1 0 0 0 0 1 1 1 0 0 0 1 1 1 1 0 1 0 1 0 0 0 1 0 1 1 0 0 0 1 0 1 0 0 1 1 0 0", "output": "32" }, { "input": "55\n1 0 1 0 1 0 1 0 1 1 0 0 1 1 1 1 0 1 0 0 0 1 1 0 0 1 0 1 0 1 1 1 0 0 0 0 0 0 1 0 0 0 1 1 1 0 0 0 1 0 1 0 1 1 1", "output": "36" }, { "input": "66\n0 1 1 0 0 1 0 1 0 1 0 1 1 0 1 1 0 0 1 1 0 1 0 0 0 0 0 0 0 1 0 0 0 1 1 1 1 1 1 0 0 1 1 1 0 1 0 1 1 0 1 0 0 1 1 0 1 1 1 0 0 0 0 0 1 0", "output": "41" }, { "input": "66\n0 1 1 0 1 1 1 0 0 0 1 1 0 1 1 0 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 0 1 0 0 1 1 1 0 0 1 0 1 1 1 0 0 0 1 0 0 0 0 0 1 0 1 0 0 1 0 0 1 1 0 1", "output": "42" }, { "input": "66\n1 0 1 0 0 0 1 0 1 0 1 0 1 1 0 1 0 1 1 0 0 0 1 1 1 0 1 0 0 1 0 1 0 0 0 0 1 1 0 1 1 0 1 0 0 0 1 1 0 1 0 1 1 0 0 0 1 1 0 1 1 0 1 1 0 0", "output": "46" }, { "input": "66\n1 0 1 0 0 0 1 1 1 1 1 0 1 0 0 0 1 1 1 0 1 1 0 1 0 1 0 0 1 0 0 1 0 1 0 1 0 0 1 0 0 1 0 1 1 1 1 1 0 1 1 1 1 1 1 0 0 0 1 0 1 1 0 0 0 1", "output": "46" }, { "input": "77\n0 0 1 0 0 1 0 0 1 1 1 1 0 1 0 0 1 0 0 0 0 1 0 0 0 0 1 0 1 0 1 0 0 0 1 0 0 1 1 0 1 0 1 1 0 0 0 1 0 0 1 1 1 0 1 0 1 1 0 1 0 0 0 1 0 1 1 0 1 1 1 0 1 1 0 1 0", "output": "47" }, { "input": "77\n0 0 1 0 0 0 1 0 1 1 1 1 0 1 1 1 0 1 1 0 1 1 1 0 1 1 0 1 0 0 0 0 1 1 0 0 0 1 1 0 0 1 1 0 1 0 0 1 0 0 0 1 0 0 1 0 0 0 1 0 0 0 1 0 0 1 0 1 1 0 1 0 0 0 0 1 1", "output": "44" }, { "input": "77\n1 0 0 0 1 0 1 1 0 0 1 0 0 0 1 1 1 1 0 1 0 0 0 0 0 0 1 1 0 0 0 1 0 1 0 1 1 1 0 1 1 1 0 0 0 1 1 0 1 1 1 0 1 1 0 0 1 0 0 1 1 1 1 0 1 0 0 0 1 0 1 1 0 0 0 0 0", "output": "45" }, { "input": "77\n1 0 1 0 0 1 1 0 0 0 0 0 0 0 0 0 0 1 0 1 1 1 0 0 1 1 1 0 1 1 0 1 0 0 0 0 1 1 1 0 1 0 0 1 1 0 1 0 1 1 1 1 1 1 1 0 0 1 1 0 0 1 0 1 1 1 1 1 1 1 1 0 0 1 0 1 1", "output": "51" }, { "input": "88\n0 0 1 0 0 0 0 0 0 0 0 1 1 1 1 0 0 0 0 1 0 1 1 1 0 0 1 1 0 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 0 0 0 0 1 0 0 0 1 0 1 1 0 1 0 1 0 0 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 1 0 0 1 1 1 0", "output": "44" }, { "input": "88\n0 0 1 0 0 0 1 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 1 0 1 1 0 1 1 1 0 1 0 0 1 0 1 1 0 0 0 0 0 1 1 0 0 1 0 1 1 1 0 1 1 0 1 1 0 0 0 1 1 1 1 1 1 1 0 0 1 0 1 0 0 0 1 0 1 0 0 0 0 0 0 0 1", "output": "59" }, { "input": "88\n1 0 0 0 1 1 1 0 1 1 0 0 0 0 0 0 1 0 1 0 0 0 1 1 0 0 1 1 1 1 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 1 1 1 0 1 1 0 0 1 1 1 0 0 1 0 0 1 1 1 1 0 0 1 0 1 1 1 0 1 0 1 1 1 1 0 1 0 1 1 1 0 0 0", "output": "53" }, { "input": "88\n1 1 1 0 0 1 1 0 1 0 0 0 1 0 1 1 1 1 1 0 1 1 1 1 1 1 1 0 0 1 0 1 1 1 0 0 0 1 1 0 1 1 0 1 0 0 1 0 0 1 0 0 1 0 1 1 0 1 0 1 0 1 0 0 1 1 1 0 0 0 1 0 0 1 0 0 1 1 0 1 1 1 1 0 1 1 0 1", "output": "63" }, { "input": "99\n0 0 0 0 1 0 0 1 0 0 0 1 1 1 1 1 1 0 1 1 0 1 0 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 0 0 1 0 0 1 0 1 0 1 0 0 0 0 1 0 1 1 0 0 1 1 1 0 0 1 1 0 0 0 0 0 0 1 0 0 0 1 1 0 0 0 1 1 1 0 1 1 0 1 0 1 0 0 0 1 1 0 0 0 0", "output": "56" }, { "input": "99\n0 0 1 0 0 1 1 0 0 0 1 1 0 0 1 0 0 0 1 1 1 1 0 0 0 1 1 0 0 0 1 0 1 1 0 0 1 1 1 0 1 1 0 0 0 0 0 1 0 0 1 0 1 1 0 1 0 1 0 0 1 0 1 1 1 1 1 1 0 1 0 0 1 1 0 0 1 0 1 0 1 0 1 1 1 0 0 1 1 1 0 0 0 0 0 0 1 1 1", "output": "58" }, { "input": "99\n1 1 0 0 1 1 1 0 0 0 1 0 1 0 1 1 0 0 0 0 0 0 0 0 1 0 1 1 0 0 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 0 1 0 1 1 1 1 0 1 1 1 0 0 1 0 0 1 1 0 0 0 0 1 0 0 1 0 1 1 0 1 1 0 0 1 0 0 1 0 1 0 1 1 0 1 0 1 1 1 1 0 0 1 0", "output": "65" }, { "input": "99\n1 1 1 0 1 0 1 1 0 1 1 0 0 1 0 0 1 1 1 0 1 1 0 0 0 1 1 1 1 0 1 1 1 0 1 1 0 1 1 0 1 0 1 0 0 1 1 1 1 1 0 1 1 0 1 1 0 0 0 1 0 1 0 1 0 1 0 0 0 1 1 1 1 0 0 1 1 0 1 0 0 0 1 0 1 1 1 0 0 1 1 1 1 1 0 1 1 1 1", "output": "77" }, { "input": "90\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "90\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "90" }, { "input": "95\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "95\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "95" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "100" } ]
1,444,644,762
3,762
Python 3
OK
TESTS
60
61
0
n = int(input()) P = list(map(int, input().split())) kol = 0 if P[0] == 1: kol += 1 for i in range(1, n-1): if P[i] != 0: kol += 1 elif P[i-1] != 0 and P[i] == 0 and P[i+1] != 0: kol += 1 if P[n-1] != 0 and n != 1: kol += 1 print(kol)
Title: Alena's Schedule Time Limit: None seconds Memory Limit: None megabytes Problem Description: Alena has successfully passed the entrance exams to the university and is now looking forward to start studying. One two-hour lesson at the Russian university is traditionally called a pair, it lasts for two academic hours (an academic hour is equal to 45 minutes). The University works in such a way that every day it holds exactly *n* lessons. Depending on the schedule of a particular group of students, on a given day, some pairs may actually contain classes, but some may be empty (such pairs are called breaks). The official website of the university has already published the schedule for tomorrow for Alena's group. Thus, for each of the *n* pairs she knows if there will be a class at that time or not. Alena's House is far from the university, so if there are breaks, she doesn't always go home. Alena has time to go home only if the break consists of at least two free pairs in a row, otherwise she waits for the next pair at the university. Of course, Alena does not want to be sleepy during pairs, so she will sleep as long as possible, and will only come to the first pair that is presented in her schedule. Similarly, if there are no more pairs, then Alena immediately goes home. Alena appreciates the time spent at home, so she always goes home when it is possible, and returns to the university only at the beginning of the next pair. Help Alena determine for how many pairs she will stay at the university. Note that during some pairs Alena may be at the university waiting for the upcoming pair. Input Specification: The first line of the input contains a positive integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of lessons at the university. The second line contains *n* numbers *a**i* (0<=≀<=*a**i*<=≀<=1). Number *a**i* equals 0, if Alena doesn't have the *i*-th pairs, otherwise it is equal to 1. Numbers *a*1,<=*a*2,<=...,<=*a**n* are separated by spaces. Output Specification: Print a single number β€” the number of pairs during which Alena stays at the university. Demo Input: ['5\n0 1 0 1 1\n', '7\n1 0 1 0 0 1 0\n', '1\n0\n'] Demo Output: ['4\n', '4\n', '0\n'] Note: In the first sample Alena stays at the university from the second to the fifth pair, inclusive, during the third pair she will be it the university waiting for the next pair. In the last sample Alena doesn't have a single pair, so she spends all the time at home.
```python n = int(input()) P = list(map(int, input().split())) kol = 0 if P[0] == 1: kol += 1 for i in range(1, n-1): if P[i] != 0: kol += 1 elif P[i-1] != 0 and P[i] == 0 and P[i+1] != 0: kol += 1 if P[n-1] != 0 and n != 1: kol += 1 print(kol) ```
3
32
B
Borze
PROGRAMMING
800
[ "expression parsing", "implementation" ]
B. Borze
2
256
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as Β«.Β», 1 as Β«-.Β» and 2 as Β«--Β». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
Output the decoded ternary number. It can have leading zeroes.
[ ".-.--\n", "--.\n", "-..-.--\n" ]
[ "012", "20", "1012" ]
none
1,000
[ { "input": ".-.--", "output": "012" }, { "input": "--.", "output": "20" }, { "input": "-..-.--", "output": "1012" }, { "input": "---..", "output": "210" }, { "input": "..--.---..", "output": "0020210" }, { "input": "-.....----.", "output": "10000220" }, { "input": ".", "output": "0" }, { "input": "-.", "output": "1" }, { "input": "--", "output": "2" }, { "input": "..", "output": "00" }, { "input": "--.", "output": "20" }, { "input": ".--.", "output": "020" }, { "input": ".-.-..", "output": "0110" }, { "input": "----.-.", "output": "2201" }, { "input": "-..--.-.", "output": "10201" }, { "input": "..--..--.", "output": "0020020" }, { "input": "-.-.---.--..-..-.-.-..-..-.--.", "output": "112120010111010120" }, { "input": "---.-.-.------..-..-..-..-.-..-.--.-.-..-.-.-----..-.-.", "output": "21112220010101011012011011221011" }, { "input": "-.-..--.-.-.-.-.-..-.-.-.---------.--.---..--...--.-----.-.-.-...--.-.-.---.------.--..-.--.-----.-...-..------", "output": "11020111110111222212021020002022111100201121222020012022110010222" }, { "input": "-.-..-.--.---..---.-..---.-...-.-.----..-.---.-.---..-.--.---.-.-------.---.--....----.-.---.---.---.----.-----..---.-.-.-.-----.--.-------.-..", "output": "110120210211021100112200121121012021122212120000220121212122022102111122120222110" }, { "input": ".-..-.-.---.-----.--.---...-.--.-.-....-..", "output": "01011212212021001201100010" }, { "input": ".------.-.---..--...-..-..-.-.-.--.--.-..-.--...-.-.---.-.-.------..--..-.---..----.-..-.--.---.-.----.-.---...-.-.-.-----.-.-.---.---.-.....-.-...-----.-...-.---.-..-.-----.--...---.-.-..-.--.-.---..", "output": "022201210200010101112020101200011211122200200121022010120211220121001112211121211000011002211001211012212000211101201210" }, { "input": ".-.--.---.-----.-.-----.-.-..-----..-..----..--.-.--.----..---.---..-.-.-----..-------.----..----.-..---...-----..-..-----...-..-.-.-----....---..---..-.-----...-.--...--.-.---.-.-.-.-.-...---..----.", "output": "01202122112211102210102200201202200212101122102221220022010210022101022100101122100021021012210012000201211111100210220" }, { "input": "..-.-.-.---.-.-.-..-.-..-.-.---.-------.---..-----.---....-.---.--.--.-.---.---------.-..---.-.-.--..---.---.-.---.-.-..-.-..-.-.-.----.--.-....--------.-.---..----.------.-.-.--.--.-----.-----.----", "output": "0011121111011011212221210221210001212020121222211021112002121121110110111220201000222201210220222011202022122122" }, { "input": "-..-------.------.-..--.-.-..--.-.-..-----..-.-.-..-..-..--.---..-----..---..-..--.-..-.-.---...-.....-------.---.-----.-...-.-...-.-.---.---.-----.--.--...-.--..-.-..-...-.-.-.-.---..---.-..-.-.-.-..", "output": "102221222010201102011022101110101020210221021010201011210010000222121221100110011212122120200012001101001111210211011110" }, { "input": ".-.----.-.--..-.-.-.-..----..-.-...--.-.---.---.-------..-.--..-......--.------.--.----.--...-.--.--..-----..-.....--.--.-.-.------..--------.----------..-.---.----.---.-..--..-.....-..------.--.", "output": "012201200111102200110020121212221012001000002022202022020001202002210100002020112220022220222220012122021102001000010222020" }, { "input": "------.-----.-....--.-.----.-.---.-.-..---.-.---.-----..-...-.-.---..-.-.-..-.-.-...-.-.-.----..--.------.----.-..-.--...-.-------...-.-..-.-.--.--.---..--..--------.--.-.-.---.-.-.-...----.--..-.--..", "output": "222022110002012201211102112122101001121011101110011122002022202201012000122210011011202021020022220201121111002202001200" }, { "input": "-.---...----...--.--...-.--.----", "output": "121002200020200012022" }, { "input": "--.--.--.---.--.-.---.-.-..-..--.-..---.-.....-..---.-----.--...-.-.-------.-.--.-.----.-..-.------.", "output": "202020212012111010201021100001021221200011222112012201012220" } ]
1,617,476,586
2,147,483,647
Python 3
OK
TESTS
30
124
0
x = input() ans = "" move = False for i in range(len(x)) : if move : move = False continue if x[i] == "." : ans += "0" else : move = True if x[i] == "-" and x[i+1] == "." : ans += "1" elif x[i] == "-" and x[i+1] == "-" : ans += "2" print(ans)
Title: Borze Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as Β«.Β», 1 as Β«-.Β» and 2 as Β«--Β». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet. Input Specification: The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes). Output Specification: Output the decoded ternary number. It can have leading zeroes. Demo Input: ['.-.--\n', '--.\n', '-..-.--\n'] Demo Output: ['012', '20', '1012'] Note: none
```python x = input() ans = "" move = False for i in range(len(x)) : if move : move = False continue if x[i] == "." : ans += "0" else : move = True if x[i] == "-" and x[i+1] == "." : ans += "1" elif x[i] == "-" and x[i+1] == "-" : ans += "2" print(ans) ```
3.969
58
A
Chat room
PROGRAMMING
1,000
[ "greedy", "strings" ]
A. Chat room
1
256
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
If Vasya managed to say hello, print "YES", otherwise print "NO".
[ "ahhellllloou\n", "hlelo\n" ]
[ "YES\n", "NO\n" ]
none
500
[ { "input": "ahhellllloou", "output": "YES" }, { "input": "hlelo", "output": "NO" }, { "input": "helhcludoo", "output": "YES" }, { "input": "hehwelloho", "output": "YES" }, { "input": "pnnepelqomhhheollvlo", "output": "YES" }, { "input": "tymbzjyqhymedasloqbq", "output": "NO" }, { "input": "yehluhlkwo", "output": "NO" }, { "input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello", "output": "YES" }, { "input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq", "output": "YES" }, { "input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi", "output": "YES" }, { "input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo", "output": "YES" }, { "input": "lqllcolohwflhfhlnaow", "output": "NO" }, { "input": "heheeellollvoo", "output": "YES" }, { "input": "hellooo", "output": "YES" }, { "input": "o", "output": "NO" }, { "input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv", "output": "YES" }, { "input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk", "output": "YES" }, { "input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry", "output": "NO" }, { "input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq", "output": "NO" }, { "input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi", "output": "YES" }, { "input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm", "output": "YES" }, { "input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac", "output": "NO" }, { "input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok", "output": "YES" }, { "input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz", "output": "YES" }, { "input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb", "output": "YES" }, { "input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla", "output": "YES" }, { "input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz", "output": "YES" }, { "input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti", "output": "YES" }, { "input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli", "output": "YES" }, { "input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo", "output": "YES" }, { "input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk", "output": "NO" }, { "input": "loee", "output": "NO" }, { "input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo", "output": "NO" }, { "input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi", "output": "YES" }, { "input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv", "output": "NO" }, { "input": "hello", "output": "YES" }, { "input": "oohell", "output": "NO" }, { "input": "hell", "output": "NO" }, { "input": "eloellohoelo", "output": "NO" }, { "input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo", "output": "YES" } ]
1,586,286,702
2,147,483,647
Python 3
OK
TESTS
40
109
0
s=input() compare="hello" i, j = 0, 0 while i < len(s) and j < 5: if s[i] != compare[j]: i+=1 else: i, j = i+1, j+1 check=j==5 if check: print("YES") else: print("NO")
Title: Chat room Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*. Input Specification: The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters. Output Specification: If Vasya managed to say hello, print "YES", otherwise print "NO". Demo Input: ['ahhellllloou\n', 'hlelo\n'] Demo Output: ['YES\n', 'NO\n'] Note: none
```python s=input() compare="hello" i, j = 0, 0 while i < len(s) and j < 5: if s[i] != compare[j]: i+=1 else: i, j = i+1, j+1 check=j==5 if check: print("YES") else: print("NO") ```
3.9455
1
B
Spreadsheet
PROGRAMMING
1,600
[ "implementation", "math" ]
B. Spreadsheets
10
64
In the popular spreadsheets systems (for example, in Excel) the following numeration of columns is used. The first column has number A, the second β€” number B, etc. till column 26 that is marked by Z. Then there are two-letter numbers: column 27 has number AA, 28 β€” AB, column 52 is marked by AZ. After ZZ there follow three-letter numbers, etc. The rows are marked by integer numbers starting with 1. The cell name is the concatenation of the column and the row numbers. For example, BC23 is the name for the cell that is in column 55, row 23. Sometimes another numeration system is used: RXCY, where X and Y are integer numbers, showing the column and the row numbers respectfully. For instance, R23C55 is the cell from the previous example. Your task is to write a program that reads the given sequence of cell coordinates and produce each item written according to the rules of another numeration system.
The first line of the input contains integer number *n* (1<=≀<=*n*<=≀<=105), the number of coordinates in the test. Then there follow *n* lines, each of them contains coordinates. All the coordinates are correct, there are no cells with the column and/or the row numbers larger than 106 .
Write *n* lines, each line should contain a cell coordinates in the other numeration system.
[ "2\nR23C55\nBC23\n" ]
[ "BC23\nR23C55\n" ]
none
0
[ { "input": "2\nR23C55\nBC23", "output": "BC23\nR23C55" }, { "input": "1\nA1", "output": "R1C1" }, { "input": "5\nR8C3\nD1\nR7C2\nR8C9\nR8C9", "output": "C8\nR1C4\nB7\nI8\nI8" }, { "input": "4\nR4C25\nR90C35\nAP55\nX83", "output": "Y4\nAI90\nR55C42\nR83C24" }, { "input": "10\nR50C12\nR23C47\nY96\nR44C13\nR19C21\nR95C73\nBK12\nR51C74\nAY34\nR63C25", "output": "L50\nAU23\nR96C25\nM44\nU19\nBU95\nR12C63\nBV51\nR34C51\nY63" } ]
1,687,414,547
2,147,483,647
PyPy 3-64
OK
TESTS
10
1,622
19,251,200
import math import re def iteracion(num, base): if num % base == 0: residuo = base else: residuo = num % base cociente = (num-residuo)/base return int(cociente), int(residuo) def tranformar_letter(num, base): lista = [] while (True): num, residuo = iteracion(num, base) lista = [residuo]+lista if num < base: lista = [num]+lista break letters = "0ABCDEFGHIJKLMNOPQRSTUVWXYZ" letter = "" for i in lista: if i != 0: letter = letter+letters[i] return letter def tranformar_num(text, base): letters = "0ABCDEFGHIJKLMNOPQRSTUVWXYZ" n = len(text) num = 0 for i in text: a = letters.index(str(i)) num = num+a*(base**(n-1)) n = n-1 return str(num) n = int(input()) data = [] for i in range(n): data.append(input()) for i in data: resultado = re.findall(r'R(\d+)C(\d+)', i) if resultado: print(tranformar_letter(int(resultado[0][1]), 26)+resultado[0][0]) else: resultado = re.findall(r'([A-Za-z]+)(\d+)', i) num = tranformar_num(resultado[0][0], 26) print("R"+resultado[0][1]+"C"+num)
Title: Spreadsheet Time Limit: 10 seconds Memory Limit: 64 megabytes Problem Description: In the popular spreadsheets systems (for example, in Excel) the following numeration of columns is used. The first column has number A, the second β€” number B, etc. till column 26 that is marked by Z. Then there are two-letter numbers: column 27 has number AA, 28 β€” AB, column 52 is marked by AZ. After ZZ there follow three-letter numbers, etc. The rows are marked by integer numbers starting with 1. The cell name is the concatenation of the column and the row numbers. For example, BC23 is the name for the cell that is in column 55, row 23. Sometimes another numeration system is used: RXCY, where X and Y are integer numbers, showing the column and the row numbers respectfully. For instance, R23C55 is the cell from the previous example. Your task is to write a program that reads the given sequence of cell coordinates and produce each item written according to the rules of another numeration system. Input Specification: The first line of the input contains integer number *n* (1<=≀<=*n*<=≀<=105), the number of coordinates in the test. Then there follow *n* lines, each of them contains coordinates. All the coordinates are correct, there are no cells with the column and/or the row numbers larger than 106 . Output Specification: Write *n* lines, each line should contain a cell coordinates in the other numeration system. Demo Input: ['2\nR23C55\nBC23\n'] Demo Output: ['BC23\nR23C55\n'] Note: none
```python import math import re def iteracion(num, base): if num % base == 0: residuo = base else: residuo = num % base cociente = (num-residuo)/base return int(cociente), int(residuo) def tranformar_letter(num, base): lista = [] while (True): num, residuo = iteracion(num, base) lista = [residuo]+lista if num < base: lista = [num]+lista break letters = "0ABCDEFGHIJKLMNOPQRSTUVWXYZ" letter = "" for i in lista: if i != 0: letter = letter+letters[i] return letter def tranformar_num(text, base): letters = "0ABCDEFGHIJKLMNOPQRSTUVWXYZ" n = len(text) num = 0 for i in text: a = letters.index(str(i)) num = num+a*(base**(n-1)) n = n-1 return str(num) n = int(input()) data = [] for i in range(n): data.append(input()) for i in data: resultado = re.findall(r'R(\d+)C(\d+)', i) if resultado: print(tranformar_letter(int(resultado[0][1]), 26)+resultado[0][0]) else: resultado = re.findall(r'([A-Za-z]+)(\d+)', i) num = tranformar_num(resultado[0][0], 26) print("R"+resultado[0][1]+"C"+num) ```
3.775467
867
A
Between the Offices
PROGRAMMING
800
[ "implementation" ]
null
null
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane. You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
The first line of input contains single integer *n* (2<=≀<=*n*<=≀<=100)Β β€” the number of days. The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise. You can print each letter in any case (upper or lower).
[ "4\nFSSF\n", "2\nSF\n", "10\nFFFFFFFFFF\n", "10\nSSFFSFFSFF\n" ]
[ "NO\n", "YES\n", "NO\n", "YES\n" ]
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO". In the second example you just flew from Seattle to San Francisco, so the answer is "YES". In the third example you stayed the whole period in San Francisco, so the answer is "NO". In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of Ο€ in binary representation. Not very useful information though.
500
[ { "input": "4\nFSSF", "output": "NO" }, { "input": "2\nSF", "output": "YES" }, { "input": "10\nFFFFFFFFFF", "output": "NO" }, { "input": "10\nSSFFSFFSFF", "output": "YES" }, { "input": "20\nSFSFFFFSSFFFFSSSSFSS", "output": "NO" }, { "input": "20\nSSFFFFFSFFFFFFFFFFFF", "output": "YES" }, { "input": "20\nSSFSFSFSFSFSFSFSSFSF", "output": "YES" }, { "input": "20\nSSSSFSFSSFSFSSSSSSFS", "output": "NO" }, { "input": "100\nFFFSFSFSFSSFSFFSSFFFFFSSSSFSSFFFFSFFFFFSFFFSSFSSSFFFFSSFFSSFSFFSSFSSSFSFFSFSFFSFSFFSSFFSFSSSSFSFSFSS", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFSS", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFSFFFFFFFFFSFSSFFFFFFFFFFFFFFFFFFFFFFSFFSFFFFFSFFFFFFFFSFFFFFFFFFFFFFSFFFFFFFFSFFFFFFFSF", "output": "NO" }, { "input": "100\nSFFSSFFFFFFSSFFFSSFSFFFFFSSFFFSFFFFFFSFSSSFSFSFFFFSFSSFFFFFFFFSFFFFFSFFFFFSSFFFSFFSFSFFFFSFFSFFFFFFF", "output": "YES" }, { "input": "100\nFFFFSSSSSFFSSSFFFSFFFFFSFSSFSFFSFFSSFFSSFSFFFFFSFSFSFSFFFFFFFFFSFSFFSFFFFSFSFFFFFFFFFFFFSFSSFFSSSSFF", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFSSFFFFSFSFFFSFSSSFSSSSSFSSSSFFSSFFFSFSFSSFFFSSSFFSFSFSSFSFSSFSFFFSFFFFFSSFSFFFSSSFSSSFFS", "output": "NO" }, { "input": "100\nFFFSSSFSFSSSSFSSFSFFSSSFFSSFSSFFSSFFSFSSSSFFFSFFFSFSFSSSFSSFSFSFSFFSSSSSFSSSFSFSFFSSFSFSSFFSSFSFFSFS", "output": "NO" }, { "input": "100\nFFSSSSFSSSFSSSSFSSSFFSFSSFFSSFSSSFSSSFFSFFSSSSSSSSSSSSFSSFSSSSFSFFFSSFFFFFFSFSFSSSSSSFSSSFSFSSFSSFSS", "output": "NO" }, { "input": "100\nSSSFFFSSSSFFSSSSSFSSSSFSSSFSSSSSFSSSSSSSSFSFFSSSFFSSFSSSSFFSSSSSSFFSSSSFSSSSSSFSSSFSSSSSSSFSSSSFSSSS", "output": "NO" }, { "input": "100\nFSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSSSSSSFSSSSSSSSSSSSSFSSFSSSSSFSSFSSSSSSSSSFFSSSSSFSFSSSFFSSSSSSSSSSSSS", "output": "NO" }, { "input": "100\nSSSSSSSSSSSSSFSSSSSSSSSSSSFSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSFS", "output": "NO" }, { "input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS", "output": "NO" }, { "input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "YES" }, { "input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFSFFFFFFFFFFFSFSFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "YES" }, { "input": "100\nSFFFFFFFFFFFFSSFFFFSFFFFFFFFFFFFFFFFFFFSFFFSSFFFFSFSFFFSFFFFFFFFFFFFFFFSSFFFFFFFFSSFFFFFFFFFFFFFFSFF", "output": "YES" }, { "input": "100\nSFFSSSFFSFSFSFFFFSSFFFFSFFFFFFFFSFSFFFSFFFSFFFSFFFFSFSFFFFFFFSFFFFFFFFFFSFFSSSFFSSFFFFSFFFFSFFFFSFFF", "output": "YES" }, { "input": "100\nSFFFSFFFFSFFFSSFFFSFSFFFSFFFSSFSFFFFFSFFFFFFFFSFSFSFFSFFFSFSSFSFFFSFSFFSSFSFSSSFFFFFFSSFSFFSFFFFFFFF", "output": "YES" }, { "input": "100\nSSSSFFFFSFFFFFFFSFFFFSFSFFFFSSFFFFFFFFFSFFSSFFFFFFSFSFSSFSSSFFFFFFFSFSFFFSSSFFFFFFFSFFFSSFFFFSSFFFSF", "output": "YES" }, { "input": "100\nSSSFSSFFFSFSSSSFSSFSSSSFSSFFFFFSFFSSSSFFSSSFSSSFSSSSFSSSSFSSSSSSSFSFSSFFFSSFFSFFSSSSFSSFFSFSSFSFFFSF", "output": "YES" }, { "input": "100\nSFFSFSSSSSSSFFSSSFSSSSFSFSSFFFSSSSSSFSSSSFSSFSSSFSSSSSSSFSSFSFFFSSFSSFSFSFSSSSSSSSSSSSFFFFSSSSSFSFFF", "output": "YES" }, { "input": "100\nSSSFSFFSFSFFSSSSSFSSSFSSSFFFSSSSSSSSSFSFSFSSSSFSFSSFFFFFSSSSSSSSSSSSSSSSSSSFFSSSSSFSFSSSSFFSSSSFSSSF", "output": "YES" }, { "input": "100\nSSSFSSSSSSSSSSFSSSSFSSSSSSFSSSSSSFSSSSSSSSSSSSSSFSSSFSSSFSSSSSSSSSSSFSSSSSSFSFSSSSFSSSSSSFSSSSSSSSFF", "output": "YES" }, { "input": "100\nSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFFSSSSSSSSSFSSSSSSSSSSSSSSSSSF", "output": "YES" }, { "input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSF", "output": "YES" }, { "input": "2\nSS", "output": "NO" } ]
1,579,508,359
2,147,483,647
Python 3
OK
TESTS
34
124
307,200
cnt = int(input()) locs = input() pre, sf, fs = locs[0], 0, 0 for i in range(1, len(locs)): if pre != locs[i]: if locs[i] == 'S': fs += 1 elif locs[i] == 'F': sf += 1 pre = locs[i] if sf > fs: print("YES") else: print("NO")
Title: Between the Offices Time Limit: None seconds Memory Limit: None megabytes Problem Description: As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane. You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not. Input Specification: The first line of input contains single integer *n* (2<=≀<=*n*<=≀<=100)Β β€” the number of days. The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence. Output Specification: Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise. You can print each letter in any case (upper or lower). Demo Input: ['4\nFSSF\n', '2\nSF\n', '10\nFFFFFFFFFF\n', '10\nSSFFSFFSFF\n'] Demo Output: ['NO\n', 'YES\n', 'NO\n', 'YES\n'] Note: In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO". In the second example you just flew from Seattle to San Francisco, so the answer is "YES". In the third example you stayed the whole period in San Francisco, so the answer is "NO". In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of Ο€ in binary representation. Not very useful information though.
```python cnt = int(input()) locs = input() pre, sf, fs = locs[0], 0, 0 for i in range(1, len(locs)): if pre != locs[i]: if locs[i] == 'S': fs += 1 elif locs[i] == 'F': sf += 1 pre = locs[i] if sf > fs: print("YES") else: print("NO") ```
3
69
A
Young Physicist
PROGRAMMING
1,000
[ "implementation", "math" ]
A. Young Physicist
2
256
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" β€” thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
The first line contains a positive integer *n* (1<=≀<=*n*<=≀<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≀<=*x**i*,<=*y**i*,<=*z**i*<=≀<=100).
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
[ "3\n4 1 7\n-2 4 -1\n1 -5 -3\n", "3\n3 -1 7\n-5 2 -4\n2 -1 -3\n" ]
[ "NO", "YES" ]
none
500
[ { "input": "3\n4 1 7\n-2 4 -1\n1 -5 -3", "output": "NO" }, { "input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3", "output": "YES" }, { "input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41", "output": "NO" }, { "input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33", "output": "NO" }, { "input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7", "output": "NO" }, { "input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38", "output": "NO" }, { "input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6", "output": "YES" }, { "input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0", "output": "YES" }, { "input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0", "output": "YES" }, { "input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0", "output": "YES" }, { "input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0", "output": "YES" }, { "input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0", "output": "YES" }, { "input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87", "output": "YES" }, { "input": "3\n1 2 3\n3 2 1\n0 0 0", "output": "NO" }, { "input": "2\n5 -23 12\n0 0 0", "output": "NO" }, { "input": "1\n0 0 0", "output": "YES" }, { "input": "1\n1 -2 0", "output": "NO" }, { "input": "2\n-23 77 -86\n23 -77 86", "output": "YES" }, { "input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82", "output": "YES" }, { "input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0", "output": "YES" }, { "input": "3\n96 49 -12\n2 -66 28\n-98 17 -16", "output": "YES" }, { "input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0", "output": "YES" }, { "input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53", "output": "YES" }, { "input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1", "output": "YES" }, { "input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0", "output": "YES" }, { "input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0", "output": "YES" }, { "input": "3\n0 2 -2\n1 -1 3\n-3 0 0", "output": "NO" } ]
1,691,237,674
2,147,483,647
Python 3
OK
TESTS
81
92
0
x=int(input()) a=0 b=0 c=0 for i in range(x): q,w,e=map(int,input().split()) a=a+q b=b+w c=c+e if(a==b==c==0): print("YES") else: print("NO")
Title: Young Physicist Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" β€” thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. Input Specification: The first line contains a positive integer *n* (1<=≀<=*n*<=≀<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≀<=*x**i*,<=*y**i*,<=*z**i*<=≀<=100). Output Specification: Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. Demo Input: ['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n'] Demo Output: ['NO', 'YES'] Note: none
```python x=int(input()) a=0 b=0 c=0 for i in range(x): q,w,e=map(int,input().split()) a=a+q b=b+w c=c+e if(a==b==c==0): print("YES") else: print("NO") ```
3.977
540
A
Combination Lock
PROGRAMMING
800
[ "implementation" ]
null
null
Scrooge McDuck keeps his most treasured savings in a home safe with a combination lock. Each time he wants to put there the treasures that he's earned fair and square, he has to open the lock. The combination lock is represented by *n* rotating disks with digits from 0 to 9 written on them. Scrooge McDuck has to turn some disks so that the combination of digits on the disks forms a secret combination. In one move, he can rotate one disk one digit forwards or backwards. In particular, in one move he can go from digit 0 to digit 9 and vice versa. What minimum number of actions does he need for that?
The first line contains a single integer *n* (1<=≀<=*n*<=≀<=1000)Β β€” the number of disks on the combination lock. The second line contains a string of *n* digitsΒ β€” the original state of the disks. The third line contains a string of *n* digitsΒ β€” Scrooge McDuck's combination that opens the lock.
Print a single integerΒ β€” the minimum number of moves Scrooge McDuck needs to open the lock.
[ "5\n82195\n64723\n" ]
[ "13\n" ]
In the sample he needs 13 moves: - 1 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b8967f65a723782358b93eff9ce69f336817cf70.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 2 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/07fa58573ece0d32c4d555e498d2b24d2f70f36a.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 3 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cc2275d9252aae35a6867c6a5b4ba7596e9a7626.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 4 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b100aea470fcaaab4e9529b234ba0d7875943c10.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 5 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/eb2cbe4324cebca65b85816262a85e473cd65967.png" style="max-width: 100.0%;max-height: 100.0%;"/>
500
[ { "input": "5\n82195\n64723", "output": "13" }, { "input": "12\n102021090898\n010212908089", "output": "16" }, { "input": "1\n8\n1", "output": "3" }, { "input": "2\n83\n57", "output": "7" }, { "input": "10\n0728592530\n1362615763", "output": "27" }, { "input": "100\n4176196363694273682807653052945037727131821799902563705176501742060696655282954944720643131654235909\n3459912084922154505910287499879975659298239371519889866585472674423008837878123067103005344986554746", "output": "245" }, { "input": "1\n8\n1", "output": "3" }, { "input": "2\n83\n57", "output": "7" }, { "input": "3\n607\n684", "output": "5" }, { "input": "4\n0809\n0636", "output": "8" }, { "input": "5\n84284\n08941", "output": "16" }, { "input": "25\n8037856825987124762280548\n9519431339078678836940020", "output": "72" }, { "input": "125\n23269567683904664184142384849516523616863461607751021071772615078579713054027902974007001544768640273491193035874486891541257\n47635110303703399505805044019026243695451609639556649012447370081552870340011971572363458960190590266459684717415349529509024", "output": "305" }, { "input": "5\n84284\n08941", "output": "16" }, { "input": "25\n8037856825987124762285484\n9519431339078678836940202", "output": "74" }, { "input": "125\n23269567689466418414238845152168634610771021717726157879713054270294007001544768647391193035874486891412573389247025830678706\n47635110307339950580504010224954516093956649124473708152870340117152363458960190596659684717415349529090241694059599629136831", "output": "357" }, { "input": "5\n84284\n08941", "output": "16" }, { "input": "25\n8378525987476228048406972\n9194339078883694020217816", "output": "55" }, { "input": "125\n23269576839046618414238484916523616863461607750210717761078579713054027902974007015447686027349193035874486891541257338624472\n47635103037033950580504401926243695451609639556490124437081552870340011971572363489601905026645984717415349529509024169604599", "output": "274" }, { "input": "1\n0\n0", "output": "0" }, { "input": "1\n7\n7", "output": "0" }, { "input": "1\n0\n5", "output": "5" }, { "input": "1\n2\n7", "output": "5" }, { "input": "1\n7\n9", "output": "2" }, { "input": "1\n9\n7", "output": "2" }, { "input": "1\n2\n9", "output": "3" }, { "input": "1\n9\n2", "output": "3" }, { "input": "25\n3164978461316464614169874\n9413979197249127496597357", "output": "66" }, { "input": "4\n9999\n9999", "output": "0" }, { "input": "2\n11\n11", "output": "0" } ]
1,591,796,988
2,147,483,647
Python 3
OK
TESTS
43
124
0
n = int(input()) a = input() b = input() c =0 for i in range(n): d = abs(int(a[i]) - int(b[i])) m = min(d,(10-d)) #print(m) c =c+m print(c)
Title: Combination Lock Time Limit: None seconds Memory Limit: None megabytes Problem Description: Scrooge McDuck keeps his most treasured savings in a home safe with a combination lock. Each time he wants to put there the treasures that he's earned fair and square, he has to open the lock. The combination lock is represented by *n* rotating disks with digits from 0 to 9 written on them. Scrooge McDuck has to turn some disks so that the combination of digits on the disks forms a secret combination. In one move, he can rotate one disk one digit forwards or backwards. In particular, in one move he can go from digit 0 to digit 9 and vice versa. What minimum number of actions does he need for that? Input Specification: The first line contains a single integer *n* (1<=≀<=*n*<=≀<=1000)Β β€” the number of disks on the combination lock. The second line contains a string of *n* digitsΒ β€” the original state of the disks. The third line contains a string of *n* digitsΒ β€” Scrooge McDuck's combination that opens the lock. Output Specification: Print a single integerΒ β€” the minimum number of moves Scrooge McDuck needs to open the lock. Demo Input: ['5\n82195\n64723\n'] Demo Output: ['13\n'] Note: In the sample he needs 13 moves: - 1 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b8967f65a723782358b93eff9ce69f336817cf70.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 2 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/07fa58573ece0d32c4d555e498d2b24d2f70f36a.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 3 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cc2275d9252aae35a6867c6a5b4ba7596e9a7626.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 4 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b100aea470fcaaab4e9529b234ba0d7875943c10.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 5 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/eb2cbe4324cebca65b85816262a85e473cd65967.png" style="max-width: 100.0%;max-height: 100.0%;"/>
```python n = int(input()) a = input() b = input() c =0 for i in range(n): d = abs(int(a[i]) - int(b[i])) m = min(d,(10-d)) #print(m) c =c+m print(c) ```
3
136
A
Presents
PROGRAMMING
800
[ "implementation" ]
null
null
Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there. If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift. Now Petya wants to know for each friend *i* the number of a friend who has given him a gift.
The first line contains one integer *n* (1<=≀<=*n*<=≀<=100) β€” the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* β€” the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves.
Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*.
[ "4\n2 3 4 1\n", "3\n1 3 2\n", "2\n1 2\n" ]
[ "4 1 2 3\n", "1 3 2\n", "1 2\n" ]
none
500
[ { "input": "4\n2 3 4 1", "output": "4 1 2 3" }, { "input": "3\n1 3 2", "output": "1 3 2" }, { "input": "2\n1 2", "output": "1 2" }, { "input": "1\n1", "output": "1" }, { "input": "10\n1 3 2 6 4 5 7 9 8 10", "output": "1 3 2 5 6 4 7 9 8 10" }, { "input": "5\n5 4 3 2 1", "output": "5 4 3 2 1" }, { "input": "20\n2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19" }, { "input": "21\n3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19", "output": "3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19" }, { "input": "10\n3 4 5 6 7 8 9 10 1 2", "output": "9 10 1 2 3 4 5 6 7 8" }, { "input": "8\n1 5 3 7 2 6 4 8", "output": "1 5 3 7 2 6 4 8" }, { "input": "50\n49 22 4 2 20 46 7 32 5 19 48 24 26 15 45 21 44 11 50 43 39 17 31 1 42 34 3 27 36 25 12 30 13 33 28 35 18 6 8 37 38 14 10 9 29 16 40 23 41 47", "output": "24 4 27 3 9 38 7 39 44 43 18 31 33 42 14 46 22 37 10 5 16 2 48 12 30 13 28 35 45 32 23 8 34 26 36 29 40 41 21 47 49 25 20 17 15 6 50 11 1 19" }, { "input": "34\n13 20 33 30 15 11 27 4 8 2 29 25 24 7 3 22 18 10 26 16 5 1 32 9 34 6 12 14 28 19 31 21 23 17", "output": "22 10 15 8 21 26 14 9 24 18 6 27 1 28 5 20 34 17 30 2 32 16 33 13 12 19 7 29 11 4 31 23 3 25" }, { "input": "92\n23 1 6 4 84 54 44 76 63 34 61 20 48 13 28 78 26 46 90 72 24 55 91 89 53 38 82 5 79 92 29 32 15 64 11 88 60 70 7 66 18 59 8 57 19 16 42 21 80 71 62 27 75 86 36 9 83 73 74 50 43 31 56 30 17 33 40 81 49 12 10 41 22 77 25 68 51 2 47 3 58 69 87 67 39 37 35 65 14 45 52 85", "output": "2 78 80 4 28 3 39 43 56 71 35 70 14 89 33 46 65 41 45 12 48 73 1 21 75 17 52 15 31 64 62 32 66 10 87 55 86 26 85 67 72 47 61 7 90 18 79 13 69 60 77 91 25 6 22 63 44 81 42 37 11 51 9 34 88 40 84 76 82 38 50 20 58 59 53 8 74 16 29 49 68 27 57 5 92 54 83 36 24 19 23 30" }, { "input": "49\n30 24 33 48 7 3 17 2 8 35 10 39 23 40 46 32 18 21 26 22 1 16 47 45 41 28 31 6 12 43 27 11 13 37 19 15 44 5 29 42 4 38 20 34 14 9 25 36 49", "output": "21 8 6 41 38 28 5 9 46 11 32 29 33 45 36 22 7 17 35 43 18 20 13 2 47 19 31 26 39 1 27 16 3 44 10 48 34 42 12 14 25 40 30 37 24 15 23 4 49" }, { "input": "12\n3 8 7 4 6 5 2 1 11 9 10 12", "output": "8 7 1 4 6 5 3 2 10 11 9 12" }, { "input": "78\n16 56 36 78 21 14 9 77 26 57 70 61 41 47 18 44 5 31 50 74 65 52 6 39 22 62 67 69 43 7 64 29 24 40 48 51 73 54 72 12 19 34 4 25 55 33 17 35 23 53 10 8 27 32 42 68 20 63 3 2 1 71 58 46 13 30 49 11 37 66 38 60 28 75 15 59 45 76", "output": "61 60 59 43 17 23 30 52 7 51 68 40 65 6 75 1 47 15 41 57 5 25 49 33 44 9 53 73 32 66 18 54 46 42 48 3 69 71 24 34 13 55 29 16 77 64 14 35 67 19 36 22 50 38 45 2 10 63 76 72 12 26 58 31 21 70 27 56 28 11 62 39 37 20 74 78 8 4" }, { "input": "64\n64 57 40 3 15 8 62 18 33 59 51 19 22 13 4 37 47 45 50 35 63 11 58 42 46 21 7 2 41 48 32 23 28 38 17 12 24 27 49 31 60 6 30 25 61 52 26 54 9 14 29 20 44 39 55 10 34 16 5 56 1 36 53 43", "output": "61 28 4 15 59 42 27 6 49 56 22 36 14 50 5 58 35 8 12 52 26 13 32 37 44 47 38 33 51 43 40 31 9 57 20 62 16 34 54 3 29 24 64 53 18 25 17 30 39 19 11 46 63 48 55 60 2 23 10 41 45 7 21 1" }, { "input": "49\n38 20 49 32 14 41 39 45 25 48 40 19 26 43 34 12 10 3 35 42 5 7 46 47 4 2 13 22 16 24 33 15 11 18 29 31 23 9 44 36 6 17 37 1 30 28 8 21 27", "output": "44 26 18 25 21 41 22 47 38 17 33 16 27 5 32 29 42 34 12 2 48 28 37 30 9 13 49 46 35 45 36 4 31 15 19 40 43 1 7 11 6 20 14 39 8 23 24 10 3" }, { "input": "78\n17 50 30 48 33 12 42 4 18 53 76 67 38 3 20 72 51 55 60 63 46 10 57 45 54 32 24 62 8 11 35 44 65 74 58 28 2 6 56 52 39 23 47 49 61 1 66 41 15 77 7 27 78 13 14 34 5 31 37 21 40 16 29 69 59 43 64 36 70 19 25 73 71 75 9 68 26 22", "output": "46 37 14 8 57 38 51 29 75 22 30 6 54 55 49 62 1 9 70 15 60 78 42 27 71 77 52 36 63 3 58 26 5 56 31 68 59 13 41 61 48 7 66 32 24 21 43 4 44 2 17 40 10 25 18 39 23 35 65 19 45 28 20 67 33 47 12 76 64 69 73 16 72 34 74 11 50 53" }, { "input": "29\n14 21 27 1 4 18 10 17 20 23 2 24 7 9 28 22 8 25 12 15 11 6 16 29 3 26 19 5 13", "output": "4 11 25 5 28 22 13 17 14 7 21 19 29 1 20 23 8 6 27 9 2 16 10 12 18 26 3 15 24" }, { "input": "82\n6 1 10 75 28 66 61 81 78 63 17 19 58 34 49 12 67 50 41 44 3 15 59 38 51 72 36 11 46 29 18 64 27 23 13 53 56 68 2 25 47 40 69 54 42 5 60 55 4 16 24 79 57 20 7 73 32 80 76 52 82 37 26 31 65 8 39 62 33 71 30 9 77 43 48 74 70 22 14 45 35 21", "output": "2 39 21 49 46 1 55 66 72 3 28 16 35 79 22 50 11 31 12 54 82 78 34 51 40 63 33 5 30 71 64 57 69 14 81 27 62 24 67 42 19 45 74 20 80 29 41 75 15 18 25 60 36 44 48 37 53 13 23 47 7 68 10 32 65 6 17 38 43 77 70 26 56 76 4 59 73 9 52 58 8 61" }, { "input": "82\n74 18 15 69 71 77 19 26 80 20 66 7 30 82 22 48 21 44 52 65 64 61 35 49 12 8 53 81 54 16 11 9 40 46 13 1 29 58 5 41 55 4 78 60 6 51 56 2 38 36 34 62 63 25 17 67 45 14 32 37 75 79 10 47 27 39 31 68 59 24 50 43 72 70 42 28 76 23 57 3 73 33", "output": "36 48 80 42 39 45 12 26 32 63 31 25 35 58 3 30 55 2 7 10 17 15 78 70 54 8 65 76 37 13 67 59 82 51 23 50 60 49 66 33 40 75 72 18 57 34 64 16 24 71 46 19 27 29 41 47 79 38 69 44 22 52 53 21 20 11 56 68 4 74 5 73 81 1 61 77 6 43 62 9 28 14" }, { "input": "45\n2 32 34 13 3 15 16 33 22 12 31 38 42 14 27 7 36 8 4 19 45 41 5 35 10 11 39 20 29 44 17 9 6 40 37 28 25 21 1 30 24 18 43 26 23", "output": "39 1 5 19 23 33 16 18 32 25 26 10 4 14 6 7 31 42 20 28 38 9 45 41 37 44 15 36 29 40 11 2 8 3 24 17 35 12 27 34 22 13 43 30 21" }, { "input": "45\n4 32 33 39 43 21 22 35 45 7 14 5 16 9 42 31 24 36 17 29 41 25 37 34 27 20 11 44 3 13 19 2 1 10 26 30 38 18 6 8 15 23 40 28 12", "output": "33 32 29 1 12 39 10 40 14 34 27 45 30 11 41 13 19 38 31 26 6 7 42 17 22 35 25 44 20 36 16 2 3 24 8 18 23 37 4 43 21 15 5 28 9" }, { "input": "74\n48 72 40 67 17 4 27 53 11 32 25 9 74 2 41 24 56 22 14 21 33 5 18 55 20 7 29 36 69 13 52 19 38 30 68 59 66 34 63 6 47 45 54 44 62 12 50 71 16 10 8 64 57 73 46 26 49 42 3 23 35 1 61 39 70 60 65 43 15 28 37 51 58 31", "output": "62 14 59 6 22 40 26 51 12 50 9 46 30 19 69 49 5 23 32 25 20 18 60 16 11 56 7 70 27 34 74 10 21 38 61 28 71 33 64 3 15 58 68 44 42 55 41 1 57 47 72 31 8 43 24 17 53 73 36 66 63 45 39 52 67 37 4 35 29 65 48 2 54 13" }, { "input": "47\n9 26 27 10 6 34 28 42 39 22 45 21 11 43 14 47 38 15 40 32 46 1 36 29 17 25 2 23 31 5 24 4 7 8 12 19 16 44 37 20 18 33 30 13 35 41 3", "output": "22 27 47 32 30 5 33 34 1 4 13 35 44 15 18 37 25 41 36 40 12 10 28 31 26 2 3 7 24 43 29 20 42 6 45 23 39 17 9 19 46 8 14 38 11 21 16" }, { "input": "49\n14 38 6 29 9 49 36 43 47 3 44 20 34 15 7 11 1 28 12 40 16 37 31 10 42 41 33 21 18 30 5 27 17 35 25 26 45 19 2 13 23 32 4 22 46 48 24 39 8", "output": "17 39 10 43 31 3 15 49 5 24 16 19 40 1 14 21 33 29 38 12 28 44 41 47 35 36 32 18 4 30 23 42 27 13 34 7 22 2 48 20 26 25 8 11 37 45 9 46 6" }, { "input": "100\n78 56 31 91 90 95 16 65 58 77 37 89 33 61 10 76 62 47 35 67 69 7 63 83 22 25 49 8 12 30 39 44 57 64 48 42 32 11 70 43 55 50 99 24 85 73 45 14 54 21 98 84 74 2 26 18 9 36 80 53 75 46 66 86 59 93 87 68 94 13 72 28 79 88 92 29 52 82 34 97 19 38 1 41 27 4 40 5 96 100 51 6 20 23 81 15 17 3 60 71", "output": "83 54 98 86 88 92 22 28 57 15 38 29 70 48 96 7 97 56 81 93 50 25 94 44 26 55 85 72 76 30 3 37 13 79 19 58 11 82 31 87 84 36 40 32 47 62 18 35 27 42 91 77 60 49 41 2 33 9 65 99 14 17 23 34 8 63 20 68 21 39 100 71 46 53 61 16 10 1 73 59 95 78 24 52 45 64 67 74 12 5 4 75 66 69 6 89 80 51 43 90" }, { "input": "22\n12 8 11 2 16 7 13 6 22 21 20 10 4 14 18 1 5 15 3 19 17 9", "output": "16 4 19 13 17 8 6 2 22 12 3 1 7 14 18 5 21 15 20 11 10 9" }, { "input": "72\n16 11 49 51 3 27 60 55 23 40 66 7 53 70 13 5 15 32 18 72 33 30 8 31 46 12 28 67 25 38 50 22 69 34 71 52 58 39 24 35 42 9 41 26 62 1 63 65 36 64 68 61 37 14 45 47 6 57 54 20 17 2 56 59 29 10 4 48 21 43 19 44", "output": "46 62 5 67 16 57 12 23 42 66 2 26 15 54 17 1 61 19 71 60 69 32 9 39 29 44 6 27 65 22 24 18 21 34 40 49 53 30 38 10 43 41 70 72 55 25 56 68 3 31 4 36 13 59 8 63 58 37 64 7 52 45 47 50 48 11 28 51 33 14 35 20" }, { "input": "63\n21 56 11 10 62 24 20 42 28 52 38 2 37 43 48 22 7 8 40 14 13 46 53 1 23 4 60 63 51 36 25 12 39 32 49 16 58 44 31 61 33 50 55 54 45 6 47 41 9 57 30 29 26 18 19 27 15 34 3 35 59 5 17", "output": "24 12 59 26 62 46 17 18 49 4 3 32 21 20 57 36 63 54 55 7 1 16 25 6 31 53 56 9 52 51 39 34 41 58 60 30 13 11 33 19 48 8 14 38 45 22 47 15 35 42 29 10 23 44 43 2 50 37 61 27 40 5 28" }, { "input": "18\n2 16 8 4 18 12 3 6 5 9 10 15 11 17 14 13 1 7", "output": "17 1 7 4 9 8 18 3 10 11 13 6 16 15 12 2 14 5" }, { "input": "47\n6 9 10 41 25 3 4 37 20 1 36 22 29 27 11 24 43 31 12 17 34 42 38 39 13 2 7 21 18 5 15 35 44 26 33 46 19 40 30 14 28 23 47 32 45 8 16", "output": "10 26 6 7 30 1 27 46 2 3 15 19 25 40 31 47 20 29 37 9 28 12 42 16 5 34 14 41 13 39 18 44 35 21 32 11 8 23 24 38 4 22 17 33 45 36 43" }, { "input": "96\n41 91 48 88 29 57 1 19 44 43 37 5 10 75 25 63 30 78 76 53 8 92 18 70 39 17 49 60 9 16 3 34 86 59 23 79 55 45 72 51 28 33 96 40 26 54 6 32 89 61 85 74 7 82 52 31 64 66 94 95 11 22 2 73 35 13 42 71 14 47 84 69 50 67 58 12 77 46 38 68 15 36 20 93 27 90 83 56 87 4 21 24 81 62 80 65", "output": "7 63 31 90 12 47 53 21 29 13 61 76 66 69 81 30 26 23 8 83 91 62 35 92 15 45 85 41 5 17 56 48 42 32 65 82 11 79 25 44 1 67 10 9 38 78 70 3 27 73 40 55 20 46 37 88 6 75 34 28 50 94 16 57 96 58 74 80 72 24 68 39 64 52 14 19 77 18 36 95 93 54 87 71 51 33 89 4 49 86 2 22 84 59 60 43" }, { "input": "73\n67 24 39 22 23 20 48 34 42 40 19 70 65 69 64 21 53 11 59 15 26 10 30 33 72 29 55 25 56 71 8 9 57 49 41 61 13 12 6 27 66 36 47 50 73 60 2 37 7 4 51 17 1 46 14 62 35 3 45 63 43 58 54 32 31 5 28 44 18 52 68 38 16", "output": "53 47 58 50 66 39 49 31 32 22 18 38 37 55 20 73 52 69 11 6 16 4 5 2 28 21 40 67 26 23 65 64 24 8 57 42 48 72 3 10 35 9 61 68 59 54 43 7 34 44 51 70 17 63 27 29 33 62 19 46 36 56 60 15 13 41 1 71 14 12 30 25 45" }, { "input": "81\n25 2 78 40 12 80 69 13 49 43 17 33 23 54 32 61 77 66 27 71 24 26 42 55 60 9 5 30 7 37 45 63 53 11 38 44 68 34 28 52 67 22 57 46 47 50 8 16 79 62 4 36 20 14 73 64 6 76 35 74 58 10 29 81 59 31 19 1 75 39 70 18 41 21 72 65 3 48 15 56 51", "output": "68 2 77 51 27 57 29 47 26 62 34 5 8 54 79 48 11 72 67 53 74 42 13 21 1 22 19 39 63 28 66 15 12 38 59 52 30 35 70 4 73 23 10 36 31 44 45 78 9 46 81 40 33 14 24 80 43 61 65 25 16 50 32 56 76 18 41 37 7 71 20 75 55 60 69 58 17 3 49 6 64" }, { "input": "12\n12 3 1 5 11 6 7 10 2 8 9 4", "output": "3 9 2 12 4 6 7 10 11 8 5 1" }, { "input": "47\n7 21 41 18 40 31 12 28 24 14 43 23 33 10 19 38 26 8 34 15 29 44 5 13 39 25 3 27 20 42 35 9 2 1 30 46 36 32 4 22 37 45 6 47 11 16 17", "output": "34 33 27 39 23 43 1 18 32 14 45 7 24 10 20 46 47 4 15 29 2 40 12 9 26 17 28 8 21 35 6 38 13 19 31 37 41 16 25 5 3 30 11 22 42 36 44" }, { "input": "8\n1 3 5 2 4 8 6 7", "output": "1 4 2 5 3 7 8 6" }, { "input": "38\n28 8 2 33 20 32 26 29 23 31 15 38 11 37 18 21 22 19 4 34 1 35 16 7 17 6 27 30 36 12 9 24 25 13 5 3 10 14", "output": "21 3 36 19 35 26 24 2 31 37 13 30 34 38 11 23 25 15 18 5 16 17 9 32 33 7 27 1 8 28 10 6 4 20 22 29 14 12" }, { "input": "10\n2 9 4 6 10 1 7 5 3 8", "output": "6 1 9 3 8 4 7 10 2 5" }, { "input": "23\n20 11 15 1 5 12 23 9 2 22 13 19 16 14 7 4 8 21 6 17 18 10 3", "output": "4 9 23 16 5 19 15 17 8 22 2 6 11 14 3 13 20 21 12 1 18 10 7" }, { "input": "10\n2 4 9 3 6 8 10 5 1 7", "output": "9 1 4 2 8 5 10 6 3 7" }, { "input": "55\n9 48 23 49 11 24 4 22 34 32 17 45 39 13 14 21 19 25 2 31 37 7 55 36 20 51 5 12 54 10 35 40 43 1 46 18 53 41 38 26 29 50 3 42 52 27 8 28 47 33 6 16 30 44 15", "output": "34 19 43 7 27 51 22 47 1 30 5 28 14 15 55 52 11 36 17 25 16 8 3 6 18 40 46 48 41 53 20 10 50 9 31 24 21 39 13 32 38 44 33 54 12 35 49 2 4 42 26 45 37 29 23" }, { "input": "58\n49 13 12 54 2 38 56 11 33 25 26 19 28 8 23 41 20 36 46 55 15 35 9 7 32 37 58 6 3 14 47 31 40 30 53 44 4 50 29 34 10 43 39 57 5 22 27 45 51 42 24 16 18 21 52 17 48 1", "output": "58 5 29 37 45 28 24 14 23 41 8 3 2 30 21 52 56 53 12 17 54 46 15 51 10 11 47 13 39 34 32 25 9 40 22 18 26 6 43 33 16 50 42 36 48 19 31 57 1 38 49 55 35 4 20 7 44 27" }, { "input": "34\n20 25 2 3 33 29 1 16 14 7 21 9 32 31 6 26 22 4 27 23 24 10 34 12 19 15 5 18 28 17 13 8 11 30", "output": "7 3 4 18 27 15 10 32 12 22 33 24 31 9 26 8 30 28 25 1 11 17 20 21 2 16 19 29 6 34 14 13 5 23" }, { "input": "53\n47 29 46 25 23 13 7 31 33 4 38 11 35 16 42 14 15 43 34 39 28 18 6 45 30 1 40 20 2 37 5 32 24 12 44 26 27 3 19 51 36 21 22 9 10 50 41 48 49 53 8 17 52", "output": "26 29 38 10 31 23 7 51 44 45 12 34 6 16 17 14 52 22 39 28 42 43 5 33 4 36 37 21 2 25 8 32 9 19 13 41 30 11 20 27 47 15 18 35 24 3 1 48 49 46 40 53 50" }, { "input": "99\n77 87 90 48 53 38 68 6 28 57 35 82 63 71 60 41 3 12 86 65 10 59 22 67 33 74 93 27 24 1 61 43 25 4 51 52 15 88 9 31 30 42 89 49 23 21 29 32 46 73 37 16 5 69 56 26 92 64 20 54 75 14 98 13 94 2 95 7 36 66 58 8 50 78 84 45 11 96 76 62 97 80 40 39 47 85 34 79 83 17 91 72 19 44 70 81 55 99 18", "output": "30 66 17 34 53 8 68 72 39 21 77 18 64 62 37 52 90 99 93 59 46 23 45 29 33 56 28 9 47 41 40 48 25 87 11 69 51 6 84 83 16 42 32 94 76 49 85 4 44 73 35 36 5 60 97 55 10 71 22 15 31 80 13 58 20 70 24 7 54 95 14 92 50 26 61 79 1 74 88 82 96 12 89 75 86 19 2 38 43 3 91 57 27 65 67 78 81 63 98" }, { "input": "32\n17 29 2 6 30 8 26 7 1 27 10 9 13 24 31 21 15 19 22 18 4 11 25 28 32 3 23 12 5 14 20 16", "output": "9 3 26 21 29 4 8 6 12 11 22 28 13 30 17 32 1 20 18 31 16 19 27 14 23 7 10 24 2 5 15 25" }, { "input": "65\n18 40 1 60 17 19 4 6 12 49 28 58 2 25 13 14 64 56 61 34 62 30 59 51 26 8 33 63 36 48 46 7 43 21 31 27 11 44 29 5 32 23 35 9 53 57 52 50 15 38 42 3 54 65 55 41 20 24 22 47 45 10 39 16 37", "output": "3 13 52 7 40 8 32 26 44 62 37 9 15 16 49 64 5 1 6 57 34 59 42 58 14 25 36 11 39 22 35 41 27 20 43 29 65 50 63 2 56 51 33 38 61 31 60 30 10 48 24 47 45 53 55 18 46 12 23 4 19 21 28 17 54" }, { "input": "71\n35 50 55 58 25 32 26 40 63 34 44 53 24 18 37 7 64 27 56 65 1 19 2 43 42 14 57 47 22 13 59 61 39 67 30 45 54 38 33 48 6 5 3 69 36 21 41 4 16 46 20 17 15 12 10 70 68 23 60 31 52 29 66 28 51 49 62 11 8 9 71", "output": "21 23 43 48 42 41 16 69 70 55 68 54 30 26 53 49 52 14 22 51 46 29 58 13 5 7 18 64 62 35 60 6 39 10 1 45 15 38 33 8 47 25 24 11 36 50 28 40 66 2 65 61 12 37 3 19 27 4 31 59 32 67 9 17 20 63 34 57 44 56 71" }, { "input": "74\n33 8 42 63 64 61 31 74 11 50 68 14 36 25 57 30 7 44 21 15 6 9 23 59 46 3 73 16 62 51 40 60 41 54 5 39 35 28 48 4 58 12 66 69 13 26 71 1 24 19 29 52 37 2 20 43 18 72 17 56 34 38 65 67 27 10 47 70 53 32 45 55 49 22", "output": "48 54 26 40 35 21 17 2 22 66 9 42 45 12 20 28 59 57 50 55 19 74 23 49 14 46 65 38 51 16 7 70 1 61 37 13 53 62 36 31 33 3 56 18 71 25 67 39 73 10 30 52 69 34 72 60 15 41 24 32 6 29 4 5 63 43 64 11 44 68 47 58 27 8" }, { "input": "96\n78 10 82 46 38 91 77 69 2 27 58 80 79 44 59 41 6 31 76 11 42 48 51 37 19 87 43 25 52 32 1 39 63 29 21 65 53 74 92 16 15 95 90 83 30 73 71 5 50 17 96 33 86 60 67 64 20 26 61 40 55 88 94 93 9 72 47 57 14 45 22 3 54 68 13 24 4 7 56 81 89 70 49 8 84 28 18 62 35 36 75 23 66 85 34 12", "output": "31 9 72 77 48 17 78 84 65 2 20 96 75 69 41 40 50 87 25 57 35 71 92 76 28 58 10 86 34 45 18 30 52 95 89 90 24 5 32 60 16 21 27 14 70 4 67 22 83 49 23 29 37 73 61 79 68 11 15 54 59 88 33 56 36 93 55 74 8 82 47 66 46 38 91 19 7 1 13 12 80 3 44 85 94 53 26 62 81 43 6 39 64 63 42 51" }, { "input": "7\n2 1 5 7 3 4 6", "output": "2 1 5 6 3 7 4" }, { "input": "51\n8 33 37 2 16 22 24 30 4 9 5 15 27 3 18 39 31 26 10 17 46 41 25 14 6 1 29 48 36 20 51 49 21 43 19 13 38 50 47 34 11 23 28 12 42 7 32 40 44 45 35", "output": "26 4 14 9 11 25 46 1 10 19 41 44 36 24 12 5 20 15 35 30 33 6 42 7 23 18 13 43 27 8 17 47 2 40 51 29 3 37 16 48 22 45 34 49 50 21 39 28 32 38 31" }, { "input": "27\n12 14 7 3 20 21 25 13 22 15 23 4 2 24 10 17 19 8 26 11 27 18 9 5 6 1 16", "output": "26 13 4 12 24 25 3 18 23 15 20 1 8 2 10 27 16 22 17 5 6 9 11 14 7 19 21" }, { "input": "71\n51 13 20 48 54 23 24 64 14 62 71 67 57 53 3 30 55 43 33 25 39 40 66 6 46 18 5 19 61 16 32 68 70 41 60 44 29 49 27 69 50 38 10 17 45 56 9 21 26 63 28 35 7 59 1 65 2 15 8 11 12 34 37 47 58 22 31 4 36 42 52", "output": "55 57 15 68 27 24 53 59 47 43 60 61 2 9 58 30 44 26 28 3 48 66 6 7 20 49 39 51 37 16 67 31 19 62 52 69 63 42 21 22 34 70 18 36 45 25 64 4 38 41 1 71 14 5 17 46 13 65 54 35 29 10 50 8 56 23 12 32 40 33 11" }, { "input": "9\n8 5 2 6 1 9 4 7 3", "output": "5 3 9 7 2 4 8 1 6" }, { "input": "29\n10 24 11 5 26 25 2 9 22 15 8 14 29 21 4 1 23 17 3 12 13 16 18 28 19 20 7 6 27", "output": "16 7 19 15 4 28 27 11 8 1 3 20 21 12 10 22 18 23 25 26 14 9 17 2 6 5 29 24 13" }, { "input": "60\n39 25 42 4 55 60 16 18 47 1 11 40 7 50 19 35 49 54 12 3 30 38 2 58 17 26 45 6 33 43 37 32 52 36 15 23 27 59 24 20 28 14 8 9 13 29 44 46 41 21 5 48 51 22 31 56 57 53 10 34", "output": "10 23 20 4 51 28 13 43 44 59 11 19 45 42 35 7 25 8 15 40 50 54 36 39 2 26 37 41 46 21 55 32 29 60 16 34 31 22 1 12 49 3 30 47 27 48 9 52 17 14 53 33 58 18 5 56 57 24 38 6" }, { "input": "50\n37 45 22 5 12 21 28 24 18 47 20 25 8 50 14 2 34 43 11 16 49 41 48 1 19 31 39 46 32 23 15 42 3 35 38 30 44 26 10 9 40 36 7 17 33 4 27 6 13 29", "output": "24 16 33 46 4 48 43 13 40 39 19 5 49 15 31 20 44 9 25 11 6 3 30 8 12 38 47 7 50 36 26 29 45 17 34 42 1 35 27 41 22 32 18 37 2 28 10 23 21 14" }, { "input": "30\n8 29 28 16 17 25 27 15 21 11 6 20 2 13 1 30 5 4 24 10 14 3 23 18 26 9 12 22 19 7", "output": "15 13 22 18 17 11 30 1 26 20 10 27 14 21 8 4 5 24 29 12 9 28 23 19 6 25 7 3 2 16" }, { "input": "46\n15 2 44 43 38 19 31 42 4 37 29 30 24 45 27 41 8 20 33 7 35 3 18 46 36 26 1 28 21 40 16 22 32 11 14 13 12 9 25 39 10 6 23 17 5 34", "output": "27 2 22 9 45 42 20 17 38 41 34 37 36 35 1 31 44 23 6 18 29 32 43 13 39 26 15 28 11 12 7 33 19 46 21 25 10 5 40 30 16 8 4 3 14 24" }, { "input": "9\n4 8 6 5 3 9 2 7 1", "output": "9 7 5 1 4 3 8 2 6" }, { "input": "46\n31 30 33 23 45 7 36 8 11 3 32 39 41 20 1 28 6 27 18 24 17 5 16 37 26 13 22 14 2 38 15 46 9 4 19 21 12 44 10 35 25 34 42 43 40 29", "output": "15 29 10 34 22 17 6 8 33 39 9 37 26 28 31 23 21 19 35 14 36 27 4 20 41 25 18 16 46 2 1 11 3 42 40 7 24 30 12 45 13 43 44 38 5 32" }, { "input": "66\n27 12 37 48 46 21 34 58 38 28 66 2 64 32 44 31 13 36 40 15 19 11 22 5 30 29 6 7 61 39 20 42 23 54 51 33 50 9 60 8 57 45 49 10 62 41 59 3 55 63 52 24 25 26 43 56 65 4 16 14 1 35 18 17 53 47", "output": "61 12 48 58 24 27 28 40 38 44 22 2 17 60 20 59 64 63 21 31 6 23 33 52 53 54 1 10 26 25 16 14 36 7 62 18 3 9 30 19 46 32 55 15 42 5 66 4 43 37 35 51 65 34 49 56 41 8 47 39 29 45 50 13 57 11" }, { "input": "13\n3 12 9 2 8 5 13 4 11 1 10 7 6", "output": "10 4 1 8 6 13 12 5 3 11 9 2 7" }, { "input": "80\n21 25 56 50 20 61 7 74 51 69 8 2 46 57 45 71 14 52 17 43 9 30 70 78 31 10 38 13 23 15 37 79 6 16 77 73 80 4 49 48 18 28 26 58 33 41 64 22 54 72 59 60 40 63 53 27 1 5 75 67 62 34 19 39 68 65 44 55 3 32 11 42 76 12 35 47 66 36 24 29", "output": "57 12 69 38 58 33 7 11 21 26 71 74 28 17 30 34 19 41 63 5 1 48 29 79 2 43 56 42 80 22 25 70 45 62 75 78 31 27 64 53 46 72 20 67 15 13 76 40 39 4 9 18 55 49 68 3 14 44 51 52 6 61 54 47 66 77 60 65 10 23 16 50 36 8 59 73 35 24 32 37" }, { "input": "63\n9 49 53 25 40 46 43 51 54 22 58 16 23 26 10 47 5 27 2 8 61 59 19 35 63 56 28 20 34 4 62 38 6 55 36 31 57 15 29 33 1 48 50 37 7 30 18 42 32 52 12 41 14 21 45 11 24 17 39 13 44 60 3", "output": "41 19 63 30 17 33 45 20 1 15 56 51 60 53 38 12 58 47 23 28 54 10 13 57 4 14 18 27 39 46 36 49 40 29 24 35 44 32 59 5 52 48 7 61 55 6 16 42 2 43 8 50 3 9 34 26 37 11 22 62 21 31 25" }, { "input": "26\n11 4 19 13 17 9 2 24 6 5 22 23 14 15 3 25 16 8 18 10 21 1 12 26 7 20", "output": "22 7 15 2 10 9 25 18 6 20 1 23 4 13 14 17 5 19 3 26 21 11 12 8 16 24" }, { "input": "69\n40 22 11 66 4 27 31 29 64 53 37 55 51 2 7 36 18 52 6 1 30 21 17 20 14 9 59 62 49 68 3 50 65 57 44 5 67 46 33 13 34 15 24 48 63 58 38 25 41 35 16 54 32 10 60 61 39 12 69 8 23 45 26 47 56 43 28 19 42", "output": "20 14 31 5 36 19 15 60 26 54 3 58 40 25 42 51 23 17 68 24 22 2 61 43 48 63 6 67 8 21 7 53 39 41 50 16 11 47 57 1 49 69 66 35 62 38 64 44 29 32 13 18 10 52 12 65 34 46 27 55 56 28 45 9 33 4 37 30 59" }, { "input": "6\n4 3 6 5 1 2", "output": "5 6 2 1 4 3" }, { "input": "9\n7 8 5 3 1 4 2 9 6", "output": "5 7 4 6 3 9 1 2 8" }, { "input": "41\n27 24 16 30 25 8 32 2 26 20 39 33 41 22 40 14 36 9 28 4 34 11 31 23 19 18 17 35 3 10 6 13 5 15 29 38 7 21 1 12 37", "output": "39 8 29 20 33 31 37 6 18 30 22 40 32 16 34 3 27 26 25 10 38 14 24 2 5 9 1 19 35 4 23 7 12 21 28 17 41 36 11 15 13" }, { "input": "1\n1", "output": "1" }, { "input": "20\n2 6 4 18 7 10 17 13 16 8 14 9 20 5 19 12 1 3 15 11", "output": "17 1 18 3 14 2 5 10 12 6 20 16 8 11 19 9 7 4 15 13" }, { "input": "2\n2 1", "output": "2 1" }, { "input": "60\n2 4 31 51 11 7 34 20 3 14 18 23 48 54 15 36 38 60 49 40 5 33 41 26 55 58 10 8 13 9 27 30 37 1 21 59 44 57 35 19 46 43 42 45 12 22 39 32 24 16 6 56 53 52 25 17 47 29 50 28", "output": "34 1 9 2 21 51 6 28 30 27 5 45 29 10 15 50 56 11 40 8 35 46 12 49 55 24 31 60 58 32 3 48 22 7 39 16 33 17 47 20 23 43 42 37 44 41 57 13 19 59 4 54 53 14 25 52 38 26 36 18" }, { "input": "14\n14 6 3 12 11 2 7 1 10 9 8 5 4 13", "output": "8 6 3 13 12 2 7 11 10 9 5 4 14 1" }, { "input": "81\n13 43 79 8 7 21 73 46 63 4 62 78 56 11 70 68 61 53 60 49 16 27 59 47 69 5 22 44 77 57 52 48 1 9 72 81 28 55 58 33 51 18 31 17 41 20 42 3 32 54 19 2 75 34 64 10 65 50 30 29 67 12 71 66 74 15 26 23 6 38 25 35 37 24 80 76 40 45 39 36 14", "output": "33 52 48 10 26 69 5 4 34 56 14 62 1 81 66 21 44 42 51 46 6 27 68 74 71 67 22 37 60 59 43 49 40 54 72 80 73 70 79 77 45 47 2 28 78 8 24 32 20 58 41 31 18 50 38 13 30 39 23 19 17 11 9 55 57 64 61 16 25 15 63 35 7 65 53 76 29 12 3 75 36" }, { "input": "42\n41 11 10 8 21 37 32 19 31 25 1 15 36 5 6 27 4 3 13 7 16 17 2 23 34 24 38 28 12 20 30 42 18 26 39 35 33 40 9 14 22 29", "output": "11 23 18 17 14 15 20 4 39 3 2 29 19 40 12 21 22 33 8 30 5 41 24 26 10 34 16 28 42 31 9 7 37 25 36 13 6 27 35 38 1 32" }, { "input": "97\n20 6 76 42 4 18 35 59 39 63 27 7 66 47 61 52 15 36 88 93 19 33 10 92 1 34 46 86 78 57 51 94 77 29 26 73 41 2 58 97 43 65 17 74 21 49 25 3 91 82 95 12 96 13 84 90 69 24 72 37 16 55 54 71 64 62 48 89 11 70 80 67 30 40 44 85 53 83 79 9 56 45 75 87 22 14 81 68 8 38 60 50 28 23 31 32 5", "output": "25 38 48 5 97 2 12 89 80 23 69 52 54 86 17 61 43 6 21 1 45 85 94 58 47 35 11 93 34 73 95 96 22 26 7 18 60 90 9 74 37 4 41 75 82 27 14 67 46 92 31 16 77 63 62 81 30 39 8 91 15 66 10 65 42 13 72 88 57 70 64 59 36 44 83 3 33 29 79 71 87 50 78 55 76 28 84 19 68 56 49 24 20 32 51 53 40" }, { "input": "62\n15 27 46 6 8 51 14 56 23 48 42 49 52 22 20 31 29 12 47 3 62 34 37 35 32 57 19 25 5 60 61 38 18 10 11 55 45 53 17 30 9 36 4 50 41 16 44 28 40 59 24 1 13 39 26 7 33 58 2 43 21 54", "output": "52 59 20 43 29 4 56 5 41 34 35 18 53 7 1 46 39 33 27 15 61 14 9 51 28 55 2 48 17 40 16 25 57 22 24 42 23 32 54 49 45 11 60 47 37 3 19 10 12 44 6 13 38 62 36 8 26 58 50 30 31 21" }, { "input": "61\n35 27 4 61 52 32 41 46 14 37 17 54 55 31 11 26 44 49 15 30 9 50 45 39 7 38 53 3 58 40 13 56 18 19 28 6 43 5 21 42 20 34 2 25 36 12 33 57 16 60 1 8 59 10 22 23 24 48 51 47 29", "output": "51 43 28 3 38 36 25 52 21 54 15 46 31 9 19 49 11 33 34 41 39 55 56 57 44 16 2 35 61 20 14 6 47 42 1 45 10 26 24 30 7 40 37 17 23 8 60 58 18 22 59 5 27 12 13 32 48 29 53 50 4" }, { "input": "59\n31 26 36 15 17 19 10 53 11 34 13 46 55 9 44 7 8 37 32 52 47 25 51 22 35 39 41 4 43 24 5 27 20 57 6 38 3 28 21 40 50 18 14 56 33 45 12 2 49 59 54 29 16 48 42 58 1 30 23", "output": "57 48 37 28 31 35 16 17 14 7 9 47 11 43 4 53 5 42 6 33 39 24 59 30 22 2 32 38 52 58 1 19 45 10 25 3 18 36 26 40 27 55 29 15 46 12 21 54 49 41 23 20 8 51 13 44 34 56 50" }, { "input": "10\n2 10 7 4 1 5 8 6 3 9", "output": "5 1 9 4 6 8 3 7 10 2" }, { "input": "14\n14 2 1 8 6 12 11 10 9 7 3 4 5 13", "output": "3 2 11 12 13 5 10 4 9 8 7 6 14 1" }, { "input": "43\n28 38 15 14 31 42 27 30 19 33 43 26 22 29 18 32 3 13 1 8 35 34 4 12 11 17 41 21 5 25 39 37 20 23 7 24 16 10 40 9 6 36 2", "output": "19 43 17 23 29 41 35 20 40 38 25 24 18 4 3 37 26 15 9 33 28 13 34 36 30 12 7 1 14 8 5 16 10 22 21 42 32 2 31 39 27 6 11" }, { "input": "86\n39 11 20 31 28 76 29 64 35 21 41 71 12 82 5 37 80 73 38 26 79 75 23 15 59 45 47 6 3 62 50 49 51 22 2 65 86 60 70 42 74 17 1 30 55 44 8 66 81 27 57 77 43 13 54 32 72 46 48 56 14 34 78 52 36 85 24 19 69 83 25 61 7 4 84 33 63 58 18 40 68 10 67 9 16 53", "output": "43 35 29 74 15 28 73 47 84 82 2 13 54 61 24 85 42 79 68 3 10 34 23 67 71 20 50 5 7 44 4 56 76 62 9 65 16 19 1 80 11 40 53 46 26 58 27 59 32 31 33 64 86 55 45 60 51 78 25 38 72 30 77 8 36 48 83 81 69 39 12 57 18 41 22 6 52 63 21 17 49 14 70 75 66 37" }, { "input": "99\n65 78 56 98 33 24 61 40 29 93 1 64 57 22 25 52 67 95 50 3 31 15 90 68 71 83 38 36 6 46 89 26 4 87 14 88 72 37 23 43 63 12 80 96 5 34 73 86 9 48 92 62 99 10 16 20 66 27 28 2 82 70 30 94 49 8 84 69 18 60 58 59 44 39 21 7 91 76 54 19 75 85 74 47 55 32 97 77 51 13 35 79 45 42 11 41 17 81 53", "output": "11 60 20 33 45 29 76 66 49 54 95 42 90 35 22 55 97 69 80 56 75 14 39 6 15 32 58 59 9 63 21 86 5 46 91 28 38 27 74 8 96 94 40 73 93 30 84 50 65 19 89 16 99 79 85 3 13 71 72 70 7 52 41 12 1 57 17 24 68 62 25 37 47 83 81 78 88 2 92 43 98 61 26 67 82 48 34 36 31 23 77 51 10 64 18 44 87 4 53" }, { "input": "100\n42 23 48 88 36 6 18 70 96 1 34 40 46 22 39 55 85 93 45 67 71 75 59 9 21 3 86 63 65 68 20 38 73 31 84 90 50 51 56 95 72 33 49 19 83 76 54 74 100 30 17 98 15 94 4 97 5 99 81 27 92 32 89 12 13 91 87 29 60 11 52 43 35 58 10 25 16 80 28 2 44 61 8 82 66 69 41 24 57 62 78 37 79 77 53 7 14 47 26 64", "output": "10 80 26 55 57 6 96 83 24 75 70 64 65 97 53 77 51 7 44 31 25 14 2 88 76 99 60 79 68 50 34 62 42 11 73 5 92 32 15 12 87 1 72 81 19 13 98 3 43 37 38 71 95 47 16 39 89 74 23 69 82 90 28 100 29 85 20 30 86 8 21 41 33 48 22 46 94 91 93 78 59 84 45 35 17 27 67 4 63 36 66 61 18 54 40 9 56 52 58 49" }, { "input": "99\n8 68 94 75 71 60 57 58 6 11 5 48 65 41 49 12 46 72 95 59 13 70 74 7 84 62 17 36 55 76 38 79 2 85 23 10 32 99 87 50 83 28 54 91 53 51 1 3 97 81 21 89 93 78 61 26 82 96 4 98 25 40 31 44 24 47 30 52 14 16 39 27 9 29 45 18 67 63 37 43 90 66 19 69 88 22 92 77 34 42 73 80 56 64 20 35 15 33 86", "output": "47 33 48 59 11 9 24 1 73 36 10 16 21 69 97 70 27 76 83 95 51 86 35 65 61 56 72 42 74 67 63 37 98 89 96 28 79 31 71 62 14 90 80 64 75 17 66 12 15 40 46 68 45 43 29 93 7 8 20 6 55 26 78 94 13 82 77 2 84 22 5 18 91 23 4 30 88 54 32 92 50 57 41 25 34 99 39 85 52 81 44 87 53 3 19 58 49 60 38" }, { "input": "99\n12 99 88 13 7 19 74 47 23 90 16 29 26 11 58 60 64 98 37 18 82 67 72 46 51 85 17 92 87 20 77 36 78 71 57 35 80 54 73 15 14 62 97 45 31 79 94 56 76 96 28 63 8 44 38 86 49 2 52 66 61 59 10 43 55 50 22 34 83 53 95 40 81 21 30 42 27 3 5 41 1 70 69 25 93 48 65 6 24 89 91 33 39 68 9 4 32 84 75", "output": "81 58 78 96 79 88 5 53 95 63 14 1 4 41 40 11 27 20 6 30 74 67 9 89 84 13 77 51 12 75 45 97 92 68 36 32 19 55 93 72 80 76 64 54 44 24 8 86 57 66 25 59 70 38 65 48 35 15 62 16 61 42 52 17 87 60 22 94 83 82 34 23 39 7 99 49 31 33 46 37 73 21 69 98 26 56 29 3 90 10 91 28 85 47 71 50 43 18 2" }, { "input": "99\n20 79 26 75 99 69 98 47 93 62 18 42 43 38 90 66 67 8 13 84 76 58 81 60 64 46 56 23 78 17 86 36 19 52 85 39 48 27 96 49 37 95 5 31 10 24 12 1 80 35 92 33 16 68 57 54 32 29 45 88 72 77 4 87 97 89 59 3 21 22 61 94 83 15 44 34 70 91 55 9 51 50 73 11 14 6 40 7 63 25 2 82 41 65 28 74 71 30 53", "output": "48 91 68 63 43 86 88 18 80 45 84 47 19 85 74 53 30 11 33 1 69 70 28 46 90 3 38 95 58 98 44 57 52 76 50 32 41 14 36 87 93 12 13 75 59 26 8 37 40 82 81 34 99 56 79 27 55 22 67 24 71 10 89 25 94 16 17 54 6 77 97 61 83 96 4 21 62 29 2 49 23 92 73 20 35 31 64 60 66 15 78 51 9 72 42 39 65 7 5" }, { "input": "99\n74 20 9 1 60 85 65 13 4 25 40 99 5 53 64 3 36 31 73 44 55 50 45 63 98 51 68 6 47 37 71 82 88 34 84 18 19 12 93 58 86 7 11 46 90 17 33 27 81 69 42 59 56 32 95 52 76 61 96 62 78 43 66 21 49 97 75 14 41 72 89 16 30 79 22 23 15 83 91 38 48 2 87 26 28 80 94 70 54 92 57 10 8 35 67 77 29 24 39", "output": "4 82 16 9 13 28 42 93 3 92 43 38 8 68 77 72 46 36 37 2 64 75 76 98 10 84 48 85 97 73 18 54 47 34 94 17 30 80 99 11 69 51 62 20 23 44 29 81 65 22 26 56 14 89 21 53 91 40 52 5 58 60 24 15 7 63 95 27 50 88 31 70 19 1 67 57 96 61 74 86 49 32 78 35 6 41 83 33 71 45 79 90 39 87 55 59 66 25 12" }, { "input": "99\n50 94 2 18 69 90 59 83 75 68 77 97 39 78 25 7 16 9 49 4 42 89 44 48 17 96 61 70 3 10 5 81 56 57 88 6 98 1 46 67 92 37 11 30 85 41 8 36 51 29 20 71 19 79 74 93 43 34 55 40 38 21 64 63 32 24 72 14 12 86 82 15 65 23 66 22 28 53 13 26 95 99 91 52 76 27 60 45 47 33 73 84 31 35 54 80 58 62 87", "output": "38 3 29 20 31 36 16 47 18 30 43 69 79 68 72 17 25 4 53 51 62 76 74 66 15 80 86 77 50 44 93 65 90 58 94 48 42 61 13 60 46 21 57 23 88 39 89 24 19 1 49 84 78 95 59 33 34 97 7 87 27 98 64 63 73 75 40 10 5 28 52 67 91 55 9 85 11 14 54 96 32 71 8 92 45 70 99 35 22 6 83 41 56 2 81 26 12 37 82" }, { "input": "99\n19 93 14 34 39 37 33 15 52 88 7 43 69 27 9 77 94 31 48 22 63 70 79 17 50 6 81 8 76 58 23 74 86 11 57 62 41 87 75 51 12 18 68 56 95 3 80 83 84 29 24 61 71 78 59 96 20 85 90 28 45 36 38 97 1 49 40 98 44 67 13 73 72 91 47 10 30 54 35 42 4 2 92 26 64 60 53 21 5 82 46 32 55 66 16 89 99 65 25", "output": "65 82 46 81 89 26 11 28 15 76 34 41 71 3 8 95 24 42 1 57 88 20 31 51 99 84 14 60 50 77 18 92 7 4 79 62 6 63 5 67 37 80 12 69 61 91 75 19 66 25 40 9 87 78 93 44 35 30 55 86 52 36 21 85 98 94 70 43 13 22 53 73 72 32 39 29 16 54 23 47 27 90 48 49 58 33 38 10 96 59 74 83 2 17 45 56 64 68 97" }, { "input": "99\n86 25 50 51 62 39 41 67 44 20 45 14 80 88 66 7 36 59 13 84 78 58 96 75 2 43 48 47 69 12 19 98 22 38 28 55 11 76 68 46 53 70 85 34 16 33 91 30 8 40 74 60 94 82 87 32 37 4 5 10 89 73 90 29 35 26 23 57 27 65 24 3 9 83 77 72 6 31 15 92 93 79 64 18 63 42 56 1 52 97 17 81 71 21 49 99 54 95 61", "output": "88 25 72 58 59 77 16 49 73 60 37 30 19 12 79 45 91 84 31 10 94 33 67 71 2 66 69 35 64 48 78 56 46 44 65 17 57 34 6 50 7 86 26 9 11 40 28 27 95 3 4 89 41 97 36 87 68 22 18 52 99 5 85 83 70 15 8 39 29 42 93 76 62 51 24 38 75 21 82 13 92 54 74 20 43 1 55 14 61 63 47 80 81 53 98 23 90 32 96" }, { "input": "100\n66 44 99 15 43 79 28 33 88 90 49 68 82 38 9 74 4 58 29 81 31 94 10 42 89 21 63 40 62 61 18 6 84 72 48 25 67 69 71 85 98 34 83 70 65 78 91 77 93 41 23 24 87 11 55 12 59 73 36 97 7 14 26 39 30 27 45 20 50 17 53 2 57 47 95 56 75 19 37 96 16 35 8 3 76 60 13 86 5 32 64 80 46 51 54 100 1 22 52 92", "output": "97 72 84 17 89 32 61 83 15 23 54 56 87 62 4 81 70 31 78 68 26 98 51 52 36 63 66 7 19 65 21 90 8 42 82 59 79 14 64 28 50 24 5 2 67 93 74 35 11 69 94 99 71 95 55 76 73 18 57 86 30 29 27 91 45 1 37 12 38 44 39 34 58 16 77 85 48 46 6 92 20 13 43 33 40 88 53 9 25 10 47 100 49 22 75 80 60 41 3 96" }, { "input": "99\n3 73 32 37 25 15 93 63 85 8 91 78 80 5 39 48 46 7 83 70 23 96 9 29 77 53 30 20 56 50 13 45 21 76 87 99 65 31 16 18 14 72 51 28 43 2 81 34 38 40 66 54 74 26 71 4 61 17 58 24 22 33 49 36 42 11 12 55 60 27 62 90 79 92 94 68 1 52 84 41 86 35 69 75 47 10 64 88 97 98 67 19 89 95 59 82 57 44 6", "output": "77 46 1 56 14 99 18 10 23 86 66 67 31 41 6 39 58 40 92 28 33 61 21 60 5 54 70 44 24 27 38 3 62 48 82 64 4 49 15 50 80 65 45 98 32 17 85 16 63 30 43 78 26 52 68 29 97 59 95 69 57 71 8 87 37 51 91 76 83 20 55 42 2 53 84 34 25 12 73 13 47 96 19 79 9 81 35 88 93 72 11 74 7 75 94 22 89 90 36" }, { "input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1" } ]
1,691,240,045
2,147,483,647
Python 3
OK
TESTS
101
92
0
n = int(input()) p = list(map(int, input().split())) l = [0 for _ in range(n)] for i in range(n): l[p[i]-1] = str(i+1) print(" ".join(l))
Title: Presents Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there. If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift. Now Petya wants to know for each friend *i* the number of a friend who has given him a gift. Input Specification: The first line contains one integer *n* (1<=≀<=*n*<=≀<=100) β€” the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* β€” the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves. Output Specification: Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*. Demo Input: ['4\n2 3 4 1\n', '3\n1 3 2\n', '2\n1 2\n'] Demo Output: ['4 1 2 3\n', '1 3 2\n', '1 2\n'] Note: none
```python n = int(input()) p = list(map(int, input().split())) l = [0 for _ in range(n)] for i in range(n): l[p[i]-1] = str(i+1) print(" ".join(l)) ```
3
25
A
IQ test
PROGRAMMING
1,300
[ "brute force" ]
A. IQ test
2
256
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob β€” to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
The first line contains integer *n* (3<=≀<=*n*<=≀<=100) β€” amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
[ "5\n2 4 7 8 10\n", "4\n1 2 1 1\n" ]
[ "3\n", "2\n" ]
none
0
[ { "input": "5\n2 4 7 8 10", "output": "3" }, { "input": "4\n1 2 1 1", "output": "2" }, { "input": "3\n1 2 2", "output": "1" }, { "input": "3\n100 99 100", "output": "2" }, { "input": "3\n5 3 2", "output": "3" }, { "input": "4\n43 28 1 91", "output": "2" }, { "input": "4\n75 13 94 77", "output": "3" }, { "input": "4\n97 8 27 3", "output": "2" }, { "input": "10\n95 51 12 91 85 3 1 31 25 7", "output": "3" }, { "input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46", "output": "4" }, { "input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36", "output": "26" }, { "input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83", "output": "48" }, { "input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25", "output": "1" }, { "input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46", "output": "25" }, { "input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73", "output": "13" }, { "input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76", "output": "99" }, { "input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14", "output": "1" }, { "input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22", "output": "93" }, { "input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23", "output": "1" }, { "input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98", "output": "1" }, { "input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94", "output": "93" }, { "input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29", "output": "32" }, { "input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47", "output": "26" }, { "input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72", "output": "56" }, { "input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86", "output": "97" }, { "input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42", "output": "79" }, { "input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52", "output": "25" }, { "input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86", "output": "78" }, { "input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68", "output": "70" }, { "input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81", "output": "39" }, { "input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83", "output": "88" }, { "input": "3\n100 100 1", "output": "3" } ]
1,584,077,968
2,147,483,647
PyPy 3
OK
TESTS
32
312
0
n = int(input()) e=o=0 a = list(map(int,input().split())) for i in range(len(a)): if(a[i]%2 == 0): e+=1 if(e>1): break; else: o+=1 if(e>o): for i in range(len(a)): if(a[i]%2 == 1): print(i+1) else: for i in range(len(a)): if(a[i]%2 == 0): print(i+1)
Title: IQ test Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob β€” to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness. Input Specification: The first line contains integer *n* (3<=≀<=*n*<=≀<=100) β€” amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness. Output Specification: Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order. Demo Input: ['5\n2 4 7 8 10\n', '4\n1 2 1 1\n'] Demo Output: ['3\n', '2\n'] Note: none
```python n = int(input()) e=o=0 a = list(map(int,input().split())) for i in range(len(a)): if(a[i]%2 == 0): e+=1 if(e>1): break; else: o+=1 if(e>o): for i in range(len(a)): if(a[i]%2 == 1): print(i+1) else: for i in range(len(a)): if(a[i]%2 == 0): print(i+1) ```
3.922
570
A
Elections
PROGRAMMING
1,100
[ "implementation" ]
null
null
The country of Byalechinsk is running elections involving *n* candidates. The country consists of *m* cities. We know how many people in each city voted for each candidate. The electoral system in the country is pretty unusual. At the first stage of elections the votes are counted for each city: it is assumed that in each city won the candidate who got the highest number of votes in this city, and if several candidates got the maximum number of votes, then the winner is the one with a smaller index. At the second stage of elections the winner is determined by the same principle over the cities: the winner of the elections is the candidate who won in the maximum number of cities, and among those who got the maximum number of cities the winner is the one with a smaller index. Determine who will win the elections.
The first line of the input contains two integers *n*, *m* (1<=≀<=*n*,<=*m*<=≀<=100) β€” the number of candidates and of cities, respectively. Each of the next *m* lines contains *n* non-negative integers, the *j*-th number in the *i*-th line *a**ij* (1<=≀<=*j*<=≀<=*n*, 1<=≀<=*i*<=≀<=*m*, 0<=≀<=*a**ij*<=≀<=109) denotes the number of votes for candidate *j* in city *i*. It is guaranteed that the total number of people in all the cities does not exceed 109.
Print a single number β€” the index of the candidate who won the elections. The candidates are indexed starting from one.
[ "3 3\n1 2 3\n2 3 1\n1 2 1\n", "3 4\n10 10 3\n5 1 6\n2 2 2\n1 5 7\n" ]
[ "2", "1" ]
Note to the first sample test. At the first stage city 1 chosen candidate 3, city 2 chosen candidate 2, city 3 chosen candidate 2. The winner is candidate 2, he gained 2 votes. Note to the second sample test. At the first stage in city 1 candidates 1 and 2 got the same maximum number of votes, but candidate 1 has a smaller index, so the city chose candidate 1. City 2 chosen candidate 3. City 3 chosen candidate 1, due to the fact that everyone has the same number of votes, and 1 has the smallest index. City 4 chosen the candidate 3. On the second stage the same number of cities chose candidates 1 and 3. The winner is candidate 1, the one with the smaller index.
500
[ { "input": "3 3\n1 2 3\n2 3 1\n1 2 1", "output": "2" }, { "input": "3 4\n10 10 3\n5 1 6\n2 2 2\n1 5 7", "output": "1" }, { "input": "1 3\n5\n3\n2", "output": "1" }, { "input": "3 1\n1 2 3", "output": "3" }, { "input": "3 1\n100 100 100", "output": "1" }, { "input": "2 2\n1 2\n2 1", "output": "1" }, { "input": "2 2\n2 1\n2 1", "output": "1" }, { "input": "2 2\n1 2\n1 2", "output": "2" }, { "input": "3 3\n0 0 0\n1 1 1\n2 2 2", "output": "1" }, { "input": "1 1\n1000000000", "output": "1" }, { "input": "5 5\n1 2 3 4 5\n2 3 4 5 6\n3 4 5 6 7\n4 5 6 7 8\n5 6 7 8 9", "output": "5" }, { "input": "4 4\n1 3 1 3\n3 1 3 1\n2 0 0 2\n0 1 1 0", "output": "1" }, { "input": "4 4\n1 4 1 3\n3 1 2 1\n1 0 0 2\n0 1 10 0", "output": "1" }, { "input": "4 4\n1 4 1 300\n3 1 2 1\n5 0 0 2\n0 1 10 100", "output": "1" }, { "input": "5 5\n15 45 15 300 10\n53 15 25 51 10\n5 50 50 2 10\n1000 1 10 100 10\n10 10 10 10 10", "output": "1" }, { "input": "1 100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1", "output": "1" }, { "input": "100 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1" }, { "input": "1 100\n859\n441\n272\n47\n355\n345\n612\n569\n545\n599\n410\n31\n720\n303\n58\n537\n561\n730\n288\n275\n446\n955\n195\n282\n153\n455\n996\n121\n267\n702\n769\n560\n353\n89\n990\n282\n801\n335\n573\n258\n722\n768\n324\n41\n249\n125\n557\n303\n664\n945\n156\n884\n985\n816\n433\n65\n976\n963\n85\n647\n46\n877\n665\n523\n714\n182\n377\n549\n994\n385\n184\n724\n447\n99\n766\n353\n494\n747\n324\n436\n915\n472\n879\n582\n928\n84\n627\n156\n972\n651\n159\n372\n70\n903\n590\n480\n184\n540\n270\n892", "output": "1" }, { "input": "100 1\n439 158 619 538 187 153 973 781 610 475 94 947 449 531 220 51 788 118 189 501 54 434 465 902 280 635 688 214 737 327 682 690 683 519 261 923 254 388 529 659 662 276 376 735 976 664 521 285 42 147 187 259 407 977 879 465 522 17 550 701 114 921 577 265 668 812 232 267 135 371 586 201 608 373 771 358 101 412 195 582 199 758 507 882 16 484 11 712 916 699 783 618 405 124 904 257 606 610 230 718", "output": "54" }, { "input": "1 99\n511\n642\n251\n30\n494\n128\n189\n324\n884\n656\n120\n616\n959\n328\n411\n933\n895\n350\n1\n838\n996\n761\n619\n131\n824\n751\n707\n688\n915\n115\n244\n476\n293\n986\n29\n787\n607\n259\n756\n864\n394\n465\n303\n387\n521\n582\n485\n355\n299\n997\n683\n472\n424\n948\n339\n383\n285\n957\n591\n203\n866\n79\n835\n980\n344\n493\n361\n159\n160\n947\n46\n362\n63\n553\n793\n754\n429\n494\n523\n227\n805\n313\n409\n243\n927\n350\n479\n971\n825\n460\n544\n235\n660\n327\n216\n729\n147\n671\n738", "output": "1" }, { "input": "99 1\n50 287 266 159 551 198 689 418 809 43 691 367 160 664 86 805 461 55 127 950 576 351 721 493 972 560 934 885 492 92 321 759 767 989 883 7 127 413 404 604 80 645 666 874 371 718 893 158 722 198 563 293 134 255 742 913 252 378 859 721 502 251 839 284 133 209 962 514 773 124 205 903 785 859 911 93 861 786 747 213 690 69 942 697 211 203 284 961 351 137 962 952 408 249 238 850 944 40 346", "output": "34" }, { "input": "100 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2", "output": "100" }, { "input": "1 1\n0", "output": "1" }, { "input": "2 1\n0 0", "output": "1" }, { "input": "2 2\n0 0\n0 0", "output": "1" }, { "input": "2 2\n1 2\n0 0", "output": "1" }, { "input": "3 3\n0 0 0\n0 0 0\n0 0 0", "output": "1" }, { "input": "2 3\n0 0\n0 0\n0 1", "output": "1" }, { "input": "3 2\n1 1 3\n0 0 0", "output": "1" }, { "input": "3 4\n1 10 3\n0 0 0\n0 0 0\n0 0 0", "output": "1" }, { "input": "2 4\n2 1\n1 2\n0 0\n1 2", "output": "1" }, { "input": "2 2\n0 1\n0 1", "output": "2" }, { "input": "2 3\n1 2\n0 0\n2 1", "output": "1" }, { "input": "2 2\n0 0\n4 5", "output": "1" }, { "input": "3 2\n10 15 20\n0 0 0", "output": "1" }, { "input": "3 4\n0 0 0\n0 0 0\n0 0 0\n1 2 3", "output": "1" }, { "input": "3 3\n0 0 0\n0 0 0\n0 0 1", "output": "1" }, { "input": "3 3\n0 0 0\n1 2 3\n1 3 2", "output": "1" }, { "input": "3 1\n0 0 0", "output": "1" }, { "input": "3 3\n0 0 1\n0 0 0\n0 0 0", "output": "1" } ]
1,498,213,798
2,147,483,647
Python 3
OK
TESTS
62
62
5,529,600
n,m=map(int,input().split(" ")) a=list() b=list() c=[0]*(n+1) for i in range(0,m): a=list(map(int,input().split(" "))) k=max(a) if a.count(k)==1: b.append(a.index(k)+1) c[a.index(k)+1]=c[a.index(k)+1]+1 else: for j in range(0,n): if a[j]==k: b.append(j+1) c[j+1]=c[j+1]+1 break s=max(c) print(c.index(s))
Title: Elections Time Limit: None seconds Memory Limit: None megabytes Problem Description: The country of Byalechinsk is running elections involving *n* candidates. The country consists of *m* cities. We know how many people in each city voted for each candidate. The electoral system in the country is pretty unusual. At the first stage of elections the votes are counted for each city: it is assumed that in each city won the candidate who got the highest number of votes in this city, and if several candidates got the maximum number of votes, then the winner is the one with a smaller index. At the second stage of elections the winner is determined by the same principle over the cities: the winner of the elections is the candidate who won in the maximum number of cities, and among those who got the maximum number of cities the winner is the one with a smaller index. Determine who will win the elections. Input Specification: The first line of the input contains two integers *n*, *m* (1<=≀<=*n*,<=*m*<=≀<=100) β€” the number of candidates and of cities, respectively. Each of the next *m* lines contains *n* non-negative integers, the *j*-th number in the *i*-th line *a**ij* (1<=≀<=*j*<=≀<=*n*, 1<=≀<=*i*<=≀<=*m*, 0<=≀<=*a**ij*<=≀<=109) denotes the number of votes for candidate *j* in city *i*. It is guaranteed that the total number of people in all the cities does not exceed 109. Output Specification: Print a single number β€” the index of the candidate who won the elections. The candidates are indexed starting from one. Demo Input: ['3 3\n1 2 3\n2 3 1\n1 2 1\n', '3 4\n10 10 3\n5 1 6\n2 2 2\n1 5 7\n'] Demo Output: ['2', '1'] Note: Note to the first sample test. At the first stage city 1 chosen candidate 3, city 2 chosen candidate 2, city 3 chosen candidate 2. The winner is candidate 2, he gained 2 votes. Note to the second sample test. At the first stage in city 1 candidates 1 and 2 got the same maximum number of votes, but candidate 1 has a smaller index, so the city chose candidate 1. City 2 chosen candidate 3. City 3 chosen candidate 1, due to the fact that everyone has the same number of votes, and 1 has the smallest index. City 4 chosen the candidate 3. On the second stage the same number of cities chose candidates 1 and 3. The winner is candidate 1, the one with the smaller index.
```python n,m=map(int,input().split(" ")) a=list() b=list() c=[0]*(n+1) for i in range(0,m): a=list(map(int,input().split(" "))) k=max(a) if a.count(k)==1: b.append(a.index(k)+1) c[a.index(k)+1]=c[a.index(k)+1]+1 else: for j in range(0,n): if a[j]==k: b.append(j+1) c[j+1]=c[j+1]+1 break s=max(c) print(c.index(s)) ```
3
41
A
Translation
PROGRAMMING
800
[ "implementation", "strings" ]
A. Translation
2
256
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the Β«translationΒ». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
[ "code\nedoc\n", "abb\naba\n", "code\ncode\n" ]
[ "YES\n", "NO\n", "NO\n" ]
none
500
[ { "input": "code\nedoc", "output": "YES" }, { "input": "abb\naba", "output": "NO" }, { "input": "code\ncode", "output": "NO" }, { "input": "abacaba\nabacaba", "output": "YES" }, { "input": "q\nq", "output": "YES" }, { "input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk", "output": "NO" }, { "input": "z\na", "output": "NO" }, { "input": "asd\ndsa", "output": "YES" }, { "input": "abcdef\nfecdba", "output": "NO" }, { "input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu", "output": "NO" }, { "input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf", "output": "NO" }, { "input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp", "output": "NO" }, { "input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb", "output": "NO" }, { "input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom", "output": "NO" }, { "input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh", "output": "NO" }, { "input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy", "output": "NO" }, { "input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko", "output": "NO" }, { "input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv", "output": "NO" }, { "input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd", "output": "NO" }, { "input": "w\nw", "output": "YES" }, { "input": "vz\nzv", "output": "YES" }, { "input": "ry\nyr", "output": "YES" }, { "input": "xou\nuox", "output": "YES" }, { "input": "axg\ngax", "output": "NO" }, { "input": "zdsl\nlsdz", "output": "YES" }, { "input": "kudl\nldku", "output": "NO" }, { "input": "zzlzwnqlcl\nlclqnwzlzz", "output": "YES" }, { "input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv", "output": "YES" }, { "input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar", "output": "NO" }, { "input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn", "output": "YES" }, { "input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum", "output": "YES" }, { "input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv", "output": "YES" }, { "input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm", "output": "NO" }, { "input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd", "output": "NO" }, { "input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg", "output": "YES" }, { "input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis", "output": "YES" }, { "input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy", "output": "NO" }, { "input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw", "output": "YES" }, { "input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi", "output": "YES" }, { "input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib", "output": "YES" } ]
1,583,759,345
2,147,483,647
Python 3
OK
TESTS
40
216
0
def A41(string1,string2): reversed_string = string1[::-1] if reversed_string == string2: print('YES') else: print('NO') string1 = input() string2 = input() A41(string1,string2)
Title: Translation Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the Β«translationΒ». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. Input Specification: The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. Output Specification: If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. Demo Input: ['code\nedoc\n', 'abb\naba\n', 'code\ncode\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none
```python def A41(string1,string2): reversed_string = string1[::-1] if reversed_string == string2: print('YES') else: print('NO') string1 = input() string2 = input() A41(string1,string2) ```
3.946
716
A
Crazy Computer
PROGRAMMING
800
[ "implementation" ]
null
null
ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear! More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≀<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=&gt;<=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen. For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen. You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything.
The first line contains two integers *n* and *c* (1<=≀<=*n*<=≀<=100<=000,<=1<=≀<=*c*<=≀<=109)Β β€” the number of words ZS the Coder typed and the crazy computer delay respectively. The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≀<=*t*1<=&lt;<=*t*2<=&lt;<=...<=&lt;<=*t**n*<=≀<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word.
Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*.
[ "6 5\n1 3 8 14 19 20\n", "6 1\n1 3 5 7 9 10\n" ]
[ "3", "2" ]
The first sample is already explained in the problem statement. For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 &gt; 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≀ 1.
500
[ { "input": "6 5\n1 3 8 14 19 20", "output": "3" }, { "input": "6 1\n1 3 5 7 9 10", "output": "2" }, { "input": "1 1\n1000000000", "output": "1" }, { "input": "5 5\n1 7 12 13 14", "output": "4" }, { "input": "2 1000000000\n1 1000000000", "output": "2" }, { "input": "3 5\n1 10 20", "output": "1" }, { "input": "3 10\n1 2 3", "output": "3" }, { "input": "2 1\n1 100", "output": "1" }, { "input": "3 1\n1 2 10", "output": "1" }, { "input": "2 1\n1 2", "output": "2" } ]
1,692,419,936
2,147,483,647
Python 3
OK
TESTS
81
93
13,209,600
lis=list(map(int,input().strip().split())) n=lis[0] x=lis[1] lis=list(map(int,input().strip().split())) c=0 for i in range(1,len(lis)): #print(lis[i]-lis[i-1],x) if lis[i]-lis[i-1]>x: c=0 else: c=c+1 print(c+1)
Title: Crazy Computer Time Limit: None seconds Memory Limit: None megabytes Problem Description: ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear! More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≀<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=&gt;<=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen. For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen. You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything. Input Specification: The first line contains two integers *n* and *c* (1<=≀<=*n*<=≀<=100<=000,<=1<=≀<=*c*<=≀<=109)Β β€” the number of words ZS the Coder typed and the crazy computer delay respectively. The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≀<=*t*1<=&lt;<=*t*2<=&lt;<=...<=&lt;<=*t**n*<=≀<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word. Output Specification: Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*. Demo Input: ['6 5\n1 3 8 14 19 20\n', '6 1\n1 3 5 7 9 10\n'] Demo Output: ['3', '2'] Note: The first sample is already explained in the problem statement. For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 &gt; 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≀ 1.
```python lis=list(map(int,input().strip().split())) n=lis[0] x=lis[1] lis=list(map(int,input().strip().split())) c=0 for i in range(1,len(lis)): #print(lis[i]-lis[i-1],x) if lis[i]-lis[i-1]>x: c=0 else: c=c+1 print(c+1) ```
3
172
A
Phone Code
PROGRAMMING
800
[ "*special", "brute force", "implementation" ]
null
null
Polycarpus has *n* friends in Tarasov city. Polycarpus knows phone numbers of all his friends: they are strings *s*1,<=*s*2,<=...,<=*s**n*. All these strings consist only of digits and have the same length. Once Polycarpus needed to figure out Tarasov city phone code. He assumed that the phone code of the city is the longest common prefix of all phone numbers of his friends. In other words, it is the longest string *c* which is a prefix (the beginning) of each *s**i* for all *i* (1<=≀<=*i*<=≀<=*n*). Help Polycarpus determine the length of the city phone code.
The first line of the input contains an integer *n* (2<=≀<=*n*<=≀<=3Β·104) β€” the number of Polycarpus's friends. The following *n* lines contain strings *s*1,<=*s*2,<=...,<=*s**n* β€” the phone numbers of Polycarpus's friends. It is guaranteed that all strings consist only of digits and have the same length from 1 to 20, inclusive. It is also guaranteed that all strings are different.
Print the number of digits in the city phone code.
[ "4\n00209\n00219\n00999\n00909\n", "2\n1\n2\n", "3\n77012345678999999999\n77012345678901234567\n77012345678998765432\n" ]
[ "2\n", "0\n", "12\n" ]
A prefix of string *t* is a string that is obtained by deleting zero or more digits from the end of string *t*. For example, string "00209" has 6 prefixes: "" (an empty prefix), "0", "00", "002", "0020", "00209". In the first sample the city phone code is string "00". In the second sample the city phone code is an empty string. In the third sample the city phone code is string "770123456789".
1,000
[ { "input": "4\n00209\n00219\n00999\n00909", "output": "2" }, { "input": "2\n1\n2", "output": "0" }, { "input": "3\n77012345678999999999\n77012345678901234567\n77012345678998765432", "output": "12" }, { "input": "5\n4491183345\n4491184811\n4491162340\n4491233399\n4491449214", "output": "4" }, { "input": "10\n15424\n10953\n19176\n15514\n16284\n18680\n19305\n13816\n16168\n15924", "output": "1" }, { "input": "10\n4906361343\n8985777485\n1204265609\n7088384855\n4127287014\n7904807820\n3032139021\n5999959109\n6477458281\n3244359368", "output": "0" }, { "input": "10\n3717208309\n3717208306\n3717208302\n3717208301\n3717208303\n3717208308\n3717208304\n3717208307\n3717208300\n3717208305", "output": "9" }, { "input": "9\n2881\n2808\n2868\n2874\n2894\n2870\n2818\n2896\n2890", "output": "2" }, { "input": "2\n4\n9", "output": "0" }, { "input": "2\n29867863763143509570\n59261213969200291523", "output": "0" }, { "input": "2\n84\n62", "output": "0" }, { "input": "2\n75970434466248453472\n75970434466248453476", "output": "19" }, { "input": "10\n17254072509168593435\n17254072509168593433\n17254072509168593430\n17254072509168593432\n17254072509168593439\n17254072509168593436\n17254072509168593438\n17254072509168593437\n17254072509168593431\n17254072509168593434", "output": "19" } ]
1,611,932,504
2,147,483,647
Python 3
OK
TESTS
28
436
0
n = int(input()) s = input() l = len(s) for i in range(1, n): si = input() j = 0 while s[j] == si[j] and j < l: j += 1 l = j print(l)
Title: Phone Code Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarpus has *n* friends in Tarasov city. Polycarpus knows phone numbers of all his friends: they are strings *s*1,<=*s*2,<=...,<=*s**n*. All these strings consist only of digits and have the same length. Once Polycarpus needed to figure out Tarasov city phone code. He assumed that the phone code of the city is the longest common prefix of all phone numbers of his friends. In other words, it is the longest string *c* which is a prefix (the beginning) of each *s**i* for all *i* (1<=≀<=*i*<=≀<=*n*). Help Polycarpus determine the length of the city phone code. Input Specification: The first line of the input contains an integer *n* (2<=≀<=*n*<=≀<=3Β·104) β€” the number of Polycarpus's friends. The following *n* lines contain strings *s*1,<=*s*2,<=...,<=*s**n* β€” the phone numbers of Polycarpus's friends. It is guaranteed that all strings consist only of digits and have the same length from 1 to 20, inclusive. It is also guaranteed that all strings are different. Output Specification: Print the number of digits in the city phone code. Demo Input: ['4\n00209\n00219\n00999\n00909\n', '2\n1\n2\n', '3\n77012345678999999999\n77012345678901234567\n77012345678998765432\n'] Demo Output: ['2\n', '0\n', '12\n'] Note: A prefix of string *t* is a string that is obtained by deleting zero or more digits from the end of string *t*. For example, string "00209" has 6 prefixes: "" (an empty prefix), "0", "00", "002", "0020", "00209". In the first sample the city phone code is string "00". In the second sample the city phone code is an empty string. In the third sample the city phone code is string "770123456789".
```python n = int(input()) s = input() l = len(s) for i in range(1, n): si = input() j = 0 while s[j] == si[j] and j < l: j += 1 l = j print(l) ```
3
41
A
Translation
PROGRAMMING
800
[ "implementation", "strings" ]
A. Translation
2
256
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the Β«translationΒ». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
[ "code\nedoc\n", "abb\naba\n", "code\ncode\n" ]
[ "YES\n", "NO\n", "NO\n" ]
none
500
[ { "input": "code\nedoc", "output": "YES" }, { "input": "abb\naba", "output": "NO" }, { "input": "code\ncode", "output": "NO" }, { "input": "abacaba\nabacaba", "output": "YES" }, { "input": "q\nq", "output": "YES" }, { "input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk", "output": "NO" }, { "input": "z\na", "output": "NO" }, { "input": "asd\ndsa", "output": "YES" }, { "input": "abcdef\nfecdba", "output": "NO" }, { "input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu", "output": "NO" }, { "input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf", "output": "NO" }, { "input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp", "output": "NO" }, { "input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb", "output": "NO" }, { "input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom", "output": "NO" }, { "input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh", "output": "NO" }, { "input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy", "output": "NO" }, { "input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko", "output": "NO" }, { "input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv", "output": "NO" }, { "input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd", "output": "NO" }, { "input": "w\nw", "output": "YES" }, { "input": "vz\nzv", "output": "YES" }, { "input": "ry\nyr", "output": "YES" }, { "input": "xou\nuox", "output": "YES" }, { "input": "axg\ngax", "output": "NO" }, { "input": "zdsl\nlsdz", "output": "YES" }, { "input": "kudl\nldku", "output": "NO" }, { "input": "zzlzwnqlcl\nlclqnwzlzz", "output": "YES" }, { "input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv", "output": "YES" }, { "input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar", "output": "NO" }, { "input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn", "output": "YES" }, { "input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum", "output": "YES" }, { "input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv", "output": "YES" }, { "input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm", "output": "NO" }, { "input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd", "output": "NO" }, { "input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg", "output": "YES" }, { "input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis", "output": "YES" }, { "input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy", "output": "NO" }, { "input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw", "output": "YES" }, { "input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi", "output": "YES" }, { "input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib", "output": "YES" } ]
1,633,256,832
2,147,483,647
Python 3
OK
TESTS
40
124
6,758,400
x=input() y=list(input()) y.reverse() z="".join(y) if z==x: print("YES") else:print("NO")
Title: Translation Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the Β«translationΒ». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. Input Specification: The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. Output Specification: If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. Demo Input: ['code\nedoc\n', 'abb\naba\n', 'code\ncode\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none
```python x=input() y=list(input()) y.reverse() z="".join(y) if z==x: print("YES") else:print("NO") ```
3.956411
160
A
Twins
PROGRAMMING
900
[ "greedy", "sortings" ]
null
null
Imagine that you have a twin brother or sister. Having another person that looks exactly like you seems very unusual. It's hard to say if having something of an alter ego is good or bad. And if you do have a twin, then you very well know what it's like. Now let's imagine a typical morning in your family. You haven't woken up yet, and Mom is already going to work. She has been so hasty that she has nearly forgotten to leave the two of her darling children some money to buy lunches in the school cafeteria. She fished in the purse and found some number of coins, or to be exact, *n* coins of arbitrary values *a*1,<=*a*2,<=...,<=*a**n*. But as Mom was running out of time, she didn't split the coins for you two. So she scribbled a note asking you to split the money equally. As you woke up, you found Mom's coins and read her note. "But why split the money equally?" β€” you thought. After all, your twin is sleeping and he won't know anything. So you decided to act like that: pick for yourself some subset of coins so that the sum of values of your coins is strictly larger than the sum of values of the remaining coins that your twin will have. However, you correctly thought that if you take too many coins, the twin will suspect the deception. So, you've decided to stick to the following strategy to avoid suspicions: you take the minimum number of coins, whose sum of values is strictly more than the sum of values of the remaining coins. On this basis, determine what minimum number of coins you need to take to divide them in the described manner.
The first line contains integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of coins. The second line contains a sequence of *n* integers *a*1, *a*2, ..., *a**n* (1<=≀<=*a**i*<=≀<=100) β€” the coins' values. All numbers are separated with spaces.
In the single line print the single number β€” the minimum needed number of coins.
[ "2\n3 3\n", "3\n2 1 2\n" ]
[ "2\n", "2\n" ]
In the first sample you will have to take 2 coins (you and your twin have sums equal to 6, 0 correspondingly). If you take 1 coin, you get sums 3, 3. If you take 0 coins, you get sums 0, 6. Those variants do not satisfy you as your sum should be strictly more that your twins' sum. In the second sample one coin isn't enough for us, too. You can pick coins with values 1, 2 or 2, 2. In any case, the minimum number of coins equals 2.
500
[ { "input": "2\n3 3", "output": "2" }, { "input": "3\n2 1 2", "output": "2" }, { "input": "1\n5", "output": "1" }, { "input": "5\n4 2 2 2 2", "output": "3" }, { "input": "7\n1 10 1 2 1 1 1", "output": "1" }, { "input": "5\n3 2 3 3 1", "output": "3" }, { "input": "2\n2 1", "output": "1" }, { "input": "3\n2 1 3", "output": "2" }, { "input": "6\n1 1 1 1 1 1", "output": "4" }, { "input": "7\n10 10 5 5 5 5 1", "output": "3" }, { "input": "20\n2 1 2 2 2 1 1 2 1 2 2 1 1 1 1 2 1 1 1 1", "output": "8" }, { "input": "20\n4 2 4 4 3 4 2 2 4 2 3 1 1 2 2 3 3 3 1 4", "output": "8" }, { "input": "20\n35 26 41 40 45 46 22 26 39 23 11 15 47 42 18 15 27 10 45 40", "output": "8" }, { "input": "20\n7 84 100 10 31 35 41 2 63 44 57 4 63 11 23 49 98 71 16 90", "output": "6" }, { "input": "50\n19 2 12 26 17 27 10 26 17 17 5 24 11 15 3 9 16 18 19 1 25 23 18 6 2 7 25 7 21 25 13 29 16 9 25 3 14 30 18 4 10 28 6 10 8 2 2 4 8 28", "output": "14" }, { "input": "70\n2 18 18 47 25 5 14 9 19 46 36 49 33 32 38 23 32 39 8 29 31 17 24 21 10 15 33 37 46 21 22 11 20 35 39 13 11 30 28 40 39 47 1 17 24 24 21 46 12 2 20 43 8 16 44 11 45 10 13 44 31 45 45 46 11 10 33 35 23 42", "output": "22" }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "51" }, { "input": "100\n1 2 2 1 2 1 1 2 1 1 1 2 2 1 1 1 2 2 2 1 2 1 1 1 1 1 2 1 2 1 2 1 2 1 2 1 1 1 2 1 1 1 1 1 2 2 1 2 1 2 1 2 2 2 1 2 1 2 2 1 1 2 2 1 1 2 2 2 1 1 2 1 1 2 2 1 2 1 1 2 2 1 2 1 1 2 2 1 1 1 1 2 1 1 1 1 2 2 2 2", "output": "37" }, { "input": "100\n1 2 3 2 1 2 2 3 1 3 3 2 2 1 1 2 2 1 1 1 1 2 3 3 2 1 1 2 2 2 3 3 3 2 1 3 1 3 3 2 3 1 2 2 2 3 2 1 1 3 3 3 3 2 1 1 2 3 2 2 3 2 3 2 2 3 2 2 2 2 3 3 3 1 3 3 1 1 2 3 2 2 2 2 3 3 3 2 1 2 3 1 1 2 3 3 1 3 3 2", "output": "36" }, { "input": "100\n5 5 4 3 5 1 2 5 1 1 3 5 4 4 1 1 1 1 5 4 4 5 1 5 5 1 2 1 3 1 5 1 3 3 3 2 2 2 1 1 5 1 3 4 1 1 3 2 5 2 2 5 5 4 4 1 3 4 3 3 4 5 3 3 3 1 2 1 4 2 4 4 1 5 1 3 5 5 5 5 3 4 4 3 1 2 5 2 3 5 4 2 4 5 3 2 4 2 4 3", "output": "33" }, { "input": "100\n3 4 8 10 8 6 4 3 7 7 6 2 3 1 3 10 1 7 9 3 5 5 2 6 2 9 1 7 4 2 4 1 6 1 7 10 2 5 3 7 6 4 6 2 8 8 8 6 6 10 3 7 4 3 4 1 7 9 3 6 3 6 1 4 9 3 8 1 10 1 4 10 7 7 9 5 3 8 10 2 1 10 8 7 10 8 5 3 1 2 1 10 6 1 5 3 3 5 7 2", "output": "30" }, { "input": "100\n16 9 11 8 11 4 9 17 4 8 4 10 9 10 6 3 3 15 1 6 1 15 12 18 6 14 13 18 1 7 18 4 10 7 10 12 3 16 14 4 10 8 10 7 19 13 15 1 4 8 16 10 6 4 3 16 11 10 7 3 4 16 1 20 1 11 4 16 10 7 7 12 18 19 3 17 19 3 4 19 2 12 11 3 18 20 2 2 14 4 20 13 13 11 16 20 19 14 7 2", "output": "29" }, { "input": "100\n2 46 4 6 38 19 15 34 10 35 37 30 3 25 5 45 40 45 33 31 6 20 10 44 11 9 2 14 35 5 9 23 20 2 48 22 25 35 38 31 24 33 35 16 4 30 27 10 12 22 6 24 12 30 23 21 14 12 32 21 7 12 25 43 18 34 34 28 47 13 28 43 18 39 44 42 35 26 35 14 8 29 32 20 29 3 20 6 20 9 9 27 8 42 10 37 42 27 8 1", "output": "30" }, { "input": "100\n85 50 17 89 65 89 5 20 86 26 16 21 85 14 44 31 87 31 6 2 48 67 8 80 79 1 48 36 97 1 5 30 79 50 78 12 2 55 76 100 54 40 26 81 97 96 68 56 87 14 51 17 54 37 52 33 69 62 38 63 74 15 62 78 9 19 67 2 60 58 93 60 18 96 55 48 34 7 79 82 32 58 90 67 20 50 27 15 7 89 98 10 11 15 99 49 4 51 77 52", "output": "29" }, { "input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "30" }, { "input": "1\n1", "output": "1" }, { "input": "4\n4 1 2 3", "output": "2" }, { "input": "5\n2 2 2 4 4", "output": "2" }, { "input": "4\n100 99 99 100", "output": "2" } ]
1,699,385,458
2,147,483,647
Python 3
OK
TESTS
29
62
0
coin_num = int(input()) coin_arr = [int(i) for i in input().split()] coin_arr.sort(reverse = True) total = sum(coin_arr) nijer = 0 counter = 0 while total>=nijer: nijer+= coin_arr[counter] total-=coin_arr[counter] counter+=1 print(counter)
Title: Twins Time Limit: None seconds Memory Limit: None megabytes Problem Description: Imagine that you have a twin brother or sister. Having another person that looks exactly like you seems very unusual. It's hard to say if having something of an alter ego is good or bad. And if you do have a twin, then you very well know what it's like. Now let's imagine a typical morning in your family. You haven't woken up yet, and Mom is already going to work. She has been so hasty that she has nearly forgotten to leave the two of her darling children some money to buy lunches in the school cafeteria. She fished in the purse and found some number of coins, or to be exact, *n* coins of arbitrary values *a*1,<=*a*2,<=...,<=*a**n*. But as Mom was running out of time, she didn't split the coins for you two. So she scribbled a note asking you to split the money equally. As you woke up, you found Mom's coins and read her note. "But why split the money equally?" β€” you thought. After all, your twin is sleeping and he won't know anything. So you decided to act like that: pick for yourself some subset of coins so that the sum of values of your coins is strictly larger than the sum of values of the remaining coins that your twin will have. However, you correctly thought that if you take too many coins, the twin will suspect the deception. So, you've decided to stick to the following strategy to avoid suspicions: you take the minimum number of coins, whose sum of values is strictly more than the sum of values of the remaining coins. On this basis, determine what minimum number of coins you need to take to divide them in the described manner. Input Specification: The first line contains integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of coins. The second line contains a sequence of *n* integers *a*1, *a*2, ..., *a**n* (1<=≀<=*a**i*<=≀<=100) β€” the coins' values. All numbers are separated with spaces. Output Specification: In the single line print the single number β€” the minimum needed number of coins. Demo Input: ['2\n3 3\n', '3\n2 1 2\n'] Demo Output: ['2\n', '2\n'] Note: In the first sample you will have to take 2 coins (you and your twin have sums equal to 6, 0 correspondingly). If you take 1 coin, you get sums 3, 3. If you take 0 coins, you get sums 0, 6. Those variants do not satisfy you as your sum should be strictly more that your twins' sum. In the second sample one coin isn't enough for us, too. You can pick coins with values 1, 2 or 2, 2. In any case, the minimum number of coins equals 2.
```python coin_num = int(input()) coin_arr = [int(i) for i in input().split()] coin_arr.sort(reverse = True) total = sum(coin_arr) nijer = 0 counter = 0 while total>=nijer: nijer+= coin_arr[counter] total-=coin_arr[counter] counter+=1 print(counter) ```
3
743
B
Chloe and the sequence
PROGRAMMING
1,200
[ "binary search", "bitmasks", "constructive algorithms", "implementation" ]
null
null
Chloe, the same as Vladik, is a competitive programmer. She didn't have any problems to get to the olympiad like Vladik, but she was confused by the task proposed on the olympiad. Let's consider the following algorithm of generating a sequence of integers. Initially we have a sequence consisting of a single element equal to 1. Then we perform (*n*<=-<=1) steps. On each step we take the sequence we've got on the previous step, append it to the end of itself and insert in the middle the minimum positive integer we haven't used before. For example, we get the sequence [1,<=2,<=1] after the first step, the sequence [1,<=2,<=1,<=3,<=1,<=2,<=1] after the second step. The task is to find the value of the element with index *k* (the elements are numbered from 1) in the obtained sequence, i.Β e. after (*n*<=-<=1) steps. Please help Chloe to solve the problem!
The only line contains two integers *n* and *k* (1<=≀<=*n*<=≀<=50, 1<=≀<=*k*<=≀<=2*n*<=-<=1).
Print single integerΒ β€” the integer at the *k*-th position in the obtained sequence.
[ "3 2\n", "4 8\n" ]
[ "2", "4" ]
In the first sample the obtained sequence is [1, 2, 1, 3, 1, 2, 1]. The number on the second position is 2. In the second sample the obtained sequence is [1, 2, 1, 3, 1, 2, 1, 4, 1, 2, 1, 3, 1, 2, 1]. The number on the eighth position is 4.
1,000
[ { "input": "3 2", "output": "2" }, { "input": "4 8", "output": "4" }, { "input": "5 27", "output": "1" }, { "input": "7 44", "output": "3" }, { "input": "15 18432", "output": "12" }, { "input": "20 259676", "output": "3" }, { "input": "30 671088640", "output": "28" }, { "input": "38 137438953472", "output": "38" }, { "input": "1 1", "output": "1" }, { "input": "3 3", "output": "1" }, { "input": "4 12", "output": "3" }, { "input": "8 224", "output": "6" }, { "input": "13 1368", "output": "4" }, { "input": "16 49152", "output": "15" }, { "input": "19 1024", "output": "11" }, { "input": "24 15204352", "output": "20" }, { "input": "27 6586544", "output": "5" }, { "input": "31 536870912", "output": "30" }, { "input": "38 94489280512", "output": "34" }, { "input": "42 215268308020", "output": "3" }, { "input": "42 3452074721280", "output": "21" }, { "input": "46 34394312982528", "output": "15" }, { "input": "48 133865540681728", "output": "39" }, { "input": "49 76541041985542", "output": "2" }, { "input": "49 104822971826176", "output": "34" }, { "input": "49 351843720888320", "output": "47" }, { "input": "50 743042492421629", "output": "1" }, { "input": "50 666266740436818", "output": "2" }, { "input": "50 704239287953456", "output": "5" }, { "input": "50 116938486513664", "output": "17" }, { "input": "50 806423059496960", "output": "37" }, { "input": "50 985162418487296", "output": "48" }, { "input": "50 844424930131968", "output": "49" }, { "input": "50 562949953421312", "output": "50" }, { "input": "50 1", "output": "1" }, { "input": "50 1125899906842623", "output": "1" }, { "input": "50 1125899906842620", "output": "3" }, { "input": "39 549755813887", "output": "1" }, { "input": "50 100000000000", "output": "12" } ]
1,647,545,722
2,147,483,647
Python 3
OK
TESTS
39
31
0
n,k = [int(i) for i in input().split(' ')] #ajustamos el index k = k-1 j = 1 while True: #Miramos si es par if k%2 == 0: print(j) break #realizamos unda division entera k = k // 2 j += 1
Title: Chloe and the sequence Time Limit: None seconds Memory Limit: None megabytes Problem Description: Chloe, the same as Vladik, is a competitive programmer. She didn't have any problems to get to the olympiad like Vladik, but she was confused by the task proposed on the olympiad. Let's consider the following algorithm of generating a sequence of integers. Initially we have a sequence consisting of a single element equal to 1. Then we perform (*n*<=-<=1) steps. On each step we take the sequence we've got on the previous step, append it to the end of itself and insert in the middle the minimum positive integer we haven't used before. For example, we get the sequence [1,<=2,<=1] after the first step, the sequence [1,<=2,<=1,<=3,<=1,<=2,<=1] after the second step. The task is to find the value of the element with index *k* (the elements are numbered from 1) in the obtained sequence, i.Β e. after (*n*<=-<=1) steps. Please help Chloe to solve the problem! Input Specification: The only line contains two integers *n* and *k* (1<=≀<=*n*<=≀<=50, 1<=≀<=*k*<=≀<=2*n*<=-<=1). Output Specification: Print single integerΒ β€” the integer at the *k*-th position in the obtained sequence. Demo Input: ['3 2\n', '4 8\n'] Demo Output: ['2', '4'] Note: In the first sample the obtained sequence is [1, 2, 1, 3, 1, 2, 1]. The number on the second position is 2. In the second sample the obtained sequence is [1, 2, 1, 3, 1, 2, 1, 4, 1, 2, 1, 3, 1, 2, 1]. The number on the eighth position is 4.
```python n,k = [int(i) for i in input().split(' ')] #ajustamos el index k = k-1 j = 1 while True: #Miramos si es par if k%2 == 0: print(j) break #realizamos unda division entera k = k // 2 j += 1 ```
3
305
B
Continued Fractions
PROGRAMMING
1,700
[ "brute force", "implementation", "math" ]
null
null
A continued fraction of height *n* is a fraction of form . You are given two rational numbers, one is represented as and the other one is represented as a finite fraction of height *n*. Check if they are equal.
The first line contains two space-separated integers *p*,<=*q* (1<=≀<=*q*<=≀<=*p*<=≀<=1018) β€” the numerator and the denominator of the first fraction. The second line contains integer *n* (1<=≀<=*n*<=≀<=90) β€” the height of the second fraction. The third line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=1018) β€” the continued fraction. Please, do not use the %lld specifier to read or write 64-bit integers in Π‘++. It is preferred to use the cin, cout streams or the %I64d specifier.
Print "YES" if these fractions are equal and "NO" otherwise.
[ "9 4\n2\n2 4\n", "9 4\n3\n2 3 1\n", "9 4\n3\n1 2 4\n" ]
[ "YES\n", "YES\n", "NO\n" ]
In the first sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/5ff92f27aebea2560d99ad61202d20bab5ee5390.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the second sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/221368c79c05fc0ecad4e5f7a64f30b832fd99f5.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the third sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4fb4b411afc0fbad27a1c8fdd08ba88ec3830ef5.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
1,000
[ { "input": "9 4\n2\n2 4", "output": "YES" }, { "input": "9 4\n3\n2 3 1", "output": "YES" }, { "input": "9 4\n3\n1 2 4", "output": "NO" }, { "input": "39088169 24157817\n36\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2", "output": "YES" }, { "input": "39088169 24157817\n36\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 4", "output": "NO" }, { "input": "61305790721611591 37889062373143906\n80\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 4", "output": "NO" }, { "input": "61305790721611591 37889062373143906\n80\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2", "output": "YES" }, { "input": "565049485241691020 228217260073568804\n40\n2 2 9 1 7 1 2 1 2 1 1 1 9 1 2 1 9 1 3 2 3 10 13 2 1 2 7 1 1 2 2 2 1 1 2 1 6 5 3 2", "output": "YES" }, { "input": "2 1\n4\n2 1 1 1", "output": "NO" }, { "input": "4 1\n2\n3 1", "output": "YES" }, { "input": "72723460248141 1597\n1\n45537545554", "output": "NO" }, { "input": "14930352 13\n6\n1148488 1 1 1 1 2", "output": "YES" }, { "input": "86267571272 102334155\n6\n842 1 841 1 842 145", "output": "NO" }, { "input": "72723460248141 121393\n7\n599074578 122 1 122 2 1 2", "output": "YES" }, { "input": "168455988218483660 53310571951833359\n32\n3 6 3 1 14 1 48 1 3 2 1 1 39 2 1 3 13 23 4 1 11 1 1 23 1 3 3 2 1 1 1 3", "output": "NO" }, { "input": "382460255113156464 275525972692563593\n37\n1 2 1 1 2 1 3 4 5 5 1 4 2 1 1 1 4 2 2 1 2 1 1 2 3 3 1 2 2 50 4 1 4 2 5 109 8", "output": "YES" }, { "input": "1000000000000000000 1\n1\n1000000000000000000", "output": "YES" }, { "input": "362912509915545727 266073193475139553\n30\n1 2 1 2 1 25 75 1 14 6 6 9 1 1 1 1 210 2 2 2 5 2 1 3 1 1 13 3 14 3", "output": "NO" }, { "input": "933329105990871495 607249523603826772\n33\n1 1 1 6 3 1 5 24 3 55 1 15 2 2 1 12 2 2 3 109 1 1 4 1 4 1 7 2 4 1 3 3 2", "output": "YES" }, { "input": "790637895857383456 679586240913926415\n40\n1 6 8 2 1 2 1 7 2 4 1 1 1 10 1 10 1 4 1 4 41 1 1 7 1 1 2 1 2 4 1 2 1 63 1 2 1 1 4 3", "output": "NO" }, { "input": "525403371166594848 423455864168639615\n38\n1 4 6 1 1 32 3 1 14 1 3 1 2 4 5 4 1 2 1 5 8 1 3 1 2 1 46 1 1 1 3 1 4 1 11 1 2 4", "output": "YES" }, { "input": "1 1\n1\n1", "output": "YES" }, { "input": "2 1\n2\n1 2", "output": "NO" }, { "input": "531983955813463755 371380136962341468\n38\n1 2 3 4 1 37 1 12 1 3 2 1 6 3 1 7 3 2 8 1 2 1 1 7 1 1 1 7 1 47 2 1 3 1 1 5 1 2", "output": "YES" }, { "input": "32951280099 987\n7\n33385288 1 5 1 5 1 6", "output": "YES" }, { "input": "6557470319842 86267571272\n6\n76 76 76 76 76 76", "output": "YES" }, { "input": "934648630114363087 6565775686518446\n31\n142 2 1 5 2 2 1 1 3 1 2 8 1 3 12 2 1 23 5 1 10 1 863 1 1 1 2 1 14 2 3", "output": "YES" }, { "input": "61305790721611591 37889062373143906\n81\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "YES" }, { "input": "4 1\n1\n4", "output": "YES" }, { "input": "500000000000000001 5\n2\n100000000000000000 5", "output": "YES" }, { "input": "1000000000000000000 3\n3\n3 4 5", "output": "NO" }, { "input": "822981258385599125 28316248989464296\n39\n29 15 1 1 1 4 4 4 1 3 1 5 12 1 1 1 1 1 6 5 2 1 11 1 1 26 1 2 2 2 14 1 1 1 3 2 4 1 1", "output": "NO" }, { "input": "823443107025550834 331822464812968648\n42\n2 2 13 14 4 4 1 1 1 1 2 1 1 1 1 113 1 1 8 1 1 1 1 2 2 1 15 1 5 1 1 2 1 1 1 14 4 3 1 5 1 1", "output": "NO" }, { "input": "226137305050296073 27076290603746056\n30\n8 2 1 5 3 67 2 1 6 1 2 1 5 1 11 8 43 2 1 7 1 95 2 3 1 11 5 2 1 1", "output": "NO" }, { "input": "524928871965838747 313083111434773473\n35\n1 1 2 10 1 4 12 3 28 1 23 1 1 1 4 1 4 3 1 3 2 3 1 4 3 1 3 2 3 11 21 1 35 1 1", "output": "NO" }, { "input": "633468529243155234 4\n90\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "NO" }, { "input": "742143496299253703 2\n90\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "NO" }, { "input": "550736960584023286 3\n90\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "NO" }, { "input": "2 1\n10\n99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999", "output": "NO" }, { "input": "262882295792523313 105000000000078855\n1\n105000000000078855", "output": "NO" }, { "input": "990130967049151695 166430169817556175\n1\n564668656008429569", "output": "NO" }, { "input": "9 4\n2\n2 3", "output": "NO" }, { "input": "529824479480396864 4705882352941177\n2\n80000000000000007 80000000000000009", "output": "NO" }, { "input": "985625905209512860 565433601688714177\n10\n6423 24947 27507 13031 16414 29169 901 32592 18763 1656", "output": "NO" }, { "input": "913255926290448385 4400000000\n2\n4400000000 4400000000", "output": "NO" }, { "input": "7 2\n2\n2 1", "output": "NO" }, { "input": "10 3\n1\n3", "output": "NO" }, { "input": "4 2\n1\n2", "output": "YES" }, { "input": "1337 42\n1\n31", "output": "NO" } ]
1,368,969,792
1,392
Python 3
OK
TESTS
49
78
102,400
p,q=tuple(map(int,input().split())) n1=input().split() n=int(n1[0]) a=list(map(int,input().split())) x=1 y=a[n-1] for i in range (n-2,-1,-1): x1=a[i]*y+x x=y y=x1 if p*x==q*y: print('YES') else: print('NO')
Title: Continued Fractions Time Limit: None seconds Memory Limit: None megabytes Problem Description: A continued fraction of height *n* is a fraction of form . You are given two rational numbers, one is represented as and the other one is represented as a finite fraction of height *n*. Check if they are equal. Input Specification: The first line contains two space-separated integers *p*,<=*q* (1<=≀<=*q*<=≀<=*p*<=≀<=1018) β€” the numerator and the denominator of the first fraction. The second line contains integer *n* (1<=≀<=*n*<=≀<=90) β€” the height of the second fraction. The third line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=1018) β€” the continued fraction. Please, do not use the %lld specifier to read or write 64-bit integers in Π‘++. It is preferred to use the cin, cout streams or the %I64d specifier. Output Specification: Print "YES" if these fractions are equal and "NO" otherwise. Demo Input: ['9 4\n2\n2 4\n', '9 4\n3\n2 3 1\n', '9 4\n3\n1 2 4\n'] Demo Output: ['YES\n', 'YES\n', 'NO\n'] Note: In the first sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/5ff92f27aebea2560d99ad61202d20bab5ee5390.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the second sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/221368c79c05fc0ecad4e5f7a64f30b832fd99f5.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the third sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4fb4b411afc0fbad27a1c8fdd08ba88ec3830ef5.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
```python p,q=tuple(map(int,input().split())) n1=input().split() n=int(n1[0]) a=list(map(int,input().split())) x=1 y=a[n-1] for i in range (n-2,-1,-1): x1=a[i]*y+x x=y y=x1 if p*x==q*y: print('YES') else: print('NO') ```
3
270
A
Fancy Fence
PROGRAMMING
1,100
[ "geometry", "implementation", "math" ]
null
null
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot. He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*. Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
The first line of input contains an integer *t* (0<=&lt;<=*t*<=&lt;<=180) β€” the number of tests. Each of the following *t* lines contains a single integer *a* (0<=&lt;<=*a*<=&lt;<=180) β€” the angle the robot can make corners at measured in degrees.
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
[ "3\n30\n60\n90\n" ]
[ "NO\nYES\nYES\n" ]
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the second test case, the fence is a regular triangle, and in the last test case β€” a square.
500
[ { "input": "3\n30\n60\n90", "output": "NO\nYES\nYES" }, { "input": "6\n1\n2\n3\n170\n179\n25", "output": "NO\nNO\nNO\nYES\nYES\nNO" } ]
1,632,821,223
2,147,483,647
Python 3
OK
TESTS
3
92
6,758,400
a=int(input()) list=[] while a!=0: b=int(input()) if 360%(180-b)!=0: list.append("NO") else: list.append("YES") a=a-1 for i in list: print(i)
Title: Fancy Fence Time Limit: None seconds Memory Limit: None megabytes Problem Description: Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot. He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*. Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*? Input Specification: The first line of input contains an integer *t* (0<=&lt;<=*t*<=&lt;<=180) β€” the number of tests. Each of the following *t* lines contains a single integer *a* (0<=&lt;<=*a*<=&lt;<=180) β€” the angle the robot can make corners at measured in degrees. Output Specification: For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible. Demo Input: ['3\n30\n60\n90\n'] Demo Output: ['NO\nYES\nYES\n'] Note: In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the second test case, the fence is a regular triangle, and in the last test case β€” a square.
```python a=int(input()) list=[] while a!=0: b=int(input()) if 360%(180-b)!=0: list.append("NO") else: list.append("YES") a=a-1 for i in list: print(i) ```
3
869
B
The Eternal Immortality
PROGRAMMING
1,100
[ "math" ]
null
null
Even if the world is full of counterfeits, I still regard it as wonderful. Pile up herbs and incense, and arise again from the flames and ashes of its predecessorΒ β€” as is known to many, the phoenix does it like this. The phoenix has a rather long lifespan, and reincarnates itself once every *a*! years. Here *a*! denotes the factorial of integer *a*, that is, *a*!<==<=1<=Γ—<=2<=Γ—<=...<=Γ—<=*a*. Specifically, 0!<==<=1. Koyomi doesn't care much about this, but before he gets into another mess with oddities, he is interested in the number of times the phoenix will reincarnate in a timespan of *b*! years, that is, . Note that when *b*<=β‰₯<=*a* this value is always integer. As the answer can be quite large, it would be enough for Koyomi just to know the last digit of the answer in decimal representation. And you're here to provide Koyomi with this knowledge.
The first and only line of input contains two space-separated integers *a* and *b* (0<=≀<=*a*<=≀<=*b*<=≀<=1018).
Output one line containing a single decimal digitΒ β€” the last digit of the value that interests Koyomi.
[ "2 4\n", "0 10\n", "107 109\n" ]
[ "2\n", "0\n", "2\n" ]
In the first example, the last digit of <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/99c47ca8b182f097e38094d12f0c06ce0b081b76.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 2; In the second example, the last digit of <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9642ef11a23e7c5a3f3c2b1255c1b1b3533802a4.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 0; In the third example, the last digit of <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/844938cef52ee264c183246d2a9df05cca94dc60.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 2.
1,000
[ { "input": "2 4", "output": "2" }, { "input": "0 10", "output": "0" }, { "input": "107 109", "output": "2" }, { "input": "10 13", "output": "6" }, { "input": "998244355 998244359", "output": "4" }, { "input": "999999999000000000 1000000000000000000", "output": "0" }, { "input": "2 3", "output": "3" }, { "input": "3 15", "output": "0" }, { "input": "24 26", "output": "0" }, { "input": "14 60", "output": "0" }, { "input": "11 79", "output": "0" }, { "input": "1230 1232", "output": "2" }, { "input": "2633 2634", "output": "4" }, { "input": "535 536", "output": "6" }, { "input": "344319135 396746843", "output": "0" }, { "input": "696667767 696667767", "output": "1" }, { "input": "419530302 610096911", "output": "0" }, { "input": "238965115 821731161", "output": "0" }, { "input": "414626436 728903812", "output": "0" }, { "input": "274410639 293308324", "output": "0" }, { "input": "650636673091305697 650636673091305702", "output": "0" }, { "input": "651240548333620923 651240548333620924", "output": "4" }, { "input": "500000000000000000 1000000000000000000", "output": "0" }, { "input": "999999999999999999 1000000000000000000", "output": "0" }, { "input": "1000000000000000000 1000000000000000000", "output": "1" }, { "input": "0 4", "output": "4" }, { "input": "50000000062000007 50000000062000011", "output": "0" }, { "input": "0 0", "output": "1" }, { "input": "1 1", "output": "1" }, { "input": "0 2", "output": "2" }, { "input": "10000000000012 10000000000015", "output": "0" }, { "input": "5 5", "output": "1" }, { "input": "12 23", "output": "0" }, { "input": "0 11", "output": "0" }, { "input": "11111234567890 11111234567898", "output": "0" }, { "input": "0 3", "output": "6" }, { "input": "1 2", "output": "2" }, { "input": "999999999999999997 999999999999999999", "output": "2" }, { "input": "4 5", "output": "5" }, { "input": "0 1", "output": "1" }, { "input": "101 1002", "output": "0" }, { "input": "0 100000000000000001", "output": "0" }, { "input": "99999999999999997 99999999999999999", "output": "2" }, { "input": "14 15", "output": "5" }, { "input": "8 19", "output": "0" }, { "input": "12 22", "output": "0" }, { "input": "999999999999996 999999999999999", "output": "4" }, { "input": "1 3", "output": "6" }, { "input": "124 125", "output": "5" }, { "input": "11 32", "output": "0" }, { "input": "0 5", "output": "0" }, { "input": "0 999999", "output": "0" }, { "input": "151151151515 151151151526", "output": "0" }, { "input": "6 107", "output": "0" }, { "input": "5 16", "output": "0" }, { "input": "7 16", "output": "0" }, { "input": "6 19", "output": "0" }, { "input": "11113111111111 13111111111111", "output": "0" }, { "input": "1 1000", "output": "0" }, { "input": "24 25", "output": "5" }, { "input": "0 100000000000", "output": "0" }, { "input": "1 22", "output": "0" }, { "input": "999999999999999996 999999999999999999", "output": "4" } ]
1,671,809,789
2,147,483,647
Python 3
OK
TESTS
63
46
0
c = 1 x , y = [int(i) for i in input().split()] # input -> x , input -> y if(y - x >= 5): # Here ?? print(0) # like 0 10 else: for _ in range(x + 1, y + 1): # 1 2 3 4 5 6 7 8 9 10 11 == num > num[-1] c *= _ print(c % 10) # num[-1] =>= c % 10 =>= str(c)[-1]
Title: The Eternal Immortality Time Limit: None seconds Memory Limit: None megabytes Problem Description: Even if the world is full of counterfeits, I still regard it as wonderful. Pile up herbs and incense, and arise again from the flames and ashes of its predecessorΒ β€” as is known to many, the phoenix does it like this. The phoenix has a rather long lifespan, and reincarnates itself once every *a*! years. Here *a*! denotes the factorial of integer *a*, that is, *a*!<==<=1<=Γ—<=2<=Γ—<=...<=Γ—<=*a*. Specifically, 0!<==<=1. Koyomi doesn't care much about this, but before he gets into another mess with oddities, he is interested in the number of times the phoenix will reincarnate in a timespan of *b*! years, that is, . Note that when *b*<=β‰₯<=*a* this value is always integer. As the answer can be quite large, it would be enough for Koyomi just to know the last digit of the answer in decimal representation. And you're here to provide Koyomi with this knowledge. Input Specification: The first and only line of input contains two space-separated integers *a* and *b* (0<=≀<=*a*<=≀<=*b*<=≀<=1018). Output Specification: Output one line containing a single decimal digitΒ β€” the last digit of the value that interests Koyomi. Demo Input: ['2 4\n', '0 10\n', '107 109\n'] Demo Output: ['2\n', '0\n', '2\n'] Note: In the first example, the last digit of <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/99c47ca8b182f097e38094d12f0c06ce0b081b76.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 2; In the second example, the last digit of <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9642ef11a23e7c5a3f3c2b1255c1b1b3533802a4.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 0; In the third example, the last digit of <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/844938cef52ee264c183246d2a9df05cca94dc60.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 2.
```python c = 1 x , y = [int(i) for i in input().split()] # input -> x , input -> y if(y - x >= 5): # Here ?? print(0) # like 0 10 else: for _ in range(x + 1, y + 1): # 1 2 3 4 5 6 7 8 9 10 11 == num > num[-1] c *= _ print(c % 10) # num[-1] =>= c % 10 =>= str(c)[-1] ```
3
595
A
Vitaly and Night
PROGRAMMING
800
[ "constructive algorithms", "implementation" ]
null
null
One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment. Vitaly sees a building of *n* floors and 2Β·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2Β·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2Β·*j*<=-<=1 and 2Β·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on. Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping.
The first line of the input contains two integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=100)Β β€” the number of floors in the house and the number of flats on each floor respectively. Next *n* lines describe the floors from top to bottom and contain 2Β·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'.
Print a single integerΒ β€” the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping.
[ "2 2\n0 0 0 1\n1 0 1 1\n", "1 3\n1 1 0 1 0 0\n" ]
[ "3\n", "2\n" ]
In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off. In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off.
500
[ { "input": "2 2\n0 0 0 1\n1 0 1 1", "output": "3" }, { "input": "1 3\n1 1 0 1 0 0", "output": "2" }, { "input": "3 3\n1 1 1 1 1 1\n1 1 0 1 1 0\n1 0 0 0 1 1", "output": "8" }, { "input": "1 5\n1 0 1 1 1 0 1 1 1 1", "output": "5" }, { "input": "1 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 0 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "99" }, { "input": "1 100\n0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "6" }, { "input": "1 100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "100 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "100" }, { "input": "100 1\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0", "output": "8" }, { "input": "100 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "1 1\n0 0", "output": "0" }, { "input": "1 1\n0 1", "output": "1" }, { "input": "1 1\n1 0", "output": "1" }, { "input": "1 1\n1 1", "output": "1" } ]
1,553,338,530
2,147,483,647
Python 3
OK
TESTS
36
124
102,400
# import sys # sys.stdin=open("input.in",'r') # sys.stdout=open("outp.out",'w') n,m=map(int,input().split()) c=0 for i in range(n): s=list(map(int,input().split())) x=0 while x<2*m: if s[x]==1 or s[x+1]==1: c+=1 x+=2 print(c)
Title: Vitaly and Night Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment. Vitaly sees a building of *n* floors and 2Β·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2Β·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2Β·*j*<=-<=1 and 2Β·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on. Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping. Input Specification: The first line of the input contains two integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=100)Β β€” the number of floors in the house and the number of flats on each floor respectively. Next *n* lines describe the floors from top to bottom and contain 2Β·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'. Output Specification: Print a single integerΒ β€” the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping. Demo Input: ['2 2\n0 0 0 1\n1 0 1 1\n', '1 3\n1 1 0 1 0 0\n'] Demo Output: ['3\n', '2\n'] Note: In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off. In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off.
```python # import sys # sys.stdin=open("input.in",'r') # sys.stdout=open("outp.out",'w') n,m=map(int,input().split()) c=0 for i in range(n): s=list(map(int,input().split())) x=0 while x<2*m: if s[x]==1 or s[x+1]==1: c+=1 x+=2 print(c) ```
3
44
A
Indian Summer
PROGRAMMING
900
[ "implementation" ]
A. Indian Summer
2
256
Indian summer is such a beautiful time of the year! A girl named Alyona is walking in the forest and picking a bouquet from fallen leaves. Alyona is very choosy β€” she doesn't take a leaf if it matches the color and the species of the tree of one of the leaves she already has. Find out how many leaves Alyona has picked.
The first line contains an integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of leaves Alyona has found. The next *n* lines contain the leaves' descriptions. Each leaf is characterized by the species of the tree it has fallen from and by the color. The species of the trees and colors are given in names, consisting of no more than 10 lowercase Latin letters. A name can not be an empty string. The species of a tree and the color are given in each line separated by a space.
Output the single number β€” the number of Alyona's leaves.
[ "5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green\n", "3\noak yellow\noak yellow\noak yellow\n" ]
[ "4\n", "1\n" ]
none
0
[ { "input": "5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green", "output": "4" }, { "input": "3\noak yellow\noak yellow\noak yellow", "output": "1" }, { "input": "5\nxbnbkzn hp\nkaqkl vrgzbvqstu\nj aqidx\nhos gyul\nwefxmh tygpluae", "output": "5" }, { "input": "1\nqvwli hz", "output": "1" }, { "input": "4\nsrhk x\nsrhk x\nqfoe vnrjuab\nqfoe vnrjuab", "output": "2" }, { "input": "4\nsddqllmmpk syded\nfprsq fnenjnaz\nn hdej\nsddqllmmpk syded", "output": "3" }, { "input": "17\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw", "output": "1" }, { "input": "18\nb d\nrfdb esp\nrfdb esp\nb d\nrfdb esp\nrfdb esp\nb d\nb d\nrfdb esp\nrfdb esp\nb d\nrfdb esp\nb d\nrfdb esp\nb d\nb d\nrfdb esp\nrfdb esp", "output": "2" }, { "input": "13\nsvpzwtwn rykzfdce\nqweiyeck jkreouy\nhk nnli\ntwxrnbbdt vtuv\nxokqjtylly sz\nesdt dbfidjslq\ng ybqgomvw\nxcpfjmf zcqvz\nifajadhj invzueip\nvdemdnxifb hckwebmi\nsdpnhipam wvowzavh\nuqdlfskhgo vunbpghae\ne dtigwnb", "output": "13" }, { "input": "20\nm vkfh\nvptikamead mvx\nitu mf\nklruxckw aqega\nekqkd enjllwol\ncc uybfdh\nimrfdngvo u\ne uh\ntwt jsslcfuogk\nbljwqsag tuqbdn\nqcv q\nasx gzhvwwmajj\nqcv q\nekqkd enjllwol\nasx gzhvwwmajj\nks vv\nkzyfi cn\ncc uybfdh\nitu mf\ncjbjhtbyvk vatwfmux", "output": "15" }, { "input": "2\nab ab\na bab", "output": "2" } ]
1,647,105,706
2,147,483,647
Python 3
OK
TESTS
29
92
0
ll=set() for _ in range(int(input())): ll.add(input()) print(len(ll))
Title: Indian Summer Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Indian summer is such a beautiful time of the year! A girl named Alyona is walking in the forest and picking a bouquet from fallen leaves. Alyona is very choosy β€” she doesn't take a leaf if it matches the color and the species of the tree of one of the leaves she already has. Find out how many leaves Alyona has picked. Input Specification: The first line contains an integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of leaves Alyona has found. The next *n* lines contain the leaves' descriptions. Each leaf is characterized by the species of the tree it has fallen from and by the color. The species of the trees and colors are given in names, consisting of no more than 10 lowercase Latin letters. A name can not be an empty string. The species of a tree and the color are given in each line separated by a space. Output Specification: Output the single number β€” the number of Alyona's leaves. Demo Input: ['5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green\n', '3\noak yellow\noak yellow\noak yellow\n'] Demo Output: ['4\n', '1\n'] Note: none
```python ll=set() for _ in range(int(input())): ll.add(input()) print(len(ll)) ```
3.977
41
A
Translation
PROGRAMMING
800
[ "implementation", "strings" ]
A. Translation
2
256
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the Β«translationΒ». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
[ "code\nedoc\n", "abb\naba\n", "code\ncode\n" ]
[ "YES\n", "NO\n", "NO\n" ]
none
500
[ { "input": "code\nedoc", "output": "YES" }, { "input": "abb\naba", "output": "NO" }, { "input": "code\ncode", "output": "NO" }, { "input": "abacaba\nabacaba", "output": "YES" }, { "input": "q\nq", "output": "YES" }, { "input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk", "output": "NO" }, { "input": "z\na", "output": "NO" }, { "input": "asd\ndsa", "output": "YES" }, { "input": "abcdef\nfecdba", "output": "NO" }, { "input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu", "output": "NO" }, { "input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf", "output": "NO" }, { "input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp", "output": "NO" }, { "input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb", "output": "NO" }, { "input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom", "output": "NO" }, { "input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh", "output": "NO" }, { "input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy", "output": "NO" }, { "input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko", "output": "NO" }, { "input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv", "output": "NO" }, { "input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd", "output": "NO" }, { "input": "w\nw", "output": "YES" }, { "input": "vz\nzv", "output": "YES" }, { "input": "ry\nyr", "output": "YES" }, { "input": "xou\nuox", "output": "YES" }, { "input": "axg\ngax", "output": "NO" }, { "input": "zdsl\nlsdz", "output": "YES" }, { "input": "kudl\nldku", "output": "NO" }, { "input": "zzlzwnqlcl\nlclqnwzlzz", "output": "YES" }, { "input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv", "output": "YES" }, { "input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar", "output": "NO" }, { "input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn", "output": "YES" }, { "input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum", "output": "YES" }, { "input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv", "output": "YES" }, { "input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm", "output": "NO" }, { "input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd", "output": "NO" }, { "input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg", "output": "YES" }, { "input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis", "output": "YES" }, { "input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy", "output": "NO" }, { "input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw", "output": "YES" }, { "input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi", "output": "YES" }, { "input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib", "output": "YES" } ]
1,600,049,392
2,147,483,647
Python 3
OK
TESTS
40
218
0
s = input() t = input() tl = len(t)-1 ans = 1 for i in range(len(s)): if(s[i] != t[tl]): ans = 0 break tl -= 1 if(ans == 1): print("YES") else: print("NO")
Title: Translation Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the Β«translationΒ». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. Input Specification: The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. Output Specification: If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. Demo Input: ['code\nedoc\n', 'abb\naba\n', 'code\ncode\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none
```python s = input() t = input() tl = len(t)-1 ans = 1 for i in range(len(s)): if(s[i] != t[tl]): ans = 0 break tl -= 1 if(ans == 1): print("YES") else: print("NO") ```
3.9455
460
A
Vasya and Socks
PROGRAMMING
900
[ "brute force", "implementation", "math" ]
null
null
Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks?
The single line contains two integers *n* and *m* (1<=≀<=*n*<=≀<=100;Β 2<=≀<=*m*<=≀<=100), separated by a space.
Print a single integer β€” the answer to the problem.
[ "2 2\n", "9 3\n" ]
[ "3\n", "13\n" ]
In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two. In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day.
500
[ { "input": "2 2", "output": "3" }, { "input": "9 3", "output": "13" }, { "input": "1 2", "output": "1" }, { "input": "2 3", "output": "2" }, { "input": "1 99", "output": "1" }, { "input": "4 4", "output": "5" }, { "input": "10 2", "output": "19" }, { "input": "10 9", "output": "11" }, { "input": "100 100", "output": "101" }, { "input": "2 27", "output": "2" }, { "input": "99 100", "output": "99" }, { "input": "99 2", "output": "197" }, { "input": "100 3", "output": "149" }, { "input": "98 3", "output": "146" }, { "input": "4 4", "output": "5" }, { "input": "100 2", "output": "199" }, { "input": "62 4", "output": "82" }, { "input": "99 10", "output": "109" }, { "input": "100 5", "output": "124" }, { "input": "80 80", "output": "81" }, { "input": "95 16", "output": "101" }, { "input": "75 16", "output": "79" }, { "input": "99 74", "output": "100" }, { "input": "20 21", "output": "20" }, { "input": "52 96", "output": "52" }, { "input": "24 5", "output": "29" } ]
1,676,578,704
2,147,483,647
Python 3
OK
TESTS
26
46
0
n , m = map(int,input().split()) days = 0 while n!=0: days+=1 if days%m==0: pass else: n-=1 print(days)
Title: Vasya and Socks Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks? Input Specification: The single line contains two integers *n* and *m* (1<=≀<=*n*<=≀<=100;Β 2<=≀<=*m*<=≀<=100), separated by a space. Output Specification: Print a single integer β€” the answer to the problem. Demo Input: ['2 2\n', '9 3\n'] Demo Output: ['3\n', '13\n'] Note: In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two. In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day.
```python n , m = map(int,input().split()) days = 0 while n!=0: days+=1 if days%m==0: pass else: n-=1 print(days) ```
3
747
A
Display Size
PROGRAMMING
800
[ "brute force", "math" ]
null
null
A big company decided to launch a new series of rectangular displays, and decided that the display must have exactly *n* pixels. Your task is to determine the size of the rectangular display β€” the number of lines (rows) of pixels *a* and the number of columns of pixels *b*, so that: - there are exactly *n* pixels on the display; - the number of rows does not exceed the number of columns, it means *a*<=≀<=*b*; - the difference *b*<=-<=*a* is as small as possible.
The first line contains the positive integer *n* (1<=≀<=*n*<=≀<=106)Β β€” the number of pixels display should have.
Print two integersΒ β€” the number of rows and columns on the display.
[ "8\n", "64\n", "5\n", "999999\n" ]
[ "2 4\n", "8 8\n", "1 5\n", "999 1001\n" ]
In the first example the minimum possible difference equals 2, so on the display should be 2 rows of 4 pixels. In the second example the minimum possible difference equals 0, so on the display should be 8 rows of 8 pixels. In the third example the minimum possible difference equals 4, so on the display should be 1 row of 5 pixels.
500
[ { "input": "8", "output": "2 4" }, { "input": "64", "output": "8 8" }, { "input": "5", "output": "1 5" }, { "input": "999999", "output": "999 1001" }, { "input": "716539", "output": "97 7387" }, { "input": "1", "output": "1 1" }, { "input": "2", "output": "1 2" }, { "input": "3", "output": "1 3" }, { "input": "4", "output": "2 2" }, { "input": "6", "output": "2 3" }, { "input": "7", "output": "1 7" }, { "input": "9", "output": "3 3" }, { "input": "10", "output": "2 5" }, { "input": "11", "output": "1 11" }, { "input": "12", "output": "3 4" }, { "input": "15", "output": "3 5" }, { "input": "100", "output": "10 10" }, { "input": "101", "output": "1 101" }, { "input": "169", "output": "13 13" }, { "input": "179", "output": "1 179" }, { "input": "190", "output": "10 19" }, { "input": "1000", "output": "25 40" }, { "input": "10000", "output": "100 100" }, { "input": "10001", "output": "73 137" }, { "input": "100000", "output": "250 400" }, { "input": "100001", "output": "11 9091" }, { "input": "1000000", "output": "1000 1000" }, { "input": "999983", "output": "1 999983" }, { "input": "524288", "output": "512 1024" }, { "input": "954493", "output": "971 983" }, { "input": "966289", "output": "983 983" }, { "input": "944663", "output": "961 983" }, { "input": "912673", "output": "97 9409" }, { "input": "732641", "output": "679 1079" }, { "input": "232897", "output": "343 679" }, { "input": "16807", "output": "49 343" }, { "input": "999958", "output": "2 499979" }, { "input": "990151", "output": "1 990151" }, { "input": "997002", "output": "998 999" }, { "input": "20", "output": "4 5" }, { "input": "20261", "output": "1 20261" }, { "input": "999123", "output": "3 333041" }, { "input": "901841", "output": "1 901841" } ]
1,660,334,531
2,147,483,647
PyPy 3
OK
TESTS
43
77
0
from cmath import sqrt def solves(): n=int(input()) m=1 temp=int(n**0.5) for i in range(1,temp+1): if n%i==0: m=max(m,i) print(m,n//m) for _ in range(1): solves()
Title: Display Size Time Limit: None seconds Memory Limit: None megabytes Problem Description: A big company decided to launch a new series of rectangular displays, and decided that the display must have exactly *n* pixels. Your task is to determine the size of the rectangular display β€” the number of lines (rows) of pixels *a* and the number of columns of pixels *b*, so that: - there are exactly *n* pixels on the display; - the number of rows does not exceed the number of columns, it means *a*<=≀<=*b*; - the difference *b*<=-<=*a* is as small as possible. Input Specification: The first line contains the positive integer *n* (1<=≀<=*n*<=≀<=106)Β β€” the number of pixels display should have. Output Specification: Print two integersΒ β€” the number of rows and columns on the display. Demo Input: ['8\n', '64\n', '5\n', '999999\n'] Demo Output: ['2 4\n', '8 8\n', '1 5\n', '999 1001\n'] Note: In the first example the minimum possible difference equals 2, so on the display should be 2 rows of 4 pixels. In the second example the minimum possible difference equals 0, so on the display should be 8 rows of 8 pixels. In the third example the minimum possible difference equals 4, so on the display should be 1 row of 5 pixels.
```python from cmath import sqrt def solves(): n=int(input()) m=1 temp=int(n**0.5) for i in range(1,temp+1): if n%i==0: m=max(m,i) print(m,n//m) for _ in range(1): solves() ```
3
755
B
PolandBall and Game
PROGRAMMING
1,100
[ "binary search", "data structures", "games", "greedy", "sortings", "strings" ]
null
null
PolandBall is playing a game with EnemyBall. The rules are simple. Players have to say words in turns. You cannot say a word which was already said. PolandBall starts. The Ball which can't say a new word loses. You're given two lists of words familiar to PolandBall and EnemyBall. Can you determine who wins the game, if both play optimally?
The first input line contains two integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=103)Β β€” number of words PolandBall and EnemyBall know, respectively. Then *n* strings follow, one per lineΒ β€” words familiar to PolandBall. Then *m* strings follow, one per lineΒ β€” words familiar to EnemyBall. Note that one Ball cannot know a word more than once (strings are unique), but some words can be known by both players. Each word is non-empty and consists of no more than 500 lowercase English alphabet letters.
In a single line of print the answerΒ β€” "YES" if PolandBall wins and "NO" otherwise. Both Balls play optimally.
[ "5 1\npolandball\nis\na\ncool\ncharacter\nnope\n", "2 2\nkremowka\nwadowicka\nkremowka\nwiedenska\n", "1 2\na\na\nb\n" ]
[ "YES", "YES", "NO" ]
In the first example PolandBall knows much more words and wins effortlessly. In the second example if PolandBall says kremowka first, then EnemyBall cannot use that word anymore. EnemyBall can only say wiedenska. PolandBall says wadowicka and wins.
1,000
[ { "input": "5 1\npolandball\nis\na\ncool\ncharacter\nnope", "output": "YES" }, { "input": "2 2\nkremowka\nwadowicka\nkremowka\nwiedenska", "output": "YES" }, { "input": "1 2\na\na\nb", "output": "NO" }, { "input": "2 2\na\nb\nb\nc", "output": "YES" }, { "input": "2 1\nc\na\na", "output": "YES" }, { "input": "3 3\nab\nbc\ncd\ncd\ndf\nfg", "output": "YES" }, { "input": "3 3\nc\na\nb\na\nd\ng", "output": "YES" }, { "input": "1 1\naa\naa", "output": "YES" }, { "input": "2 1\na\nb\na", "output": "YES" }, { "input": "6 5\na\nb\nc\nd\ne\nf\nf\ne\nd\nz\ny", "output": "YES" }, { "input": "3 2\na\nb\nc\nd\ne", "output": "YES" } ]
1,673,113,537
2,147,483,647
Python 3
OK
TESTS
33
46
512,000
import sys input = lambda: sys.stdin.readline().strip() n, m = map(int, input().split()) pol, com = set(), 0 for _ in range(n): pol.add(input()) for _ in range(m): com += input() in pol n += com & 1 if n > m: print("YES") else: print("NO")
Title: PolandBall and Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: PolandBall is playing a game with EnemyBall. The rules are simple. Players have to say words in turns. You cannot say a word which was already said. PolandBall starts. The Ball which can't say a new word loses. You're given two lists of words familiar to PolandBall and EnemyBall. Can you determine who wins the game, if both play optimally? Input Specification: The first input line contains two integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=103)Β β€” number of words PolandBall and EnemyBall know, respectively. Then *n* strings follow, one per lineΒ β€” words familiar to PolandBall. Then *m* strings follow, one per lineΒ β€” words familiar to EnemyBall. Note that one Ball cannot know a word more than once (strings are unique), but some words can be known by both players. Each word is non-empty and consists of no more than 500 lowercase English alphabet letters. Output Specification: In a single line of print the answerΒ β€” "YES" if PolandBall wins and "NO" otherwise. Both Balls play optimally. Demo Input: ['5 1\npolandball\nis\na\ncool\ncharacter\nnope\n', '2 2\nkremowka\nwadowicka\nkremowka\nwiedenska\n', '1 2\na\na\nb\n'] Demo Output: ['YES', 'YES', 'NO'] Note: In the first example PolandBall knows much more words and wins effortlessly. In the second example if PolandBall says kremowka first, then EnemyBall cannot use that word anymore. EnemyBall can only say wiedenska. PolandBall says wadowicka and wins.
```python import sys input = lambda: sys.stdin.readline().strip() n, m = map(int, input().split()) pol, com = set(), 0 for _ in range(n): pol.add(input()) for _ in range(m): com += input() in pol n += com & 1 if n > m: print("YES") else: print("NO") ```
3
1,010
A
Fly
PROGRAMMING
1,500
[ "binary search", "math" ]
null
null
Natasha is going to fly on a rocket to Mars and return to Earth. Also, on the way to Mars, she will land on $n - 2$ intermediate planets. Formally: we number all the planets from $1$ to $n$. $1$ is Earth, $n$ is Mars. Natasha will make exactly $n$ flights: $1 \to 2 \to \ldots n \to 1$. Flight from $x$ to $y$ consists of two phases: take-off from planet $x$ and landing to planet $y$. This way, the overall itinerary of the trip will be: the $1$-st planet $\to$ take-off from the $1$-st planet $\to$ landing to the $2$-nd planet $\to$ $2$-nd planet $\to$ take-off from the $2$-nd planet $\to$ $\ldots$ $\to$ landing to the $n$-th planet $\to$ the $n$-th planet $\to$ take-off from the $n$-th planet $\to$ landing to the $1$-st planet $\to$ the $1$-st planet. The mass of the rocket together with all the useful cargo (but without fuel) is $m$ tons. However, Natasha does not know how much fuel to load into the rocket. Unfortunately, fuel can only be loaded on Earth, so if the rocket runs out of fuel on some other planet, Natasha will not be able to return home. Fuel is needed to take-off from each planet and to land to each planet. It is known that $1$ ton of fuel can lift off $a_i$ tons of rocket from the $i$-th planet or to land $b_i$ tons of rocket onto the $i$-th planet. For example, if the weight of rocket is $9$ tons, weight of fuel is $3$ tons and take-off coefficient is $8$ ($a_i = 8$), then $1.5$ tons of fuel will be burnt (since $1.5 \cdot 8 = 9 + 3$). The new weight of fuel after take-off will be $1.5$ tons. Please note, that it is allowed to burn non-integral amount of fuel during take-off or landing, and the amount of initial fuel can be non-integral as well. Help Natasha to calculate the minimum mass of fuel to load into the rocket. Note, that the rocket must spend fuel to carry both useful cargo and the fuel itself. However, it doesn't need to carry the fuel which has already been burnt. Assume, that the rocket takes off and lands instantly.
The first line contains a single integer $n$ ($2 \le n \le 1000$)Β β€” number of planets. The second line contains the only integer $m$ ($1 \le m \le 1000$)Β β€” weight of the payload. The third line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \le a_i \le 1000$), where $a_i$ is the number of tons, which can be lifted off by one ton of fuel. The fourth line contains $n$ integers $b_1, b_2, \ldots, b_n$ ($1 \le b_i \le 1000$), where $b_i$ is the number of tons, which can be landed by one ton of fuel. It is guaranteed, that if Natasha can make a flight, then it takes no more than $10^9$ tons of fuel.
If Natasha can fly to Mars through $(n - 2)$ planets and return to Earth, print the minimum mass of fuel (in tons) that Natasha should take. Otherwise, print a single number $-1$. It is guaranteed, that if Natasha can make a flight, then it takes no more than $10^9$ tons of fuel. The answer will be considered correct if its absolute or relative error doesn't exceed $10^{-6}$. Formally, let your answer be $p$, and the jury's answer be $q$. Your answer is considered correct if $\frac{|p - q|}{\max{(1, |q|)}} \le 10^{-6}$.
[ "2\n12\n11 8\n7 5\n", "3\n1\n1 4 1\n2 5 3\n", "6\n2\n4 6 3 3 5 6\n2 6 3 6 5 3\n" ]
[ "10.0000000000\n", "-1\n", "85.4800000000\n" ]
Let's consider the first example. Initially, the mass of a rocket with fuel is $22$ tons. - At take-off from Earth one ton of fuel can lift off $11$ tons of cargo, so to lift off $22$ tons you need to burn $2$ tons of fuel. Remaining weight of the rocket with fuel is $20$ tons.- During landing on Mars, one ton of fuel can land $5$ tons of cargo, so for landing $20$ tons you will need to burn $4$ tons of fuel. There will be $16$ tons of the rocket with fuel remaining.- While taking off from Mars, one ton of fuel can raise $8$ tons of cargo, so to lift off $16$ tons you will need to burn $2$ tons of fuel. There will be $14$ tons of rocket with fuel after that.- During landing on Earth, one ton of fuel can land $7$ tons of cargo, so for landing $14$ tons you will need to burn $2$ tons of fuel. Remaining weight is $12$ tons, that is, a rocket without any fuel. In the second case, the rocket will not be able even to take off from Earth.
500
[ { "input": "2\n12\n11 8\n7 5", "output": "10.0000000000" }, { "input": "3\n1\n1 4 1\n2 5 3", "output": "-1" }, { "input": "6\n2\n4 6 3 3 5 6\n2 6 3 6 5 3", "output": "85.4800000000" }, { "input": "3\n3\n1 2 1\n2 2 2", "output": "-1" }, { "input": "4\n4\n2 3 2 2\n2 3 4 3", "output": "284.0000000000" }, { "input": "5\n2\n1 2 2 1 2\n4 5 1 4 1", "output": "-1" }, { "input": "7\n7\n3 2 6 2 2 2 5\n4 7 5 6 2 2 2", "output": "4697.0000000000" }, { "input": "2\n1000\n12 34\n56 78", "output": "159.2650775220" }, { "input": "8\n4\n1 1 4 1 3 1 8 1\n1 1 1 1 1 3 1 2", "output": "-1" }, { "input": "9\n2\n8 7 1 1 3 7 1 2 4\n4 1 1 8 7 7 1 1 5", "output": "-1" }, { "input": "10\n10\n9 8 8 7 2 10 2 9 2 4\n3 10 6 2 6 6 5 9 4 5", "output": "3075.7142857143" }, { "input": "20\n12\n3 9 12 13 16 18 9 9 19 7 2 5 17 14 7 7 15 16 5 7\n16 9 13 5 14 10 4 3 16 16 12 20 17 11 4 5 5 14 6 15", "output": "4670.8944493007" }, { "input": "30\n5\n25 1 28 1 27 25 24 1 28 1 12 1 29 16 1 1 1 1 27 1 24 1 1 1 1 1 1 1 30 3\n1 22 1 1 24 2 13 1 16 21 1 27 14 16 1 1 7 1 1 18 1 23 10 1 15 16 16 15 10 1", "output": "-1" }, { "input": "40\n13\n1 1 1 23 21 1 1 1 1 1 40 32 1 21 1 8 1 1 36 15 33 1 30 1 1 37 22 1 4 39 7 1 9 37 1 1 1 28 1 1\n1 34 17 1 38 20 8 14 1 18 29 3 21 21 18 14 1 11 1 1 23 1 25 1 14 1 7 31 9 20 25 1 1 1 1 8 26 12 1 1", "output": "-1" }, { "input": "50\n19\n17 7 13 42 19 25 10 25 2 36 17 40 30 48 34 43 34 20 5 15 8 7 43 35 21 40 40 19 30 11 49 7 24 23 43 30 38 49 10 8 30 11 28 50 48 25 25 20 48 24\n49 35 10 22 24 50 50 7 6 13 16 35 12 43 50 44 35 33 38 49 26 18 23 37 7 38 23 20 28 48 41 16 6 32 32 34 11 39 38 9 38 23 16 31 37 47 33 20 46 30", "output": "7832.1821424977" }, { "input": "60\n21\n11 35 1 28 39 13 19 56 13 13 21 25 1 1 23 1 52 26 53 1 1 1 30 39 1 7 1 1 3 1 1 10 1 1 37 1 1 25 1 1 1 53 1 3 48 1 6 5 4 15 1 14 25 53 25 38 27 1 1 1\n1 1 1 35 40 58 10 22 1 56 1 59 1 6 33 1 1 1 1 18 14 1 1 40 25 47 1 34 1 1 53 1 1 25 1 45 1 1 25 34 3 1 1 1 53 27 11 58 1 1 1 10 12 1 1 1 31 52 1 1", "output": "-1" }, { "input": "70\n69\n70 66 57 58 24 60 39 2 48 61 65 22 10 26 68 62 48 25 12 14 45 57 6 30 48 15 46 33 42 28 69 42 64 25 24 8 62 12 68 53 55 20 32 70 3 5 41 49 16 26 2 34 34 20 39 65 18 47 62 31 39 28 61 67 7 14 31 31 53 54\n40 33 24 20 68 20 22 39 53 56 48 38 59 45 47 46 7 69 11 58 61 40 35 38 62 66 18 36 44 48 67 24 14 27 67 63 68 30 50 6 58 7 6 35 20 58 6 12 12 23 14 2 63 27 29 22 49 16 55 40 70 27 27 70 42 38 66 55 69 47", "output": "217989.4794743629" }, { "input": "80\n21\n65 4 26 25 1 1 1 1 1 1 60 1 29 43 48 6 48 13 29 1 1 62 1 1 1 1 1 1 1 26 9 1 22 1 35 13 66 36 1 1 1 38 55 21 70 1 58 70 1 1 38 1 1 20 1 1 51 1 1 28 1 23 11 1 39 47 1 52 41 1 63 1 1 52 1 45 11 10 80 1\n1 1 25 30 1 1 55 54 1 48 10 37 22 1 74 1 78 13 1 65 32 1 1 1 1 69 5 59 1 1 65 1 40 1 31 1 1 75 54 1 60 1 1 1 1 1 1 1 11 29 36 1 72 71 52 1 1 1 37 1 1 75 43 9 53 1 62 1 29 1 40 27 59 74 41 53 19 30 1 73", "output": "-1" }, { "input": "90\n35\n1 68 16 30 24 1 1 1 35 1 1 67 1 1 1 1 33 16 37 77 83 1 77 26 1 1 68 67 70 62 1 47 1 1 1 84 1 65 1 32 83 1 1 1 28 1 71 76 84 1 1 5 1 74 10 1 1 1 38 87 13 1 7 66 81 49 1 9 1 11 1 25 1 1 1 1 7 1 1 36 61 47 51 1 1 69 40 1 37 1\n40 1 21 1 19 51 37 52 64 1 86 1 5 24 1 1 1 19 36 1 1 77 24 4 1 18 89 1 1 1 1 1 29 22 1 80 32 36 6 1 63 1 30 1 1 1 86 79 73 52 9 1 1 11 7 1 25 20 1 20 1 49 1 37 1 41 1 1 1 1 54 55 1 10 1 1 1 1 1 1 66 1 68 1 1 1 1 53 1 1", "output": "-1" }, { "input": "2\n1\n1 1\n1 1", "output": "-1" }, { "input": "2\n1\n1 1\n2 2", "output": "-1" }, { "input": "2\n1\n2 2\n1 1", "output": "-1" }, { "input": "2\n1\n2 2\n2 2", "output": "15.0000000000" }, { "input": "2\n2\n1 1\n1 1", "output": "-1" }, { "input": "2\n2\n1 1\n2 2", "output": "-1" }, { "input": "2\n2\n2 2\n1 1", "output": "-1" }, { "input": "2\n2\n2 2\n2 2", "output": "30.0000000000" }, { "input": "40\n55\n1 382 1 1 1 629 111 689 396 614 1 1 995 148 7 820 913 1 1 169 157 1 702 1 159 1 1 226 1 253 1 319 1 130 1 1 1 466 1 756\n1 23 555 1 412 1 1 373 316 234 888 1 112 818 33 443 313 1 235 1 1 610 110 535 1 445 1 386 1 1 758 1 292 1 862 1 244 428 530 1", "output": "-1" }, { "input": "49\n1\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3", "output": "695580114.6380882263" }, { "input": "2\n12\n11 8\n1 1", "output": "-1" }, { "input": "3\n3\n7 11 17\n19 31 33", "output": "1.6012429470" } ]
1,569,572,145
2,147,483,647
Python 3
OK
TESTS
76
109
307,200
n = int(input()) p = int(input()) R = lambda :map(int,input().split()) a = list(R()) b = list(R()) t = 1 for i in range(n) : t *= (1- (1/a[i]))*(1- (1/b[i])) if t >= 1 or t == 0 : print(-1) else : print(p*((1-t)/t))
Title: Fly Time Limit: None seconds Memory Limit: None megabytes Problem Description: Natasha is going to fly on a rocket to Mars and return to Earth. Also, on the way to Mars, she will land on $n - 2$ intermediate planets. Formally: we number all the planets from $1$ to $n$. $1$ is Earth, $n$ is Mars. Natasha will make exactly $n$ flights: $1 \to 2 \to \ldots n \to 1$. Flight from $x$ to $y$ consists of two phases: take-off from planet $x$ and landing to planet $y$. This way, the overall itinerary of the trip will be: the $1$-st planet $\to$ take-off from the $1$-st planet $\to$ landing to the $2$-nd planet $\to$ $2$-nd planet $\to$ take-off from the $2$-nd planet $\to$ $\ldots$ $\to$ landing to the $n$-th planet $\to$ the $n$-th planet $\to$ take-off from the $n$-th planet $\to$ landing to the $1$-st planet $\to$ the $1$-st planet. The mass of the rocket together with all the useful cargo (but without fuel) is $m$ tons. However, Natasha does not know how much fuel to load into the rocket. Unfortunately, fuel can only be loaded on Earth, so if the rocket runs out of fuel on some other planet, Natasha will not be able to return home. Fuel is needed to take-off from each planet and to land to each planet. It is known that $1$ ton of fuel can lift off $a_i$ tons of rocket from the $i$-th planet or to land $b_i$ tons of rocket onto the $i$-th planet. For example, if the weight of rocket is $9$ tons, weight of fuel is $3$ tons and take-off coefficient is $8$ ($a_i = 8$), then $1.5$ tons of fuel will be burnt (since $1.5 \cdot 8 = 9 + 3$). The new weight of fuel after take-off will be $1.5$ tons. Please note, that it is allowed to burn non-integral amount of fuel during take-off or landing, and the amount of initial fuel can be non-integral as well. Help Natasha to calculate the minimum mass of fuel to load into the rocket. Note, that the rocket must spend fuel to carry both useful cargo and the fuel itself. However, it doesn't need to carry the fuel which has already been burnt. Assume, that the rocket takes off and lands instantly. Input Specification: The first line contains a single integer $n$ ($2 \le n \le 1000$)Β β€” number of planets. The second line contains the only integer $m$ ($1 \le m \le 1000$)Β β€” weight of the payload. The third line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \le a_i \le 1000$), where $a_i$ is the number of tons, which can be lifted off by one ton of fuel. The fourth line contains $n$ integers $b_1, b_2, \ldots, b_n$ ($1 \le b_i \le 1000$), where $b_i$ is the number of tons, which can be landed by one ton of fuel. It is guaranteed, that if Natasha can make a flight, then it takes no more than $10^9$ tons of fuel. Output Specification: If Natasha can fly to Mars through $(n - 2)$ planets and return to Earth, print the minimum mass of fuel (in tons) that Natasha should take. Otherwise, print a single number $-1$. It is guaranteed, that if Natasha can make a flight, then it takes no more than $10^9$ tons of fuel. The answer will be considered correct if its absolute or relative error doesn't exceed $10^{-6}$. Formally, let your answer be $p$, and the jury's answer be $q$. Your answer is considered correct if $\frac{|p - q|}{\max{(1, |q|)}} \le 10^{-6}$. Demo Input: ['2\n12\n11 8\n7 5\n', '3\n1\n1 4 1\n2 5 3\n', '6\n2\n4 6 3 3 5 6\n2 6 3 6 5 3\n'] Demo Output: ['10.0000000000\n', '-1\n', '85.4800000000\n'] Note: Let's consider the first example. Initially, the mass of a rocket with fuel is $22$ tons. - At take-off from Earth one ton of fuel can lift off $11$ tons of cargo, so to lift off $22$ tons you need to burn $2$ tons of fuel. Remaining weight of the rocket with fuel is $20$ tons.- During landing on Mars, one ton of fuel can land $5$ tons of cargo, so for landing $20$ tons you will need to burn $4$ tons of fuel. There will be $16$ tons of the rocket with fuel remaining.- While taking off from Mars, one ton of fuel can raise $8$ tons of cargo, so to lift off $16$ tons you will need to burn $2$ tons of fuel. There will be $14$ tons of rocket with fuel after that.- During landing on Earth, one ton of fuel can land $7$ tons of cargo, so for landing $14$ tons you will need to burn $2$ tons of fuel. Remaining weight is $12$ tons, that is, a rocket without any fuel. In the second case, the rocket will not be able even to take off from Earth.
```python n = int(input()) p = int(input()) R = lambda :map(int,input().split()) a = list(R()) b = list(R()) t = 1 for i in range(n) : t *= (1- (1/a[i]))*(1- (1/b[i])) if t >= 1 or t == 0 : print(-1) else : print(p*((1-t)/t)) ```
3
607
A
Chain Reaction
PROGRAMMING
1,600
[ "binary search", "dp" ]
null
null
There are *n* beacons located at distinct positions on a number line. The *i*-th beacon has position *a**i* and power level *b**i*. When the *i*-th beacon is activated, it destroys all beacons to its left (direction of decreasing coordinates) within distance *b**i* inclusive. The beacon itself is not destroyed however. Saitama will activate the beacons one at a time from right to left. If a beacon is destroyed, it cannot be activated. Saitama wants Genos to add a beacon strictly to the right of all the existing beacons, with any position and any power level, such that the least possible number of beacons are destroyed. Note that Genos's placement of the beacon means it will be the first beacon activated. Help Genos by finding the minimum number of beacons that could be destroyed.
The first line of input contains a single integer *n* (1<=≀<=*n*<=≀<=100<=000) β€” the initial number of beacons. The *i*-th of next *n* lines contains two integers *a**i* and *b**i* (0<=≀<=*a**i*<=≀<=1<=000<=000, 1<=≀<=*b**i*<=≀<=1<=000<=000)Β β€” the position and power level of the *i*-th beacon respectively. No two beacons will have the same position, so *a**i*<=β‰ <=*a**j* if *i*<=β‰ <=*j*.
Print a single integerΒ β€” the minimum number of beacons that could be destroyed if exactly one beacon is added.
[ "4\n1 9\n3 1\n6 1\n7 4\n", "7\n1 1\n2 1\n3 1\n4 1\n5 1\n6 1\n7 1\n" ]
[ "1\n", "3\n" ]
For the first sample case, the minimum number of beacons destroyed is 1. One way to achieve this is to place a beacon at position 9 with power level 2. For the second sample case, the minimum number of beacons destroyed is 3. One way to achieve this is to place a beacon at position 1337 with power level 42.
500
[ { "input": "4\n1 9\n3 1\n6 1\n7 4", "output": "1" }, { "input": "7\n1 1\n2 1\n3 1\n4 1\n5 1\n6 1\n7 1", "output": "3" }, { "input": "1\n0 1", "output": "0" }, { "input": "1\n0 1000000", "output": "0" }, { "input": "1\n1000000 1000000", "output": "0" }, { "input": "7\n1 1\n2 1\n3 1\n4 1\n5 1\n6 6\n7 7", "output": "4" }, { "input": "5\n1 1\n3 1\n5 1\n7 10\n8 10", "output": "2" }, { "input": "11\n110 90\n100 70\n90 10\n80 10\n70 1\n60 1\n50 10\n40 1\n30 1\n10 1\n20 1", "output": "4" } ]
1,569,098,204
2,147,483,647
Python 3
OK
TESTS
41
608
6,246,400
# your code goes here n = int(input()) bb = [0] * 1000001 for i in range(n): a, b = map(int, input().split()) bb[a] = b a = 0 m = 0 for index, value in enumerate(bb): if value > 0: if (index - value) > 0: a = (1 + bb[index - value -1]) else: a = 1 bb[index] = a print(n - max(bb))
Title: Chain Reaction Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are *n* beacons located at distinct positions on a number line. The *i*-th beacon has position *a**i* and power level *b**i*. When the *i*-th beacon is activated, it destroys all beacons to its left (direction of decreasing coordinates) within distance *b**i* inclusive. The beacon itself is not destroyed however. Saitama will activate the beacons one at a time from right to left. If a beacon is destroyed, it cannot be activated. Saitama wants Genos to add a beacon strictly to the right of all the existing beacons, with any position and any power level, such that the least possible number of beacons are destroyed. Note that Genos's placement of the beacon means it will be the first beacon activated. Help Genos by finding the minimum number of beacons that could be destroyed. Input Specification: The first line of input contains a single integer *n* (1<=≀<=*n*<=≀<=100<=000) β€” the initial number of beacons. The *i*-th of next *n* lines contains two integers *a**i* and *b**i* (0<=≀<=*a**i*<=≀<=1<=000<=000, 1<=≀<=*b**i*<=≀<=1<=000<=000)Β β€” the position and power level of the *i*-th beacon respectively. No two beacons will have the same position, so *a**i*<=β‰ <=*a**j* if *i*<=β‰ <=*j*. Output Specification: Print a single integerΒ β€” the minimum number of beacons that could be destroyed if exactly one beacon is added. Demo Input: ['4\n1 9\n3 1\n6 1\n7 4\n', '7\n1 1\n2 1\n3 1\n4 1\n5 1\n6 1\n7 1\n'] Demo Output: ['1\n', '3\n'] Note: For the first sample case, the minimum number of beacons destroyed is 1. One way to achieve this is to place a beacon at position 9 with power level 2. For the second sample case, the minimum number of beacons destroyed is 3. One way to achieve this is to place a beacon at position 1337 with power level 42.
```python # your code goes here n = int(input()) bb = [0] * 1000001 for i in range(n): a, b = map(int, input().split()) bb[a] = b a = 0 m = 0 for index, value in enumerate(bb): if value > 0: if (index - value) > 0: a = (1 + bb[index - value -1]) else: a = 1 bb[index] = a print(n - max(bb)) ```
3
190
A
Vasya and the Bus
PROGRAMMING
1,100
[ "greedy", "math" ]
null
null
One day Vasya heard a story: "In the city of High Bertown a bus number 62 left from the bus station. It had *n* grown-ups and *m* kids..." The latter events happen to be of no importance to us. Vasya is an accountant and he loves counting money. So he wondered what maximum and minimum sum of money these passengers could have paid for the ride. The bus fare equals one berland ruble in High Bertown. However, not everything is that easy β€” no more than one child can ride for free with each grown-up passenger. That means that a grown-up passenger who rides with his *k* (*k*<=&gt;<=0) children, pays overall *k* rubles: a ticket for himself and (*k*<=-<=1) tickets for his children. Also, a grown-up can ride without children, in this case he only pays one ruble. We know that in High Bertown children can't ride in a bus unaccompanied by grown-ups. Help Vasya count the minimum and the maximum sum in Berland rubles, that all passengers of this bus could have paid in total.
The input file consists of a single line containing two space-separated numbers *n* and *m* (0<=≀<=*n*,<=*m*<=≀<=105) β€” the number of the grown-ups and the number of the children in the bus, correspondingly.
If *n* grown-ups and *m* children could have ridden in the bus, then print on a single line two space-separated integers β€” the minimum and the maximum possible total bus fare, correspondingly. Otherwise, print "Impossible" (without the quotes).
[ "1 2\n", "0 5\n", "2 2\n" ]
[ "2 2", "Impossible", "2 3" ]
In the first sample a grown-up rides with two children and pays two rubles. In the second sample there are only children in the bus, so the situation is impossible. In the third sample there are two cases: - Each of the two grown-ups rides with one children and pays one ruble for the tickets. In this case the passengers pay two rubles in total. - One of the grown-ups ride with two children's and pays two rubles, the another one rides alone and pays one ruble for himself. So, they pay three rubles in total.
500
[ { "input": "1 2", "output": "2 2" }, { "input": "0 5", "output": "Impossible" }, { "input": "2 2", "output": "2 3" }, { "input": "2 7", "output": "7 8" }, { "input": "4 10", "output": "10 13" }, { "input": "6 0", "output": "6 6" }, { "input": "7 1", "output": "7 7" }, { "input": "0 0", "output": "0 0" }, { "input": "71 24", "output": "71 94" }, { "input": "16 70", "output": "70 85" }, { "input": "0 1", "output": "Impossible" }, { "input": "1 0", "output": "1 1" }, { "input": "1 1", "output": "1 1" }, { "input": "63 82", "output": "82 144" }, { "input": "8 26", "output": "26 33" }, { "input": "21 27", "output": "27 47" }, { "input": "0 38", "output": "Impossible" }, { "input": "46 84", "output": "84 129" }, { "input": "59 96", "output": "96 154" }, { "input": "63028 0", "output": "63028 63028" }, { "input": "9458 0", "output": "9458 9458" }, { "input": "80236 0", "output": "80236 80236" }, { "input": "26666 0", "output": "26666 26666" }, { "input": "59617 0", "output": "59617 59617" }, { "input": "0 6048", "output": "Impossible" }, { "input": "63028 28217", "output": "63028 91244" }, { "input": "9458 39163", "output": "39163 48620" }, { "input": "80236 14868", "output": "80236 95103" }, { "input": "26666 52747", "output": "52747 79412" }, { "input": "59617 28452", "output": "59617 88068" }, { "input": "6048 4158", "output": "6048 10205" }, { "input": "76826 4210", "output": "76826 81035" }, { "input": "23256 15156", "output": "23256 38411" }, { "input": "56207 53035", "output": "56207 109241" }, { "input": "2637 28740", "output": "28740 31376" }, { "input": "73415 4445", "output": "73415 77859" }, { "input": "82019 4498", "output": "82019 86516" }, { "input": "28449 80204", "output": "80204 108652" }, { "input": "99227 53323", "output": "99227 152549" }, { "input": "45657 29028", "output": "45657 74684" }, { "input": "78608 4733", "output": "78608 83340" }, { "input": "25038 4786", "output": "25038 29823" }, { "input": "95816 80492", "output": "95816 176307" }, { "input": "42246 94024", "output": "94024 136269" }, { "input": "0 100000", "output": "Impossible" }, { "input": "100000 0", "output": "100000 100000" }, { "input": "1 100000", "output": "100000 100000" }, { "input": "100000 1", "output": "100000 100000" }, { "input": "63028 63028", "output": "63028 126055" }, { "input": "9458 9458", "output": "9458 18915" }, { "input": "80236 80236", "output": "80236 160471" }, { "input": "26666 26666", "output": "26666 53331" }, { "input": "59617 59617", "output": "59617 119233" }, { "input": "100000 100000", "output": "100000 199999" } ]
1,656,149,640
2,147,483,647
Python 3
OK
TESTS
54
92
0
a,b=map(int,input().split()) if a<1 and b:print('Impossible');exit() print(max(a,b),a+max(b-1,0))
Title: Vasya and the Bus Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vasya heard a story: "In the city of High Bertown a bus number 62 left from the bus station. It had *n* grown-ups and *m* kids..." The latter events happen to be of no importance to us. Vasya is an accountant and he loves counting money. So he wondered what maximum and minimum sum of money these passengers could have paid for the ride. The bus fare equals one berland ruble in High Bertown. However, not everything is that easy β€” no more than one child can ride for free with each grown-up passenger. That means that a grown-up passenger who rides with his *k* (*k*<=&gt;<=0) children, pays overall *k* rubles: a ticket for himself and (*k*<=-<=1) tickets for his children. Also, a grown-up can ride without children, in this case he only pays one ruble. We know that in High Bertown children can't ride in a bus unaccompanied by grown-ups. Help Vasya count the minimum and the maximum sum in Berland rubles, that all passengers of this bus could have paid in total. Input Specification: The input file consists of a single line containing two space-separated numbers *n* and *m* (0<=≀<=*n*,<=*m*<=≀<=105) β€” the number of the grown-ups and the number of the children in the bus, correspondingly. Output Specification: If *n* grown-ups and *m* children could have ridden in the bus, then print on a single line two space-separated integers β€” the minimum and the maximum possible total bus fare, correspondingly. Otherwise, print "Impossible" (without the quotes). Demo Input: ['1 2\n', '0 5\n', '2 2\n'] Demo Output: ['2 2', 'Impossible', '2 3'] Note: In the first sample a grown-up rides with two children and pays two rubles. In the second sample there are only children in the bus, so the situation is impossible. In the third sample there are two cases: - Each of the two grown-ups rides with one children and pays one ruble for the tickets. In this case the passengers pay two rubles in total. - One of the grown-ups ride with two children's and pays two rubles, the another one rides alone and pays one ruble for himself. So, they pay three rubles in total.
```python a,b=map(int,input().split()) if a<1 and b:print('Impossible');exit() print(max(a,b),a+max(b-1,0)) ```
3
651
B
Beautiful Paintings
PROGRAMMING
1,200
[ "greedy", "sortings" ]
null
null
There are *n* pictures delivered for the new exhibition. The *i*-th painting has beauty *a**i*. We know that a visitor becomes happy every time he passes from a painting to a more beautiful one. We are allowed to arranged pictures in any order. What is the maximum possible number of times the visitor may become happy while passing all pictures from first to last? In other words, we are allowed to rearrange elements of *a* in any order. What is the maximum possible number of indices *i* (1<=≀<=*i*<=≀<=*n*<=-<=1), such that *a**i*<=+<=1<=&gt;<=*a**i*.
The first line of the input contains integer *n* (1<=≀<=*n*<=≀<=1000)Β β€” the number of painting. The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=1000), where *a**i* means the beauty of the *i*-th painting.
Print one integerΒ β€” the maximum possible number of neighbouring pairs, such that *a**i*<=+<=1<=&gt;<=*a**i*, after the optimal rearrangement.
[ "5\n20 30 10 50 40\n", "4\n200 100 100 200\n" ]
[ "4\n", "2\n" ]
In the first sample, the optimal order is: 10, 20, 30, 40, 50. In the second sample, the optimal order is: 100, 200, 100, 200.
1,000
[ { "input": "5\n20 30 10 50 40", "output": "4" }, { "input": "4\n200 100 100 200", "output": "2" }, { "input": "10\n2 2 2 2 2 2 2 2 2 2", "output": "0" }, { "input": "1\n1000", "output": "0" }, { "input": "2\n444 333", "output": "1" }, { "input": "100\n9 9 72 55 14 8 55 58 35 67 3 18 73 92 41 49 15 60 18 66 9 26 97 47 43 88 71 97 19 34 48 96 79 53 8 24 69 49 12 23 77 12 21 88 66 9 29 13 61 69 54 77 41 13 4 68 37 74 7 6 29 76 55 72 89 4 78 27 29 82 18 83 12 4 32 69 89 85 66 13 92 54 38 5 26 56 17 55 29 4 17 39 29 94 3 67 85 98 21 14", "output": "95" }, { "input": "1\n995", "output": "0" }, { "input": "10\n103 101 103 103 101 102 100 100 101 104", "output": "7" }, { "input": "20\n102 100 102 104 102 101 104 103 100 103 105 105 100 105 100 100 101 105 105 102", "output": "15" }, { "input": "20\n990 994 996 999 997 994 990 992 990 993 992 990 999 999 992 994 997 990 993 998", "output": "15" }, { "input": "100\n1 8 3 8 10 8 5 3 10 3 5 8 4 5 5 5 10 3 6 6 6 6 6 7 2 7 2 4 7 8 3 8 7 2 5 6 1 5 5 7 9 7 6 9 1 8 1 3 6 5 1 3 6 9 5 6 8 4 8 6 10 9 2 9 3 8 7 5 2 10 2 10 3 6 5 5 3 5 10 2 3 7 10 8 8 4 3 4 9 6 10 7 6 6 6 4 9 9 8 9", "output": "84" } ]
1,658,296,059
2,147,483,647
Python 3
OK
TESTS
31
93
0
n=int(input()) l=list(map(int,input().split())) f,b=0,l.copy() l.sort() for i in range(len(l)-1): if l[i+1]>l[i]:f+=1 s=list(set(l)) while 1: for i in s: b.remove(i) if len(b)==0: break b.sort() for i in range(len(b)-1): if b[i+1]>b[i]: f+=1 s=list(set(b)) print(f)
Title: Beautiful Paintings Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are *n* pictures delivered for the new exhibition. The *i*-th painting has beauty *a**i*. We know that a visitor becomes happy every time he passes from a painting to a more beautiful one. We are allowed to arranged pictures in any order. What is the maximum possible number of times the visitor may become happy while passing all pictures from first to last? In other words, we are allowed to rearrange elements of *a* in any order. What is the maximum possible number of indices *i* (1<=≀<=*i*<=≀<=*n*<=-<=1), such that *a**i*<=+<=1<=&gt;<=*a**i*. Input Specification: The first line of the input contains integer *n* (1<=≀<=*n*<=≀<=1000)Β β€” the number of painting. The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=1000), where *a**i* means the beauty of the *i*-th painting. Output Specification: Print one integerΒ β€” the maximum possible number of neighbouring pairs, such that *a**i*<=+<=1<=&gt;<=*a**i*, after the optimal rearrangement. Demo Input: ['5\n20 30 10 50 40\n', '4\n200 100 100 200\n'] Demo Output: ['4\n', '2\n'] Note: In the first sample, the optimal order is: 10, 20, 30, 40, 50. In the second sample, the optimal order is: 100, 200, 100, 200.
```python n=int(input()) l=list(map(int,input().split())) f,b=0,l.copy() l.sort() for i in range(len(l)-1): if l[i+1]>l[i]:f+=1 s=list(set(l)) while 1: for i in s: b.remove(i) if len(b)==0: break b.sort() for i in range(len(b)-1): if b[i+1]>b[i]: f+=1 s=list(set(b)) print(f) ```
3
281
A
Word Capitalization
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word. Note, that during capitalization all the letters except the first one remains unchanged.
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
Output the given word after capitalization.
[ "ApPLe\n", "konjac\n" ]
[ "ApPLe\n", "Konjac\n" ]
none
500
[ { "input": "ApPLe", "output": "ApPLe" }, { "input": "konjac", "output": "Konjac" }, { "input": "a", "output": "A" }, { "input": "A", "output": "A" }, { "input": "z", "output": "Z" }, { "input": "ABACABA", "output": "ABACABA" }, { "input": "xYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX", "output": "XYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX" }, { "input": "rZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO", "output": "RZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO" }, { "input": "hDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD", "output": "HDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD" }, { "input": "qUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW", "output": "QUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW" }, { "input": "kHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL", "output": "KHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL" }, { "input": "aHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC", "output": "AHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC" }, { "input": "sLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN", "output": "SLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN" }, { "input": "iRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE", "output": "IRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE" }, { "input": "cRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP", "output": "CRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP" }, { "input": "wVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG", "output": "WVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG" }, { "input": "kEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV", "output": "KEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV" }, { "input": "eIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI", "output": "EIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI" }, { "input": "uOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX", "output": "UOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX" }, { "input": "lZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ", "output": "LZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ" }, { "input": "P", "output": "P" }, { "input": "Xyzzy", "output": "Xyzzy" }, { "input": "Zzz", "output": "Zzz" }, { "input": "Zp", "output": "Zp" } ]
1,696,542,714
2,147,483,647
Python 3
OK
TESTS
25
62
0
a = input() l = list(a) l[0] = l[0].upper() b = ''.join(l) print(b)
Title: Word Capitalization Time Limit: None seconds Memory Limit: None megabytes Problem Description: Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word. Note, that during capitalization all the letters except the first one remains unchanged. Input Specification: A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103. Output Specification: Output the given word after capitalization. Demo Input: ['ApPLe\n', 'konjac\n'] Demo Output: ['ApPLe\n', 'Konjac\n'] Note: none
```python a = input() l = list(a) l[0] = l[0].upper() b = ''.join(l) print(b) ```
3
389
A
Fox and Number Game
PROGRAMMING
1,000
[ "greedy", "math" ]
null
null
Fox Ciel is playing a game with numbers now. Ciel has *n* positive integers: *x*1, *x*2, ..., *x**n*. She can do the following operation as many times as needed: select two different indexes *i* and *j* such that *x**i* &gt; *x**j* hold, and then apply assignment *x**i* = *x**i* - *x**j*. The goal is to make the sum of all numbers as small as possible. Please help Ciel to find this minimal sum.
The first line contains an integer *n* (2<=≀<=*n*<=≀<=100). Then the second line contains *n* integers: *x*1, *x*2, ..., *x**n* (1<=≀<=*x**i*<=≀<=100).
Output a single integer β€” the required minimal sum.
[ "2\n1 2\n", "3\n2 4 6\n", "2\n12 18\n", "5\n45 12 27 30 18\n" ]
[ "2\n", "6\n", "12\n", "15\n" ]
In the first example the optimal way is to do the assignment: *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>. In the second example the optimal sequence of operations is: *x*<sub class="lower-index">3</sub> = *x*<sub class="lower-index">3</sub> - *x*<sub class="lower-index">2</sub>, *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>.
500
[ { "input": "2\n1 2", "output": "2" }, { "input": "3\n2 4 6", "output": "6" }, { "input": "2\n12 18", "output": "12" }, { "input": "5\n45 12 27 30 18", "output": "15" }, { "input": "2\n1 1", "output": "2" }, { "input": "2\n100 100", "output": "200" }, { "input": "2\n87 58", "output": "58" }, { "input": "39\n52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52", "output": "2028" }, { "input": "59\n96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96", "output": "5664" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "10000" }, { "input": "100\n70 70 77 42 98 84 56 91 35 21 7 70 77 77 56 63 14 84 56 14 77 77 63 70 14 7 28 91 63 49 21 84 98 56 77 98 98 84 98 14 7 56 49 28 91 98 7 56 14 91 14 98 49 28 98 14 98 98 14 70 35 28 63 28 49 63 63 56 91 98 35 42 42 35 63 35 42 14 63 21 77 56 42 77 35 91 56 21 28 84 56 70 70 91 98 70 84 63 21 98", "output": "700" }, { "input": "39\n63 21 21 42 21 63 21 84 42 21 84 63 42 63 84 84 84 42 42 84 21 63 42 63 42 42 63 42 42 63 84 42 21 84 21 63 42 21 42", "output": "819" }, { "input": "59\n70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70", "output": "4130" }, { "input": "87\n44 88 88 88 88 66 88 22 22 88 88 44 88 22 22 22 88 88 88 88 66 22 88 88 88 88 66 66 44 88 44 44 66 22 88 88 22 44 66 44 88 66 66 22 22 22 22 88 22 22 44 66 88 22 22 88 66 66 88 22 66 88 66 88 66 44 88 44 22 44 44 22 44 88 44 44 44 44 22 88 88 88 66 66 88 44 22", "output": "1914" }, { "input": "15\n63 63 63 63 63 63 63 63 63 63 63 63 63 63 63", "output": "945" }, { "input": "39\n63 77 21 14 14 35 21 21 70 42 21 70 28 77 28 77 7 42 63 7 98 49 98 84 35 70 70 91 14 42 98 7 42 7 98 42 56 35 91", "output": "273" }, { "input": "18\n18 18 18 36 36 36 54 72 54 36 72 54 36 36 36 36 18 36", "output": "324" }, { "input": "46\n71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71", "output": "3266" }, { "input": "70\n66 11 66 11 44 11 44 99 55 22 88 11 11 22 55 44 22 77 44 77 77 22 44 55 88 11 99 99 88 22 77 77 66 11 11 66 99 55 55 44 66 44 77 44 44 55 33 55 44 88 77 77 22 66 33 44 11 22 55 44 22 66 77 33 33 44 44 44 22 33", "output": "770" }, { "input": "10\n60 12 96 48 60 24 60 36 60 60", "output": "120" }, { "input": "20\n51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51", "output": "1020" }, { "input": "50\n58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58", "output": "2900" }, { "input": "98\n70 60 100 30 70 20 30 50 50 30 90 40 30 40 60 80 60 60 80 50 10 80 20 10 20 10 50 70 30 80 30 50 60 90 90 100 60 30 90 20 30 60 90 80 60 60 10 90 10 50 40 40 80 90 100 40 70 40 30 50 60 50 60 30 40 20 90 60 20 20 20 70 60 70 50 100 90 50 20 40 80 60 10 60 50 40 40 10 50 10 40 10 80 100 100 90 10 90", "output": "980" }, { "input": "100\n82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82", "output": "8200" }, { "input": "100\n11 87 77 93 3 54 21 93 9 71 37 23 69 85 74 3 48 99 51 31 56 19 21 96 39 6 4 4 29 69 100 42 1 22 81 53 48 49 81 61 10 7 40 61 7 71 51 59 79 44 50 35 95 80 83 8 98 40 18 94 84 49 52 74 66 69 39 37 100 44 38 62 2 80 46 31 35 53 5 60 21 49 63 55 20 53 80 53 66 34 23 92 77 50 86 63 65 24 12 70", "output": "100" }, { "input": "2\n100 1", "output": "2" }, { "input": "2\n18 30", "output": "12" }, { "input": "2\n3 5", "output": "2" }, { "input": "2\n1 10", "output": "2" }, { "input": "2\n8 5", "output": "2" }, { "input": "5\n2 3 5 8 18", "output": "5" }, { "input": "5\n2 4 1 6 8", "output": "5" }, { "input": "3\n12 10 5", "output": "3" }, { "input": "3\n6 10 15", "output": "3" } ]
1,461,748,619
2,147,483,647
Python 3
OK
TESTS
34
77
5,222,400
def f(x,y): while True: t=x%y x=y y=t if t==0: return x n=int(input()) x=list(map(int,input().split())) j=x[0] for i in x: j=f(j,i) #print(j) print(j*n)
Title: Fox and Number Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Fox Ciel is playing a game with numbers now. Ciel has *n* positive integers: *x*1, *x*2, ..., *x**n*. She can do the following operation as many times as needed: select two different indexes *i* and *j* such that *x**i* &gt; *x**j* hold, and then apply assignment *x**i* = *x**i* - *x**j*. The goal is to make the sum of all numbers as small as possible. Please help Ciel to find this minimal sum. Input Specification: The first line contains an integer *n* (2<=≀<=*n*<=≀<=100). Then the second line contains *n* integers: *x*1, *x*2, ..., *x**n* (1<=≀<=*x**i*<=≀<=100). Output Specification: Output a single integer β€” the required minimal sum. Demo Input: ['2\n1 2\n', '3\n2 4 6\n', '2\n12 18\n', '5\n45 12 27 30 18\n'] Demo Output: ['2\n', '6\n', '12\n', '15\n'] Note: In the first example the optimal way is to do the assignment: *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>. In the second example the optimal sequence of operations is: *x*<sub class="lower-index">3</sub> = *x*<sub class="lower-index">3</sub> - *x*<sub class="lower-index">2</sub>, *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>.
```python def f(x,y): while True: t=x%y x=y y=t if t==0: return x n=int(input()) x=list(map(int,input().split())) j=x[0] for i in x: j=f(j,i) #print(j) print(j*n) ```
3
322
B
Ciel and Flowers
PROGRAMMING
1,600
[ "combinatorics", "math" ]
null
null
Fox Ciel has some flowers: *r* red flowers, *g* green flowers and *b* blue flowers. She wants to use these flowers to make several bouquets. There are 4 types of bouquets: - To make a "red bouquet", it needs 3 red flowers. - To make a "green bouquet", it needs 3 green flowers. - To make a "blue bouquet", it needs 3 blue flowers. - To make a "mixing bouquet", it needs 1 red, 1 green and 1 blue flower. Help Fox Ciel to find the maximal number of bouquets she can make.
The first line contains three integers *r*, *g* and *b* (0<=≀<=*r*,<=*g*,<=*b*<=≀<=109) β€” the number of red, green and blue flowers.
Print the maximal number of bouquets Fox Ciel can make.
[ "3 6 9\n", "4 4 4\n", "0 0 0\n" ]
[ "6\n", "4\n", "0\n" ]
In test case 1, we can make 1 red bouquet, 2 green bouquets and 3 blue bouquets. In test case 2, we can make 1 red, 1 green, 1 blue and 1 mixing bouquet.
1,000
[ { "input": "3 6 9", "output": "6" }, { "input": "4 4 4", "output": "4" }, { "input": "0 0 0", "output": "0" }, { "input": "0 3 6", "output": "3" }, { "input": "7 8 9", "output": "7" }, { "input": "8 8 9", "output": "8" }, { "input": "15 3 999", "output": "339" }, { "input": "32 62 92", "output": "62" }, { "input": "123456789 123456789 123456789", "output": "123456789" }, { "input": "3 5 5", "output": "4" }, { "input": "666806767 385540591 357848286", "output": "470065214" }, { "input": "80010646 727118126 817880463", "output": "541669744" }, { "input": "829651016 732259171 572879931", "output": "711596705" }, { "input": "242854896 442432924 180395753", "output": "288561190" }, { "input": "139978911 5123031 935395222", "output": "360165721" }, { "input": "553182792 10264076 395427398", "output": "319624755" }, { "input": "597790453 720437830 855459575", "output": "724562619" }, { "input": "494914467 356982656 757942689", "output": "536613270" }, { "input": "908118348 67156409 217974865", "output": "397749873" }, { "input": "952726009 629846517 972974334", "output": "851848953" }, { "input": "775140200 616574841 630329230", "output": "674014756" }, { "input": "524780569 326748594 90361407", "output": "313963523" }, { "input": "937984449 184405994 992844522", "output": "705078321" }, { "input": "835108464 525983528 452876698", "output": "604656229" }, { "input": "879716125 531124573 207876166", "output": "539572288" }, { "input": "292920005 241298326 667908343", "output": "400708891" }, { "input": "1000000000 1000000000 1000000000", "output": "1000000000" }, { "input": "1000000000 999999999 999999998", "output": "999999998" }, { "input": "999999998 999999998 999999999", "output": "999999998" }, { "input": "0 1 1", "output": "0" }, { "input": "0 1000000000 0", "output": "333333333" }, { "input": "0 1 0", "output": "0" }, { "input": "1 0 0", "output": "0" }, { "input": "0 2 2", "output": "0" }, { "input": "3 3 5", "output": "3" }, { "input": "2 2 0", "output": "0" }, { "input": "0 5 5", "output": "2" }, { "input": "2 0 11", "output": "3" }, { "input": "9 9 7", "output": "8" }, { "input": "65 30 74", "output": "56" } ]
1,490,562,302
2,147,483,647
Python 3
OK
TESTS
40
124
4,608,000
r,g,b=map(int,input().split()) a,d,c=0,0,0 a=r//3+b//3+g//3 if(r and g and b):r,g,b=r-1,g-1,b-1;a=max(a,r//3+b//3+g//3+1) if(r and g and b):r,g,b=r-1,g-1,b-1;a=max(a,r//3+b//3+g//3+2) print(a)
Title: Ciel and Flowers Time Limit: None seconds Memory Limit: None megabytes Problem Description: Fox Ciel has some flowers: *r* red flowers, *g* green flowers and *b* blue flowers. She wants to use these flowers to make several bouquets. There are 4 types of bouquets: - To make a "red bouquet", it needs 3 red flowers. - To make a "green bouquet", it needs 3 green flowers. - To make a "blue bouquet", it needs 3 blue flowers. - To make a "mixing bouquet", it needs 1 red, 1 green and 1 blue flower. Help Fox Ciel to find the maximal number of bouquets she can make. Input Specification: The first line contains three integers *r*, *g* and *b* (0<=≀<=*r*,<=*g*,<=*b*<=≀<=109) β€” the number of red, green and blue flowers. Output Specification: Print the maximal number of bouquets Fox Ciel can make. Demo Input: ['3 6 9\n', '4 4 4\n', '0 0 0\n'] Demo Output: ['6\n', '4\n', '0\n'] Note: In test case 1, we can make 1 red bouquet, 2 green bouquets and 3 blue bouquets. In test case 2, we can make 1 red, 1 green, 1 blue and 1 mixing bouquet.
```python r,g,b=map(int,input().split()) a,d,c=0,0,0 a=r//3+b//3+g//3 if(r and g and b):r,g,b=r-1,g-1,b-1;a=max(a,r//3+b//3+g//3+1) if(r and g and b):r,g,b=r-1,g-1,b-1;a=max(a,r//3+b//3+g//3+2) print(a) ```
3
801
B
Valued Keys
PROGRAMMING
900
[ "constructive algorithms", "greedy", "strings" ]
null
null
You found a mysterious function *f*. The function takes two strings *s*1 and *s*2. These strings must consist only of lowercase English letters, and must be the same length. The output of the function *f* is another string of the same length. The *i*-th character of the output is equal to the minimum of the *i*-th character of *s*1 and the *i*-th character of *s*2. For example, *f*("ab", "ba") = "aa", and *f*("nzwzl", "zizez") = "niwel". You found two strings *x* and *y* of the same length and consisting of only lowercase English letters. Find any string *z* such that *f*(*x*,<=*z*)<==<=*y*, or print -1 if no such string *z* exists.
The first line of input contains the string *x*. The second line of input contains the string *y*. Both *x* and *y* consist only of lowercase English letters, *x* and *y* have same length and this length is between 1 and 100.
If there is no string *z* such that *f*(*x*,<=*z*)<==<=*y*, print -1. Otherwise, print a string *z* such that *f*(*x*,<=*z*)<==<=*y*. If there are multiple possible answers, print any of them. The string *z* should be the same length as *x* and *y* and consist only of lowercase English letters.
[ "ab\naa\n", "nzwzl\nniwel\n", "ab\nba\n" ]
[ "ba\n", "xiyez\n", "-1\n" ]
The first case is from the statement. Another solution for the second case is "zizez" There is no solution for the third case. That is, there is no *z* such that *f*("ab", *z*) =  "ba".
1,000
[ { "input": "ab\naa", "output": "ba" }, { "input": "nzwzl\nniwel", "output": "xiyez" }, { "input": "ab\nba", "output": "-1" }, { "input": "r\nl", "output": "l" }, { "input": "d\ny", "output": "-1" }, { "input": "yvowz\ncajav", "output": "cajav" }, { "input": "lwzjp\ninjit", "output": "-1" }, { "input": "epqnlxmiicdidyscjaxqznwur\neodnlemiicdedmkcgavqbnqmm", "output": "eodnlemiicdedmkcgavqbnqmm" }, { "input": "qqdabbsxiibnnjgsgxllfvdqj\nuxmypqtwfdezewdxfgplannrs", "output": "-1" }, { "input": "aanerbaqslfmqmuciqbxyznkevukvznpkmxlcorpmrenwxhzfgbmlfpxtkqpxdrmcqcmbf\naanebbaqkgfiimcciqbaoznkeqqkrgapdillccrfeienwbcvfgbmlfbimkqchcrmclcmbf", "output": "aanebbaqkgfiimcciqbaoznkeqqkrgapdillccrfeienwbcvfgbmlfbimkqchcrmclcmbf" }, { "input": "mbyrkhjctrcrayisflptgfudwgrtegidhqicsjqafvdloritbjhciyxuwavxknezwwudnk\nvvixsutlbdewqoabqhpuerfkzrddcqptfwmxdlxwbvsaqfjoxztlddvwgflcteqbwaiaen", "output": "-1" }, { "input": "eufycwztywhbjrpqobvknwfqmnboqcfdiahkagykeibbsqpljcghhmsgfmswwsanzyiwtvuirwmppfivtekaywkzskyydfvkjgxb\necfwavookadbcilfobojnweqinbcpcfdiahkabwkeibbacpljcghhksgfajgmianfnivmhfifogpffiheegayfkxkkcmdfvihgdb", "output": "ecfwavookadbcilfobojnweqinbcpcfdiahkabwkeibbacpljcghhksgfajgmianfnivmhfifogpffiheegayfkxkkcmdfvihgdb" }, { "input": "qvpltcffyeghtbdhjyhfteojezyzziardduzrbwuxmzzkkoehfnxecafizxglboauhynfbawlfxenmykquyhrxswhjuovvogntok\nchvkcvzxptbcepdjfezcpuvtehewbnvqeoezlcnzhpfwujbmhafoeqmjhtwisnobauinkzyigrvahpuetkgpdjfgbzficsmuqnym", "output": "-1" }, { "input": "nmuwjdihouqrnsuahimssnrbxdpwvxiyqtenahtrlshjkmnfuttnpqhgcagoptinnaptxaccptparldzrhpgbyrzedghudtsswxi\nnilhbdghosqnbebafimconrbvdodjsipqmekahhrllhjkemeketapfhgcagopfidnahtlaccpfpafedqicpcbvfgedghudhddwib", "output": "nilhbdghosqnbebafimconrbvdodjsipqmekahhrllhjkemeketapfhgcagopfidnahtlaccpfpafedqicpcbvfgedghudhddwib" }, { "input": "dyxgwupoauwqtcfoyfjdotzirwztdfrueqiypxoqvkmhiehdppwtdoxrbfvtairdbuvlqohjflznggjpifhwjrshcrfbjtklpykx\ngzqlnoizhxolnditjdhlhptjsbczehicudoybzilwnshmywozwnwuipcgirgzldtvtowdsokfeafggwserzdazkxyddjttiopeew", "output": "-1" }, { "input": "hbgwuqzougqzlxemvyjpeizjfwhgugrfnhbrlxkmkdalikfyunppwgdzmalbwewybnjzqsohwhjkdcyhhzmysflambvhpsjilsyv\nfbdjdqjojdafarakvcjpeipjfehgfgrfehbolxkmkdagikflunnpvadocalbkedibhbflmohnhjkdcthhaigsfjaibqhbcjelirv", "output": "fbdjdqjojdafarakvcjpeipjfehgfgrfehbolxkmkdagikflunnpvadocalbkedibhbflmohnhjkdcthhaigsfjaibqhbcjelirv" }, { "input": "xnjjhjfuhgyxqhpzmvgbaohqarugdoaczcfecofltwemieyxolswkcwhlfagfrgmoiqrgftokbqwtxgxzweozzlikrvafiabivlk\npjfosalbsitcnqiazhmepfifjxvmazvdgffcnozmnqubhonwjldmpdsjagmamniylzjdbklcyrzivjyzgnogahobpkwpwpvraqns", "output": "-1" }, { "input": "zrvzedssbsrfldqvjpgmsefrmsatspzoitwvymahiptphiystjlsauzquzqqbmljobdhijcpdvatorwmyojqgnezvzlgjibxepcf\npesoedmqbmffldqsjggmhefkadaesijointrkmahapaahiysfjdiaupqujngbjhjobdhiecadeatgjvelojjgnepvajgeibfepaf", "output": "pesoedmqbmffldqsjggmhefkadaesijointrkmahapaahiysfjdiaupqujngbjhjobdhiecadeatgjvelojjgnepvajgeibfepaf" }, { "input": "pdvkuwyzntzfqpblzmbynknyhlnqbxijuqaincviugxohcsrofozrrsategwkbwxcvkyzxhurokefpbdnmcfogfhsojayysqbrow\nbvxruombdrywlcjkrltyayaazwpauuhbtgwfzdrmfwwucgffucwelzvpsdgtapogchblzahsrfymjlaghkbmbssghrpxalkslcvp", "output": "-1" }, { "input": "tgharsjyihroiiahwgbjezlxvlterxivdhtzjcqegzmtigqmrehvhiyjeywegxaseoyoacouijudbiruoghgxvxadwzgdxtnxlds\ntghaksjsdhkoiiahegbjexlfrctercipdhmvjbgegxdtggqdpbhvhiseehhegnaseoooacnsijubbirjnghgsvpadhaadrtimfdp", "output": "tghaksjsdhkoiiahegbjexlfrctercipdhmvjbgegxdtggqdpbhvhiseehhegnaseoooacnsijubbirjnghgsvpadhaadrtimfdp" }, { "input": "jsinejpfwhzloulxndzvzftgogfdagrsscxmatldssqsgaknnbkcvhptebjjpkjhrjegrotzwcdosezkedzxeoyibmyzunkguoqj\nkfmvybobocdpipiripysioruqvloopvbggpjksgmwzyqwyxnesmvhsawnbbmntulspvsysfkjqwpvoelliopbaukyagedextzoej", "output": "-1" }, { "input": "nttdcfceptruiomtmwzestrfchnqpgqeztpcvthzelfyggjgqadylzubpvbrlgndrcsursczpxlnoyoadxezncqalupfzmjeqihe\nkttdcfceohrjiaahmoldanpfchnfpgheqpdahqhxecfpbgigqadrkjubjfbrlgndbcgcgmcjpeleinaadretncqaiqpfkmjeqihe", "output": "kttdcfceohrjiaahmoldanpfchnfpgheqpdahqhxecfpbgigqadrkjubjfbrlgndbcgcgmcjpeleinaadretncqaiqpfkmjeqihe" }, { "input": "diuopwglduasnaxgduwslbzoyayoypzznqspljcyqehweydhlwifcvnjmaowuvyqfwynjghecqvxdvuquuwpvwrjljozocaxnktv\ntrdydprdzmjhgbhzytelrfjpgsebijicsigmwhynmcyjtqrvojcndodchzxfcvyqjxqzwibccdvsjqhsnectdjyrrhzkeamukang", "output": "-1" }, { "input": "ftfr\nftfr", "output": "ftfr" }, { "input": "ftr\nftr", "output": "ftr" }, { "input": "shftr\nshftr", "output": "shftr" }, { "input": "vkvkkv\nvkvkkv", "output": "vkvkkv" }, { "input": "ftrd\nftrd", "output": "ftrd" }, { "input": "fztr\nfztr", "output": "fztr" }, { "input": "frtr\nfrtr", "output": "frtr" }, { "input": "shdftr\nshdftr", "output": "shdftr" }, { "input": "zzz\nzzz", "output": "zzz" }, { "input": "shtr\nshtr", "output": "shtr" }, { "input": "aaaaa\nzzzzz", "output": "-1" }, { "input": "efr\nefr", "output": "efr" } ]
1,502,874,959
2,147,483,647
Python 3
OK
TESTS
35
77
4,608,000
s=input() r=input() x=0 for i in range(len(s)): if(s[i]<r[i]): x=1 break if(x): print(-1) else: print(r)
Title: Valued Keys Time Limit: None seconds Memory Limit: None megabytes Problem Description: You found a mysterious function *f*. The function takes two strings *s*1 and *s*2. These strings must consist only of lowercase English letters, and must be the same length. The output of the function *f* is another string of the same length. The *i*-th character of the output is equal to the minimum of the *i*-th character of *s*1 and the *i*-th character of *s*2. For example, *f*("ab", "ba") = "aa", and *f*("nzwzl", "zizez") = "niwel". You found two strings *x* and *y* of the same length and consisting of only lowercase English letters. Find any string *z* such that *f*(*x*,<=*z*)<==<=*y*, or print -1 if no such string *z* exists. Input Specification: The first line of input contains the string *x*. The second line of input contains the string *y*. Both *x* and *y* consist only of lowercase English letters, *x* and *y* have same length and this length is between 1 and 100. Output Specification: If there is no string *z* such that *f*(*x*,<=*z*)<==<=*y*, print -1. Otherwise, print a string *z* such that *f*(*x*,<=*z*)<==<=*y*. If there are multiple possible answers, print any of them. The string *z* should be the same length as *x* and *y* and consist only of lowercase English letters. Demo Input: ['ab\naa\n', 'nzwzl\nniwel\n', 'ab\nba\n'] Demo Output: ['ba\n', 'xiyez\n', '-1\n'] Note: The first case is from the statement. Another solution for the second case is "zizez" There is no solution for the third case. That is, there is no *z* such that *f*("ab", *z*) =  "ba".
```python s=input() r=input() x=0 for i in range(len(s)): if(s[i]<r[i]): x=1 break if(x): print(-1) else: print(r) ```
3
344
A
Magnets
PROGRAMMING
800
[ "implementation" ]
null
null
Mad scientist Mike entertains himself by arranging rows of dominoes. He doesn't need dominoes, though: he uses rectangular magnets instead. Each magnet has two poles, positive (a "plus") and negative (a "minus"). If two magnets are put together at a close distance, then the like poles will repel each other and the opposite poles will attract each other. Mike starts by laying one magnet horizontally on the table. During each following step Mike adds one more magnet horizontally to the right end of the row. Depending on how Mike puts the magnet on the table, it is either attracted to the previous one (forming a group of multiple magnets linked together) or repelled by it (then Mike lays this magnet at some distance to the right from the previous one). We assume that a sole magnet not linked to others forms a group of its own. Mike arranged multiple magnets in a row. Determine the number of groups that the magnets formed.
The first line of the input contains an integer *n* (1<=≀<=*n*<=≀<=100000) β€” the number of magnets. Then *n* lines follow. The *i*-th line (1<=≀<=*i*<=≀<=*n*) contains either characters "01", if Mike put the *i*-th magnet in the "plus-minus" position, or characters "10", if Mike put the magnet in the "minus-plus" position.
On the single line of the output print the number of groups of magnets.
[ "6\n10\n10\n10\n01\n10\n10\n", "4\n01\n01\n10\n10\n" ]
[ "3\n", "2\n" ]
The first testcase corresponds to the figure. The testcase has three groups consisting of three, one and two magnets. The second testcase has two groups, each consisting of two magnets.
500
[ { "input": "6\n10\n10\n10\n01\n10\n10", "output": "3" }, { "input": "4\n01\n01\n10\n10", "output": "2" }, { "input": "1\n10", "output": "1" }, { "input": "2\n01\n10", "output": "2" }, { "input": "2\n10\n10", "output": "1" }, { "input": "3\n10\n01\n10", "output": "3" }, { "input": "1\n01", "output": "1" }, { "input": "2\n01\n01", "output": "1" }, { "input": "2\n10\n01", "output": "2" }, { "input": "3\n01\n01\n01", "output": "1" }, { "input": "3\n10\n10\n01", "output": "2" }, { "input": "3\n01\n10\n10", "output": "2" }, { "input": "115\n10\n10\n10\n10\n01\n01\n10\n10\n10\n01\n01\n10\n01\n01\n10\n10\n10\n01\n10\n01\n10\n10\n01\n01\n10\n10\n10\n10\n01\n10\n01\n01\n10\n10\n10\n10\n01\n10\n10\n10\n01\n10\n01\n10\n10\n10\n10\n01\n01\n01\n10\n10\n01\n01\n01\n10\n10\n01\n10\n01\n01\n01\n01\n10\n10\n01\n10\n01\n01\n01\n01\n01\n10\n01\n10\n10\n01\n01\n01\n10\n01\n01\n10\n10\n01\n01\n01\n01\n01\n10\n01\n10\n01\n10\n01\n01\n01\n10\n01\n10\n10\n01\n10\n10\n01\n01\n01\n10\n10\n10\n10\n10\n10\n10\n10", "output": "55" } ]
1,697,009,917
2,147,483,647
Python 3
OK
TESTS
31
218
0
LastMagnet = None Groups = 0 for i in range(int(input())): Magnet = input() if Magnet != LastMagnet: Groups += 1 LastMagnet = Magnet print(Groups)
Title: Magnets Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mad scientist Mike entertains himself by arranging rows of dominoes. He doesn't need dominoes, though: he uses rectangular magnets instead. Each magnet has two poles, positive (a "plus") and negative (a "minus"). If two magnets are put together at a close distance, then the like poles will repel each other and the opposite poles will attract each other. Mike starts by laying one magnet horizontally on the table. During each following step Mike adds one more magnet horizontally to the right end of the row. Depending on how Mike puts the magnet on the table, it is either attracted to the previous one (forming a group of multiple magnets linked together) or repelled by it (then Mike lays this magnet at some distance to the right from the previous one). We assume that a sole magnet not linked to others forms a group of its own. Mike arranged multiple magnets in a row. Determine the number of groups that the magnets formed. Input Specification: The first line of the input contains an integer *n* (1<=≀<=*n*<=≀<=100000) β€” the number of magnets. Then *n* lines follow. The *i*-th line (1<=≀<=*i*<=≀<=*n*) contains either characters "01", if Mike put the *i*-th magnet in the "plus-minus" position, or characters "10", if Mike put the magnet in the "minus-plus" position. Output Specification: On the single line of the output print the number of groups of magnets. Demo Input: ['6\n10\n10\n10\n01\n10\n10\n', '4\n01\n01\n10\n10\n'] Demo Output: ['3\n', '2\n'] Note: The first testcase corresponds to the figure. The testcase has three groups consisting of three, one and two magnets. The second testcase has two groups, each consisting of two magnets.
```python LastMagnet = None Groups = 0 for i in range(int(input())): Magnet = input() if Magnet != LastMagnet: Groups += 1 LastMagnet = Magnet print(Groups) ```
3
172
A
Phone Code
PROGRAMMING
800
[ "*special", "brute force", "implementation" ]
null
null
Polycarpus has *n* friends in Tarasov city. Polycarpus knows phone numbers of all his friends: they are strings *s*1,<=*s*2,<=...,<=*s**n*. All these strings consist only of digits and have the same length. Once Polycarpus needed to figure out Tarasov city phone code. He assumed that the phone code of the city is the longest common prefix of all phone numbers of his friends. In other words, it is the longest string *c* which is a prefix (the beginning) of each *s**i* for all *i* (1<=≀<=*i*<=≀<=*n*). Help Polycarpus determine the length of the city phone code.
The first line of the input contains an integer *n* (2<=≀<=*n*<=≀<=3Β·104) β€” the number of Polycarpus's friends. The following *n* lines contain strings *s*1,<=*s*2,<=...,<=*s**n* β€” the phone numbers of Polycarpus's friends. It is guaranteed that all strings consist only of digits and have the same length from 1 to 20, inclusive. It is also guaranteed that all strings are different.
Print the number of digits in the city phone code.
[ "4\n00209\n00219\n00999\n00909\n", "2\n1\n2\n", "3\n77012345678999999999\n77012345678901234567\n77012345678998765432\n" ]
[ "2\n", "0\n", "12\n" ]
A prefix of string *t* is a string that is obtained by deleting zero or more digits from the end of string *t*. For example, string "00209" has 6 prefixes: "" (an empty prefix), "0", "00", "002", "0020", "00209". In the first sample the city phone code is string "00". In the second sample the city phone code is an empty string. In the third sample the city phone code is string "770123456789".
1,000
[ { "input": "4\n00209\n00219\n00999\n00909", "output": "2" }, { "input": "2\n1\n2", "output": "0" }, { "input": "3\n77012345678999999999\n77012345678901234567\n77012345678998765432", "output": "12" }, { "input": "5\n4491183345\n4491184811\n4491162340\n4491233399\n4491449214", "output": "4" }, { "input": "10\n15424\n10953\n19176\n15514\n16284\n18680\n19305\n13816\n16168\n15924", "output": "1" }, { "input": "10\n4906361343\n8985777485\n1204265609\n7088384855\n4127287014\n7904807820\n3032139021\n5999959109\n6477458281\n3244359368", "output": "0" }, { "input": "10\n3717208309\n3717208306\n3717208302\n3717208301\n3717208303\n3717208308\n3717208304\n3717208307\n3717208300\n3717208305", "output": "9" }, { "input": "9\n2881\n2808\n2868\n2874\n2894\n2870\n2818\n2896\n2890", "output": "2" }, { "input": "2\n4\n9", "output": "0" }, { "input": "2\n29867863763143509570\n59261213969200291523", "output": "0" }, { "input": "2\n84\n62", "output": "0" }, { "input": "2\n75970434466248453472\n75970434466248453476", "output": "19" }, { "input": "10\n17254072509168593435\n17254072509168593433\n17254072509168593430\n17254072509168593432\n17254072509168593439\n17254072509168593436\n17254072509168593438\n17254072509168593437\n17254072509168593431\n17254072509168593434", "output": "19" } ]
1,641,617,444
2,147,483,647
Python 3
OK
TESTS
28
216
1,638,400
def solve(): n = int(input()) numbers = [] for i in range(n): numbers.append(input()) numbers_length = len(numbers) number_length = len(numbers[0]) code = 0 for i in range(number_length): first_number = numbers[0][i] for j in range(numbers_length): if numbers[j][i] != first_number: print(code) return code = code + 1 print(code) solve()
Title: Phone Code Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarpus has *n* friends in Tarasov city. Polycarpus knows phone numbers of all his friends: they are strings *s*1,<=*s*2,<=...,<=*s**n*. All these strings consist only of digits and have the same length. Once Polycarpus needed to figure out Tarasov city phone code. He assumed that the phone code of the city is the longest common prefix of all phone numbers of his friends. In other words, it is the longest string *c* which is a prefix (the beginning) of each *s**i* for all *i* (1<=≀<=*i*<=≀<=*n*). Help Polycarpus determine the length of the city phone code. Input Specification: The first line of the input contains an integer *n* (2<=≀<=*n*<=≀<=3Β·104) β€” the number of Polycarpus's friends. The following *n* lines contain strings *s*1,<=*s*2,<=...,<=*s**n* β€” the phone numbers of Polycarpus's friends. It is guaranteed that all strings consist only of digits and have the same length from 1 to 20, inclusive. It is also guaranteed that all strings are different. Output Specification: Print the number of digits in the city phone code. Demo Input: ['4\n00209\n00219\n00999\n00909\n', '2\n1\n2\n', '3\n77012345678999999999\n77012345678901234567\n77012345678998765432\n'] Demo Output: ['2\n', '0\n', '12\n'] Note: A prefix of string *t* is a string that is obtained by deleting zero or more digits from the end of string *t*. For example, string "00209" has 6 prefixes: "" (an empty prefix), "0", "00", "002", "0020", "00209". In the first sample the city phone code is string "00". In the second sample the city phone code is an empty string. In the third sample the city phone code is string "770123456789".
```python def solve(): n = int(input()) numbers = [] for i in range(n): numbers.append(input()) numbers_length = len(numbers) number_length = len(numbers[0]) code = 0 for i in range(number_length): first_number = numbers[0][i] for j in range(numbers_length): if numbers[j][i] != first_number: print(code) return code = code + 1 print(code) solve() ```
3
58
A
Chat room
PROGRAMMING
1,000
[ "greedy", "strings" ]
A. Chat room
1
256
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
If Vasya managed to say hello, print "YES", otherwise print "NO".
[ "ahhellllloou\n", "hlelo\n" ]
[ "YES\n", "NO\n" ]
none
500
[ { "input": "ahhellllloou", "output": "YES" }, { "input": "hlelo", "output": "NO" }, { "input": "helhcludoo", "output": "YES" }, { "input": "hehwelloho", "output": "YES" }, { "input": "pnnepelqomhhheollvlo", "output": "YES" }, { "input": "tymbzjyqhymedasloqbq", "output": "NO" }, { "input": "yehluhlkwo", "output": "NO" }, { "input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello", "output": "YES" }, { "input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq", "output": "YES" }, { "input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi", "output": "YES" }, { "input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo", "output": "YES" }, { "input": "lqllcolohwflhfhlnaow", "output": "NO" }, { "input": "heheeellollvoo", "output": "YES" }, { "input": "hellooo", "output": "YES" }, { "input": "o", "output": "NO" }, { "input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv", "output": "YES" }, { "input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk", "output": "YES" }, { "input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry", "output": "NO" }, { "input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq", "output": "NO" }, { "input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi", "output": "YES" }, { "input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm", "output": "YES" }, { "input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac", "output": "NO" }, { "input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok", "output": "YES" }, { "input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz", "output": "YES" }, { "input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb", "output": "YES" }, { "input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla", "output": "YES" }, { "input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz", "output": "YES" }, { "input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti", "output": "YES" }, { "input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli", "output": "YES" }, { "input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo", "output": "YES" }, { "input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk", "output": "NO" }, { "input": "loee", "output": "NO" }, { "input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo", "output": "NO" }, { "input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi", "output": "YES" }, { "input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv", "output": "NO" }, { "input": "hello", "output": "YES" }, { "input": "oohell", "output": "NO" }, { "input": "hell", "output": "NO" }, { "input": "eloellohoelo", "output": "NO" }, { "input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo", "output": "YES" } ]
1,686,124,208
2,147,483,647
Python 3
OK
TESTS
40
46
0
s=input() j=[] o=0 while o<len (s): if s[o] == 'h' and len(j)==0: j.append('h') elif s[o] == 'e' and len(j)==1: j.append('e') elif s[o] == 'l' and (len(j)==2 or len(j)==3): j.append('l') elif s[o] == 'o' and len(j)==4: j.append('l') o+=1 if len(j)==5: print('YES') else: print('NO')
Title: Chat room Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*. Input Specification: The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters. Output Specification: If Vasya managed to say hello, print "YES", otherwise print "NO". Demo Input: ['ahhellllloou\n', 'hlelo\n'] Demo Output: ['YES\n', 'NO\n'] Note: none
```python s=input() j=[] o=0 while o<len (s): if s[o] == 'h' and len(j)==0: j.append('h') elif s[o] == 'e' and len(j)==1: j.append('e') elif s[o] == 'l' and (len(j)==2 or len(j)==3): j.append('l') elif s[o] == 'o' and len(j)==4: j.append('l') o+=1 if len(j)==5: print('YES') else: print('NO') ```
3.977
55
B
Smallest number
PROGRAMMING
1,600
[ "brute force" ]
B. Smallest number
2
256
Recently, Vladimir got bad mark in algebra again. To avoid such unpleasant events in future he decided to train his arithmetic skills. He wrote four integer numbers *a*, *b*, *c*, *d* on the blackboard. During each of the next three minutes he took two numbers from the blackboard (not necessarily adjacent) and replaced them with their sum or their product. In the end he got one number. Unfortunately, due to the awful memory he forgot that number, but he remembers four original numbers, sequence of the operations and his surprise because of the very small result. Help Vladimir remember the forgotten number: find the smallest number that can be obtained from the original numbers by the given sequence of operations.
First line contains four integers separated by space: 0<=≀<=*a*,<=*b*,<=*c*,<=*d*<=≀<=1000 β€” the original numbers. Second line contains three signs ('+' or '*' each) separated by space β€” the sequence of the operations in the order of performing. ('+' stands for addition, '*' β€” multiplication)
Output one integer number β€” the minimal result which can be obtained. Please, do not use %lld specificator to read or write 64-bit integers in C++. It is preffered to use cin (also you may use %I64d).
[ "1 1 1 1\n+ + *\n", "2 2 2 2\n* * +\n", "1 2 3 4\n* + +\n" ]
[ "3\n", "8\n", "9\n" ]
none
1,000
[ { "input": "1 1 1 1\n+ + *", "output": "3" }, { "input": "2 2 2 2\n* * +", "output": "8" }, { "input": "1 2 3 4\n* + +", "output": "9" }, { "input": "15 1 3 1\n* * +", "output": "18" }, { "input": "8 1 7 14\n+ + +", "output": "30" }, { "input": "7 17 3 25\n+ * +", "output": "63" }, { "input": "13 87 4 17\n* * *", "output": "76908" }, { "input": "7 0 8 15\n+ + *", "output": "0" }, { "input": "52 0 43 239\n+ + +", "output": "334" }, { "input": "1000 1000 999 1000\n* * *", "output": "999000000000" }, { "input": "720 903 589 804\n* * *", "output": "307887168960" }, { "input": "631 149 496 892\n* * +", "output": "445884" }, { "input": "220 127 597 394\n* + +", "output": "28931" }, { "input": "214 862 466 795\n+ + +", "output": "2337" }, { "input": "346 290 587 525\n* * *", "output": "30922279500" }, { "input": "323 771 559 347\n+ * *", "output": "149067730" }, { "input": "633 941 836 254\n* + +", "output": "162559" }, { "input": "735 111 769 553\n+ * *", "output": "92320032" }, { "input": "622 919 896 120\n* * +", "output": "667592" }, { "input": "652 651 142 661\n+ + +", "output": "2106" }, { "input": "450 457 975 35\n* * *", "output": "7017806250" }, { "input": "883 954 804 352\n* * +", "output": "1045740" }, { "input": "847 206 949 358\n* + *", "output": "62660050" }, { "input": "663 163 339 76\n+ + +", "output": "1241" }, { "input": "990 330 253 553\n+ * +", "output": "85033" }, { "input": "179 346 525 784\n* * *", "output": "25492034400" }, { "input": "780 418 829 778\n+ + *", "output": "997766" }, { "input": "573 598 791 124\n* * *", "output": "33608874936" }, { "input": "112 823 202 223\n* * +", "output": "137222" }, { "input": "901 166 994 315\n* + *", "output": "47278294" }, { "input": "393 342 840 486\n+ * *", "output": "178222356" }, { "input": "609 275 153 598\n+ + *", "output": "226746" }, { "input": "56 828 386 57\n+ * *", "output": "3875088" }, { "input": "944 398 288 986\n+ + *", "output": "670464" }, { "input": "544 177 162 21\n+ + *", "output": "18543" }, { "input": "105 238 316 265\n+ + +", "output": "924" }, { "input": "31 353 300 911\n* * *", "output": "2990721900" }, { "input": "46 378 310 194\n* * +", "output": "77528" }, { "input": "702 534 357 657\n+ * *", "output": "259077042" }, { "input": "492 596 219 470\n+ + *", "output": "341202" }, { "input": "482 842 982 902\n+ * +", "output": "407728" }, { "input": "827 578 394 351\n* * *", "output": "66105361764" }, { "input": "901 884 426 451\n* + *", "output": "170223210" }, { "input": "210 295 12 795\n* * +", "output": "71490" }, { "input": "40 734 948 202\n+ * *", "output": "13590560" }, { "input": "136 611 963 195\n+ + *", "output": "240584" }, { "input": "695 74 871 760\n+ * +", "output": "53061" }, { "input": "666 884 772 54\n* + +", "output": "37620" }, { "input": "975 785 753 224\n+ * +", "output": "170432" }, { "input": "35 187 126 596\n+ + +", "output": "944" }, { "input": "243 386 431 35\n* + *", "output": "3298015" }, { "input": "229 602 133 635\n* * +", "output": "222313" }, { "input": "916 207 238 891\n+ + *", "output": "423315" }, { "input": "922 145 883 357\n+ + *", "output": "313490" }, { "input": "69 355 762 111\n* + +", "output": "8776" }, { "input": "209 206 34 67\n* + *", "output": "476374" }, { "input": "693 824 375 361\n* * +", "output": "557339" }, { "input": "45 712 635 467\n* + +", "output": "22362" }, { "input": "426 283 179 211\n+ + +", "output": "1099" }, { "input": "802 387 686 12\n+ + +", "output": "1887" } ]
1,678,947,099
2,147,483,647
PyPy 3-64
OK
TESTS
60
124
0
nums = list(map(str,input().split())) operators = list(map(str,input().split())) ans = float("inf") def smallestnum(nums,m): global ans if len(nums)==1: ans = min(ans,int(nums[0])) return for i in range(len(nums)): for j in range(i+1,len(nums)): new_list = [v for k,v in enumerate(nums) if k!=i and k!=j] op = eval(nums[i]+operators[m]+nums[j]) new_list.append(str(op)) smallestnum(new_list,m+1) new_list.remove(str(op)) smallestnum(nums,0) print(ans)
Title: Smallest number Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Recently, Vladimir got bad mark in algebra again. To avoid such unpleasant events in future he decided to train his arithmetic skills. He wrote four integer numbers *a*, *b*, *c*, *d* on the blackboard. During each of the next three minutes he took two numbers from the blackboard (not necessarily adjacent) and replaced them with their sum or their product. In the end he got one number. Unfortunately, due to the awful memory he forgot that number, but he remembers four original numbers, sequence of the operations and his surprise because of the very small result. Help Vladimir remember the forgotten number: find the smallest number that can be obtained from the original numbers by the given sequence of operations. Input Specification: First line contains four integers separated by space: 0<=≀<=*a*,<=*b*,<=*c*,<=*d*<=≀<=1000 β€” the original numbers. Second line contains three signs ('+' or '*' each) separated by space β€” the sequence of the operations in the order of performing. ('+' stands for addition, '*' β€” multiplication) Output Specification: Output one integer number β€” the minimal result which can be obtained. Please, do not use %lld specificator to read or write 64-bit integers in C++. It is preffered to use cin (also you may use %I64d). Demo Input: ['1 1 1 1\n+ + *\n', '2 2 2 2\n* * +\n', '1 2 3 4\n* + +\n'] Demo Output: ['3\n', '8\n', '9\n'] Note: none
```python nums = list(map(str,input().split())) operators = list(map(str,input().split())) ans = float("inf") def smallestnum(nums,m): global ans if len(nums)==1: ans = min(ans,int(nums[0])) return for i in range(len(nums)): for j in range(i+1,len(nums)): new_list = [v for k,v in enumerate(nums) if k!=i and k!=j] op = eval(nums[i]+operators[m]+nums[j]) new_list.append(str(op)) smallestnum(new_list,m+1) new_list.remove(str(op)) smallestnum(nums,0) print(ans) ```
3.969
991
B
Getting an A
PROGRAMMING
900
[ "greedy", "sortings" ]
null
null
Translator's note: in Russia's most widespread grading system, there are four grades: 5, 4, 3, 2, the higher the better, roughly corresponding to A, B, C and F respectively in American grading system. The term is coming to an end and students start thinking about their grades. Today, a professor told his students that the grades for his course would be given out automatically Β β€” he would calculate the simple average (arithmetic mean) of all grades given out for lab works this term and round to the nearest integer. The rounding would be done in favour of the studentΒ β€” $4.5$ would be rounded up to $5$ (as in example 3), but $4.4$ would be rounded down to $4$. This does not bode well for Vasya who didn't think those lab works would influence anything, so he may receive a grade worse than $5$ (maybe even the dreaded $2$). However, the professor allowed him to redo some of his works of Vasya's choosing to increase his average grade. Vasya wants to redo as as few lab works as possible in order to get $5$ for the course. Of course, Vasya will get $5$ for the lab works he chooses to redo. Help VasyaΒ β€” calculate the minimum amount of lab works Vasya has to redo.
The first line contains a single integer $n$Β β€” the number of Vasya's grades ($1 \leq n \leq 100$). The second line contains $n$ integers from $2$ to $5$Β β€” Vasya's grades for his lab works.
Output a single integerΒ β€” the minimum amount of lab works that Vasya has to redo. It can be shown that Vasya can always redo enough lab works to get a $5$.
[ "3\n4 4 4\n", "4\n5 4 5 5\n", "4\n5 3 3 5\n" ]
[ "2\n", "0\n", "1\n" ]
In the first sample, it is enough to redo two lab works to make two $4$s into $5$s. In the second sample, Vasya's average is already $4.75$ so he doesn't have to redo anything to get a $5$. In the second sample Vasya has to redo one lab work to get rid of one of the $3$s, that will make the average exactly $4.5$ so the final grade would be $5$.
1,000
[ { "input": "3\n4 4 4", "output": "2" }, { "input": "4\n5 4 5 5", "output": "0" }, { "input": "4\n5 3 3 5", "output": "1" }, { "input": "1\n5", "output": "0" }, { "input": "4\n3 2 5 4", "output": "2" }, { "input": "5\n5 4 3 2 5", "output": "2" }, { "input": "8\n5 4 2 5 5 2 5 5", "output": "1" }, { "input": "5\n5 5 2 5 5", "output": "1" }, { "input": "6\n5 5 5 5 5 2", "output": "0" }, { "input": "6\n2 2 2 2 2 2", "output": "5" }, { "input": "100\n3 2 4 3 3 3 4 2 3 5 5 2 5 2 3 2 4 4 4 5 5 4 2 5 4 3 2 5 3 4 3 4 2 4 5 4 2 4 3 4 5 2 5 3 3 4 2 2 4 4 4 5 4 3 3 3 2 5 2 2 2 3 5 4 3 2 4 5 5 5 2 2 4 2 3 3 3 5 3 2 2 4 5 5 4 5 5 4 2 3 2 2 2 2 5 3 5 2 3 4", "output": "40" }, { "input": "1\n2", "output": "1" }, { "input": "1\n3", "output": "1" }, { "input": "1\n4", "output": "1" }, { "input": "4\n3 2 5 5", "output": "1" }, { "input": "6\n4 3 3 3 3 4", "output": "4" }, { "input": "8\n3 3 5 3 3 3 5 5", "output": "3" }, { "input": "10\n2 4 5 5 5 5 2 3 3 2", "output": "3" }, { "input": "20\n5 2 5 2 2 2 2 2 5 2 2 5 2 5 5 2 2 5 2 2", "output": "10" }, { "input": "25\n4 4 4 4 3 4 3 3 3 3 3 4 4 3 4 4 4 4 4 3 3 3 4 3 4", "output": "13" }, { "input": "30\n4 2 4 2 4 2 2 4 4 4 4 2 4 4 4 2 2 2 2 4 2 4 4 4 2 4 2 4 2 2", "output": "15" }, { "input": "52\n5 3 4 4 4 3 5 3 4 5 3 4 4 3 5 5 4 3 3 3 4 5 4 4 5 3 5 3 5 4 5 5 4 3 4 5 3 4 3 3 4 4 4 3 5 3 4 5 3 5 4 5", "output": "14" }, { "input": "77\n5 3 2 3 2 3 2 3 5 2 2 3 3 3 3 5 3 3 2 2 2 5 5 5 5 3 2 2 5 2 3 2 2 5 2 5 3 3 2 2 5 5 2 3 3 2 3 3 3 2 5 5 2 2 3 3 5 5 2 2 5 5 3 3 5 5 2 2 5 2 2 5 5 5 2 5 2", "output": "33" }, { "input": "55\n3 4 2 3 3 2 4 4 3 3 4 2 4 4 3 3 2 3 2 2 3 3 2 3 2 3 2 4 4 3 2 3 2 3 3 2 2 4 2 4 4 3 4 3 2 4 3 2 4 2 2 3 2 3 4", "output": "34" }, { "input": "66\n5 4 5 5 4 4 4 4 4 2 5 5 2 4 2 2 2 5 4 4 4 4 5 2 2 5 5 2 2 4 4 2 4 2 2 5 2 5 4 5 4 5 4 4 2 5 2 4 4 4 2 2 5 5 5 5 4 4 4 4 4 2 4 5 5 5", "output": "16" }, { "input": "99\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2", "output": "83" }, { "input": "100\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2", "output": "84" }, { "input": "99\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3", "output": "75" }, { "input": "100\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3", "output": "75" }, { "input": "99\n2 2 3 3 3 3 3 2 2 3 2 3 2 3 2 2 3 2 3 2 3 3 3 3 2 2 2 2 3 2 3 3 3 3 3 2 3 3 3 3 2 3 2 3 3 3 2 3 2 3 3 3 3 2 2 3 2 3 2 3 2 3 2 2 2 3 3 2 3 2 2 2 2 2 2 2 2 3 3 3 3 2 3 2 3 3 2 3 2 3 2 3 3 2 2 2 3 2 3", "output": "75" }, { "input": "100\n3 2 3 3 2 2 3 2 2 3 3 2 3 2 2 2 2 2 3 2 2 2 3 2 3 3 2 2 3 2 2 2 2 3 2 3 3 2 2 3 2 2 3 2 3 2 2 3 2 3 2 2 3 2 2 3 3 3 3 3 2 2 3 2 3 3 2 2 3 2 2 2 3 2 2 3 3 2 2 3 3 3 3 2 3 2 2 2 3 3 2 2 3 2 2 2 2 3 2 2", "output": "75" }, { "input": "99\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "50" }, { "input": "100\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "50" }, { "input": "99\n2 2 2 2 4 2 2 2 2 4 4 4 4 2 4 4 2 2 4 4 2 2 2 4 4 2 4 4 2 4 4 2 2 2 4 4 2 2 2 2 4 4 4 2 2 2 4 4 2 4 2 4 2 2 4 2 4 4 4 4 4 2 2 4 4 4 2 2 2 2 4 2 4 2 2 2 2 2 2 4 4 2 4 2 2 4 2 2 2 2 2 4 2 4 2 2 4 4 4", "output": "54" }, { "input": "100\n4 2 4 4 2 4 2 2 4 4 4 4 4 4 4 4 4 2 4 4 2 2 4 4 2 2 4 4 2 2 2 4 4 2 4 4 2 4 2 2 4 4 2 4 2 4 4 4 2 2 2 2 2 2 2 4 2 2 2 4 4 4 2 2 2 2 4 2 2 2 2 2 2 2 4 4 4 4 4 4 4 4 4 2 2 2 2 2 2 2 2 4 4 4 4 2 4 2 2 4", "output": "50" }, { "input": "99\n4 3 4 4 4 4 4 3 4 3 3 4 3 3 4 4 3 3 3 4 3 4 3 3 4 3 3 3 3 4 3 4 4 3 4 4 3 3 4 4 4 3 3 3 4 4 3 3 4 3 4 3 4 3 4 3 3 3 3 4 3 4 4 4 4 4 4 3 4 4 3 3 3 3 3 3 3 3 4 3 3 3 4 4 4 4 4 4 3 3 3 3 4 4 4 3 3 4 3", "output": "51" }, { "input": "100\n3 3 4 4 4 4 4 3 4 4 3 3 3 3 4 4 4 4 4 4 3 3 3 4 3 4 3 4 3 3 4 3 3 3 3 3 3 3 3 4 3 4 3 3 4 3 3 3 4 4 3 4 4 3 3 4 4 4 4 4 4 3 4 4 3 4 3 3 3 4 4 3 3 4 4 3 4 4 4 3 3 4 3 3 4 3 4 3 4 3 3 4 4 4 3 3 4 3 3 4", "output": "51" }, { "input": "99\n3 3 4 4 4 2 4 4 3 2 3 4 4 4 2 2 2 3 2 4 4 2 4 3 2 2 2 4 2 3 4 3 4 2 3 3 4 2 3 3 2 3 4 4 3 2 4 3 4 3 3 3 3 3 4 4 3 3 4 4 2 4 3 4 3 2 3 3 3 4 4 2 4 4 2 3 4 2 3 3 3 4 2 2 3 2 4 3 2 3 3 2 3 4 2 3 3 2 3", "output": "58" }, { "input": "100\n2 2 4 2 2 3 2 3 4 4 3 3 4 4 4 2 3 2 2 3 4 2 3 2 4 3 4 2 3 3 3 2 4 3 3 2 2 3 2 4 4 2 4 3 4 4 3 3 3 2 4 2 2 2 2 2 2 3 2 3 2 3 4 4 4 2 2 3 4 4 3 4 3 3 2 3 3 3 4 3 2 3 3 2 4 2 3 3 4 4 3 3 4 3 4 3 3 4 3 3", "output": "61" }, { "input": "99\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5", "output": "0" }, { "input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5", "output": "0" }, { "input": "99\n2 2 2 2 2 5 2 2 5 2 5 2 5 2 2 2 2 2 5 2 2 2 5 2 2 5 2 2 2 5 5 2 5 2 2 5 2 5 2 2 5 5 2 2 2 2 5 5 2 2 2 5 2 2 5 2 2 2 2 2 5 5 5 5 2 2 5 2 5 2 2 2 2 2 5 2 2 5 5 2 2 2 2 2 5 5 2 2 5 5 2 2 2 2 5 5 5 2 5", "output": "48" }, { "input": "100\n5 5 2 2 2 2 2 2 5 5 2 5 2 2 2 2 5 2 5 2 5 5 2 5 5 2 2 2 2 2 2 5 2 2 2 5 2 2 5 2 2 5 5 5 2 5 5 5 5 5 5 2 2 5 2 2 5 5 5 5 5 2 5 2 5 2 2 2 5 2 5 2 5 5 2 5 5 2 2 5 2 5 5 2 5 2 2 5 2 2 2 5 2 2 2 2 5 5 2 5", "output": "38" }, { "input": "99\n5 3 3 3 5 3 3 3 3 3 3 3 3 5 3 3 3 3 3 3 3 3 5 3 3 3 5 5 3 5 5 3 3 5 5 5 3 5 3 3 3 3 5 3 3 5 5 3 5 5 5 3 5 3 5 3 5 5 5 5 3 3 3 5 3 5 3 3 3 5 5 5 5 5 3 5 5 3 3 5 5 3 5 5 3 5 5 3 3 5 5 5 3 3 3 5 3 3 3", "output": "32" }, { "input": "100\n3 3 3 5 3 3 3 3 3 3 5 5 5 5 3 3 3 3 5 3 3 3 3 3 5 3 5 3 3 5 5 5 5 5 5 3 3 5 3 3 5 3 5 5 5 3 5 3 3 3 3 3 3 3 3 3 3 3 5 5 3 5 3 5 5 3 5 3 3 5 3 5 5 5 5 3 5 3 3 3 5 5 5 3 3 3 5 3 5 5 5 3 3 3 5 3 5 5 3 5", "output": "32" }, { "input": "99\n5 3 5 5 3 3 3 2 2 5 2 5 3 2 5 2 5 2 3 5 3 2 3 2 5 5 2 2 3 3 5 5 3 5 5 2 3 3 5 2 2 5 3 2 5 2 3 5 5 2 5 2 2 5 3 3 5 3 3 5 3 2 3 5 3 2 3 2 3 2 2 2 2 5 2 2 3 2 5 5 5 3 3 2 5 3 5 5 5 2 3 2 5 5 2 5 2 5 3", "output": "39" }, { "input": "100\n3 5 3 3 5 5 3 3 2 5 5 3 3 3 2 2 3 2 5 3 2 2 3 3 3 3 2 5 3 2 3 3 5 2 2 2 3 2 3 5 5 3 2 5 2 2 5 5 3 5 5 5 2 2 5 5 3 3 2 2 2 5 3 3 2 2 3 5 3 2 3 5 5 3 2 3 5 5 3 3 2 3 5 2 5 5 5 5 5 5 3 5 3 2 3 3 2 5 2 2", "output": "42" }, { "input": "99\n4 4 4 5 4 4 5 5 4 4 5 5 5 4 5 4 5 5 5 4 4 5 5 5 5 4 5 5 5 4 4 5 5 4 5 4 4 4 5 5 5 5 4 4 5 4 4 5 4 4 4 4 5 5 5 4 5 4 5 5 5 5 5 4 5 4 5 4 4 4 4 5 5 5 4 5 5 4 4 5 5 5 4 5 4 4 5 5 4 5 5 5 5 4 5 5 4 4 4", "output": "0" }, { "input": "100\n4 4 5 5 5 5 5 5 4 4 5 5 4 4 5 5 4 5 4 4 4 4 4 4 4 4 5 5 5 5 5 4 4 4 4 4 5 4 4 5 4 4 4 5 5 5 4 5 5 5 5 5 5 4 4 4 4 4 4 5 5 4 5 4 4 5 4 4 4 4 5 5 4 5 5 4 4 4 5 5 5 5 4 5 5 5 4 4 5 5 5 4 5 4 5 4 4 5 5 4", "output": "1" }, { "input": "99\n2 2 2 5 2 2 2 2 2 4 4 5 5 2 2 4 2 5 2 2 2 5 2 2 5 5 5 4 5 5 4 4 2 2 5 2 2 2 2 5 5 2 2 4 4 4 2 2 2 5 2 4 4 2 4 2 4 2 5 4 2 2 5 2 4 4 4 2 5 2 2 5 4 2 2 5 5 5 2 4 5 4 5 5 4 4 4 5 4 5 4 5 4 2 5 2 2 2 4", "output": "37" }, { "input": "100\n4 4 5 2 2 5 4 5 2 2 2 4 2 5 4 4 2 2 4 5 2 4 2 5 5 4 2 4 4 2 2 5 4 2 5 4 5 2 5 2 4 2 5 4 5 2 2 2 5 2 5 2 5 2 2 4 4 5 5 5 5 5 5 5 4 2 2 2 4 2 2 4 5 5 4 5 4 2 2 2 2 4 2 2 5 5 4 2 2 5 4 5 5 5 4 5 5 5 2 2", "output": "31" }, { "input": "99\n5 3 4 4 5 4 4 4 3 5 4 3 3 4 3 5 5 5 5 4 3 3 5 3 4 5 3 5 4 4 3 5 5 4 4 4 4 3 5 3 3 5 5 5 5 5 4 3 4 4 3 5 5 3 3 4 4 4 5 4 4 5 4 4 4 4 5 5 4 3 3 4 3 5 3 3 3 3 4 4 4 4 3 4 5 4 4 5 5 5 3 4 5 3 4 5 4 3 3", "output": "24" }, { "input": "100\n5 4 4 4 5 5 5 4 5 4 4 3 3 4 4 4 5 4 5 5 3 5 5 4 5 5 5 4 4 5 3 5 3 5 3 3 5 4 4 5 5 4 5 5 3 4 5 4 4 3 4 4 3 3 5 4 5 4 5 3 4 5 3 4 5 4 3 5 4 5 4 4 4 3 4 5 3 4 3 5 3 4 4 4 3 4 4 5 3 3 4 4 5 5 4 3 4 4 3 5", "output": "19" }, { "input": "99\n2 2 5 2 5 3 4 2 3 5 4 3 4 2 5 3 2 2 4 2 4 4 5 4 4 5 2 5 5 3 2 3 2 2 3 4 5 3 5 2 5 4 4 5 4 2 2 3 2 3 3 3 4 4 3 2 2 4 4 2 5 3 5 3 5 4 4 4 5 4 5 2 2 5 4 4 4 3 3 2 5 2 5 2 3 2 5 2 2 5 5 3 4 5 3 4 4 4 4", "output": "37" }, { "input": "2\n5 2", "output": "1" }, { "input": "5\n2 2 2 2 2", "output": "5" }, { "input": "100\n2 3 2 2 2 3 2 3 3 3 3 3 2 3 3 2 2 3 3 2 3 2 3 2 3 4 4 4 3 3 3 3 3 4 4 3 3 4 3 2 3 4 3 3 3 3 2 3 4 3 4 3 3 2 4 4 2 4 4 3 3 3 3 4 3 2 3 4 3 4 4 4 4 4 3 2 2 3 4 2 4 4 4 2 2 4 2 2 3 2 2 4 4 3 4 2 3 3 2 2", "output": "61" }, { "input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "1" }, { "input": "100\n5 4 3 5 3 5 4 2 3 3 4 5 4 5 5 4 2 4 2 2 5 2 5 3 4 4 4 5 5 5 3 4 4 4 3 5 3 2 5 4 3 3 3 5 2 3 4 2 5 4 3 4 5 2 2 3 4 4 2 3 3 3 2 5 2 3 4 3 3 3 2 5 4 3 4 5 4 2 5 4 5 2 2 4 2 2 5 5 4 5 2 2 2 2 5 2 4 4 4 5", "output": "35" }, { "input": "2\n2 2", "output": "2" }, { "input": "20\n4 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 5 5 5", "output": "1" } ]
1,580,109,171
2,147,483,647
PyPy 3
OK
TESTS
61
155
0
import math n=int(input()) a = list(map(int,input().split())) g=math.ceil(4.5*n)-sum(a) a.sort() sum=0 i=0 while(sum<g): sum+=5-a[i] i+=1 print(i)
Title: Getting an A Time Limit: None seconds Memory Limit: None megabytes Problem Description: Translator's note: in Russia's most widespread grading system, there are four grades: 5, 4, 3, 2, the higher the better, roughly corresponding to A, B, C and F respectively in American grading system. The term is coming to an end and students start thinking about their grades. Today, a professor told his students that the grades for his course would be given out automatically Β β€” he would calculate the simple average (arithmetic mean) of all grades given out for lab works this term and round to the nearest integer. The rounding would be done in favour of the studentΒ β€” $4.5$ would be rounded up to $5$ (as in example 3), but $4.4$ would be rounded down to $4$. This does not bode well for Vasya who didn't think those lab works would influence anything, so he may receive a grade worse than $5$ (maybe even the dreaded $2$). However, the professor allowed him to redo some of his works of Vasya's choosing to increase his average grade. Vasya wants to redo as as few lab works as possible in order to get $5$ for the course. Of course, Vasya will get $5$ for the lab works he chooses to redo. Help VasyaΒ β€” calculate the minimum amount of lab works Vasya has to redo. Input Specification: The first line contains a single integer $n$Β β€” the number of Vasya's grades ($1 \leq n \leq 100$). The second line contains $n$ integers from $2$ to $5$Β β€” Vasya's grades for his lab works. Output Specification: Output a single integerΒ β€” the minimum amount of lab works that Vasya has to redo. It can be shown that Vasya can always redo enough lab works to get a $5$. Demo Input: ['3\n4 4 4\n', '4\n5 4 5 5\n', '4\n5 3 3 5\n'] Demo Output: ['2\n', '0\n', '1\n'] Note: In the first sample, it is enough to redo two lab works to make two $4$s into $5$s. In the second sample, Vasya's average is already $4.75$ so he doesn't have to redo anything to get a $5$. In the second sample Vasya has to redo one lab work to get rid of one of the $3$s, that will make the average exactly $4.5$ so the final grade would be $5$.
```python import math n=int(input()) a = list(map(int,input().split())) g=math.ceil(4.5*n)-sum(a) a.sort() sum=0 i=0 while(sum<g): sum+=5-a[i] i+=1 print(i) ```
3
579
A
Raising Bacteria
PROGRAMMING
1,000
[ "bitmasks" ]
null
null
You are a lover of bacteria. You want to raise some bacteria in a box. Initially, the box is empty. Each morning, you can put any number of bacteria into the box. And each night, every bacterium in the box will split into two bacteria. You hope to see exactly *x* bacteria in the box at some moment. What is the minimum number of bacteria you need to put into the box across those days?
The only line containing one integer *x* (1<=≀<=*x*<=≀<=109).
The only line containing one integer: the answer.
[ "5\n", "8\n" ]
[ "2\n", "1\n" ]
For the first sample, we can add one bacterium in the box in the first day morning and at the third morning there will be 4 bacteria in the box. Now we put one more resulting 5 in the box. We added 2 bacteria in the process so the answer is 2. For the second sample, we can put one in the first morning and in the 4-th morning there will be 8 in the box. So the answer is 1.
250
[ { "input": "5", "output": "2" }, { "input": "8", "output": "1" }, { "input": "536870911", "output": "29" }, { "input": "1", "output": "1" }, { "input": "343000816", "output": "14" }, { "input": "559980448", "output": "12" }, { "input": "697681824", "output": "14" }, { "input": "41313494", "output": "14" }, { "input": "673935585", "output": "13" }, { "input": "117422204", "output": "19" }, { "input": "954746654", "output": "15" }, { "input": "536838144", "output": "14" }, { "input": "1000000000", "output": "13" }, { "input": "2", "output": "1" }, { "input": "3", "output": "2" }, { "input": "4", "output": "1" }, { "input": "6", "output": "2" }, { "input": "7", "output": "3" }, { "input": "9", "output": "2" }, { "input": "10", "output": "2" }, { "input": "999999999", "output": "21" }, { "input": "999999998", "output": "20" }, { "input": "999999997", "output": "20" }, { "input": "999999996", "output": "19" }, { "input": "999999995", "output": "20" }, { "input": "999999994", "output": "19" }, { "input": "999999993", "output": "19" }, { "input": "999999992", "output": "18" }, { "input": "999999991", "output": "20" }, { "input": "999999990", "output": "19" }, { "input": "536870910", "output": "28" }, { "input": "536870912", "output": "1" }, { "input": "536870913", "output": "2" }, { "input": "536870914", "output": "2" }, { "input": "22", "output": "3" }, { "input": "14", "output": "3" } ]
1,678,679,703
2,147,483,647
Python 3
OK
TESTS
36
46
0
x = int(input()) ones = 0 while x != 0: #print(temp) if x % 2 == 1: ones = ones + 1 x = int(x/2) print(ones)
Title: Raising Bacteria Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are a lover of bacteria. You want to raise some bacteria in a box. Initially, the box is empty. Each morning, you can put any number of bacteria into the box. And each night, every bacterium in the box will split into two bacteria. You hope to see exactly *x* bacteria in the box at some moment. What is the minimum number of bacteria you need to put into the box across those days? Input Specification: The only line containing one integer *x* (1<=≀<=*x*<=≀<=109). Output Specification: The only line containing one integer: the answer. Demo Input: ['5\n', '8\n'] Demo Output: ['2\n', '1\n'] Note: For the first sample, we can add one bacterium in the box in the first day morning and at the third morning there will be 4 bacteria in the box. Now we put one more resulting 5 in the box. We added 2 bacteria in the process so the answer is 2. For the second sample, we can put one in the first morning and in the 4-th morning there will be 8 in the box. So the answer is 1.
```python x = int(input()) ones = 0 while x != 0: #print(temp) if x % 2 == 1: ones = ones + 1 x = int(x/2) print(ones) ```
3
41
A
Translation
PROGRAMMING
800
[ "implementation", "strings" ]
A. Translation
2
256
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the Β«translationΒ». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
[ "code\nedoc\n", "abb\naba\n", "code\ncode\n" ]
[ "YES\n", "NO\n", "NO\n" ]
none
500
[ { "input": "code\nedoc", "output": "YES" }, { "input": "abb\naba", "output": "NO" }, { "input": "code\ncode", "output": "NO" }, { "input": "abacaba\nabacaba", "output": "YES" }, { "input": "q\nq", "output": "YES" }, { "input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk", "output": "NO" }, { "input": "z\na", "output": "NO" }, { "input": "asd\ndsa", "output": "YES" }, { "input": "abcdef\nfecdba", "output": "NO" }, { "input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu", "output": "NO" }, { "input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf", "output": "NO" }, { "input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp", "output": "NO" }, { "input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb", "output": "NO" }, { "input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom", "output": "NO" }, { "input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh", "output": "NO" }, { "input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy", "output": "NO" }, { "input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko", "output": "NO" }, { "input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv", "output": "NO" }, { "input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd", "output": "NO" }, { "input": "w\nw", "output": "YES" }, { "input": "vz\nzv", "output": "YES" }, { "input": "ry\nyr", "output": "YES" }, { "input": "xou\nuox", "output": "YES" }, { "input": "axg\ngax", "output": "NO" }, { "input": "zdsl\nlsdz", "output": "YES" }, { "input": "kudl\nldku", "output": "NO" }, { "input": "zzlzwnqlcl\nlclqnwzlzz", "output": "YES" }, { "input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv", "output": "YES" }, { "input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar", "output": "NO" }, { "input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn", "output": "YES" }, { "input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum", "output": "YES" }, { "input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv", "output": "YES" }, { "input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm", "output": "NO" }, { "input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd", "output": "NO" }, { "input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg", "output": "YES" }, { "input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis", "output": "YES" }, { "input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy", "output": "NO" }, { "input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw", "output": "YES" }, { "input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi", "output": "YES" }, { "input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib", "output": "YES" } ]
1,457,020,221
2,147,483,647
Python 3
OK
TESTS
40
154
0
word1 = input() word2 = input() word3 = word2[::-1] if (word1 == word3): print("YES") else: print("NO")
Title: Translation Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the Β«translationΒ». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. Input Specification: The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. Output Specification: If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. Demo Input: ['code\nedoc\n', 'abb\naba\n', 'code\ncode\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none
```python word1 = input() word2 = input() word3 = word2[::-1] if (word1 == word3): print("YES") else: print("NO") ```
3.9615
269
B
Greenhouse Effect
PROGRAMMING
1,700
[ "dp" ]
null
null
Emuskald is an avid horticulturist and owns the world's longest greenhouse β€” it is effectively infinite in length. Over the years Emuskald has cultivated *n* plants in his greenhouse, of *m* different plant species numbered from 1 to *m*. His greenhouse is very narrow and can be viewed as an infinite line, with each plant occupying a single point on that line. Emuskald has discovered that each species thrives at a different temperature, so he wants to arrange *m*<=-<=1 borders that would divide the greenhouse into *m* sections numbered from 1 to *m* from left to right with each section housing a single species. He is free to place the borders, but in the end all of the *i*-th species plants must reside in *i*-th section from the left. Of course, it is not always possible to place the borders in such way, so Emuskald needs to replant some of his plants. He can remove each plant from its position and place it anywhere in the greenhouse (at any real coordinate) with no plant already in it. Since replanting is a lot of stress for the plants, help Emuskald find the minimum number of plants he has to replant to be able to place the borders.
The first line of input contains two space-separated integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=5000, *n*<=β‰₯<=*m*), the number of plants and the number of different species. Each of the following *n* lines contain two space-separated numbers: one integer number *s**i* (1<=≀<=*s**i*<=≀<=*m*), and one real number *x**i* (0<=≀<=*x**i*<=≀<=109), the species and position of the *i*-th plant. Each *x**i* will contain no more than 6 digits after the decimal point. It is guaranteed that all *x**i* are different; there is at least one plant of each species; the plants are given in order "from left to the right", that is in the ascending order of their *x**i* coordinates (*x**i*<=&lt;<=*x**i*<=+<=1,<=1<=≀<=*i*<=&lt;<=*n*).
Output a single integer β€” the minimum number of plants to be replanted.
[ "3 2\n2 1\n1 2.0\n1 3.100\n", "3 3\n1 5.0\n2 5.5\n3 6.0\n", "6 3\n1 14.284235\n2 17.921382\n1 20.328172\n3 20.842331\n1 25.790145\n1 27.204125\n" ]
[ "1\n", "0\n", "2\n" ]
In the first test case, Emuskald can replant the first plant to the right of the last plant, so the answer is 1. In the second test case, the species are already in the correct order, so no replanting is needed.
1,000
[ { "input": "3 2\n2 1\n1 2.0\n1 3.100", "output": "1" }, { "input": "3 3\n1 5.0\n2 5.5\n3 6.0", "output": "0" }, { "input": "6 3\n1 14.284235\n2 17.921382\n1 20.328172\n3 20.842331\n1 25.790145\n1 27.204125", "output": "2" }, { "input": "1 1\n1 0", "output": "0" }, { "input": "8 2\n1 0.000000\n1 1.000000\n1 2.000000\n2 2.000001\n1 999999997.000000\n2 999999998.000000\n2 999999999.999999\n2 1000000000.000000", "output": "1" }, { "input": "15 5\n4 6.039627\n2 7.255149\n2 14.469785\n2 15.108572\n4 22.570081\n5 26.642253\n5 32.129202\n5 44.288220\n5 53.231909\n5 60.548042\n4 62.386581\n2 77.828816\n1 87.998512\n3 96.163559\n2 99.412872", "output": "6" }, { "input": "10 7\n4 70882.412953\n1 100461.912159\n3 100813.254090\n7 121632.112636\n2 424085.529781\n6 510966.713362\n6 543441.105338\n7 680094.776949\n1 721404.212606\n5 838754.272757", "output": "5" }, { "input": "5 5\n5 0\n4 1\n3 2\n2 3\n1 4", "output": "4" }, { "input": "12 5\n2 0\n2 1\n3 2\n3 3\n3 4\n1 5\n5 6\n3 7\n3 8\n3 9\n4 999999999\n4 1000000000", "output": "2" }, { "input": "3 3\n2 0\n1 1\n3 2", "output": "1" }, { "input": "3 3\n3 0\n1 1\n2 2", "output": "1" }, { "input": "4 2\n1 10\n2 20\n1 30\n2 40", "output": "1" }, { "input": "20 10\n1 0.000000\n2 0.000001\n3 0.000002\n4 0.000003\n5 0.000004\n6 0.000005\n7 0.000006\n8 0.000007\n9 0.000008\n10 0.000009\n1 999999999.999990\n2 999999999.999991\n3 999999999.999992\n4 999999999.999993\n5 999999999.999994\n6 999999999.999995\n7 999999999.999996\n8 999999999.999997\n9 999999999.999998\n10 999999999.999999", "output": "9" }, { "input": "12 4\n3 0\n3 1\n3 2\n3 3\n3 4\n1 5\n1 6\n2 7\n4 8\n4 9\n2 10\n3 11", "output": "5" }, { "input": "16 2\n1 0\n1 1\n2 2\n2 3\n2 4\n2 5\n1 6\n1 7\n2 8\n2 9\n1 10\n1 11\n2 12\n2 13\n2 14\n2 15", "output": "4" }, { "input": "10 10\n1 100\n2 101\n3 102\n5 103\n9 1000\n8 10000\n6 100000\n7 1000000\n4 10000000\n10 100000000", "output": "3" }, { "input": "10 6\n5 50837.108162\n3 111993.624183\n1 207268.919250\n6 567963.419694\n1 621364.247371\n2 630118.065585\n1 642135.221942\n6 642673.884754\n5 647004.198361\n4 735196.102629", "output": "6" }, { "input": "20 2\n1 39277.770446\n1 131242.472574\n2 131745.437889\n1 261920.593789\n2 323611.256365\n1 341693.666730\n2 378611.498102\n2 568433.562368\n1 667757.789581\n1 674662.040626\n2 690065.099817\n2 724737.429934\n1 774858.513301\n2 783681.914774\n1 808327.402925\n2 867697.070403\n1 880911.396984\n1 929807.064277\n2 942269.265950\n1 999503.792481", "output": "9" }, { "input": "20 15\n6 8719.787178\n10 13066.663722\n15 58623.690996\n9 184321.819759\n3 227999.294560\n2 279836.330518\n9 282806.308675\n8 311056.507765\n1 312315.562927\n5 459200.373445\n14 563454.265947\n7 647364.984868\n13 679761.613732\n4 684192.647497\n1 733119.607626\n7 748637.778398\n12 828048.945890\n11 893690.736585\n8 965323.895167\n5 967641.708962", "output": "15" }, { "input": "15 3\n1 0\n2 1\n3 2\n1 3\n2 4\n3 5\n1 6\n2 7\n3 8\n1 9\n2 10\n3 11\n1 12\n2 13\n3 14", "output": "8" }, { "input": "10 2\n2 0\n2 1\n2 2\n2 3\n2 4\n1 5\n1 6\n1 7\n1 8\n1 9", "output": "5" }, { "input": "11 3\n2 0\n2 1\n2 2\n2 3\n2 4\n3 5\n1 6\n1 7\n1 8\n1 9\n1 10", "output": "5" } ]
1,692,552,391
2,147,483,647
PyPy 3-64
OK
TESTS
40
342
3,788,800
import sys input = lambda: sys.stdin.readline().rstrip() from collections import deque,defaultdict,Counter from itertools import permutations,combinations from bisect import * from heapq import * from math import ceil,gcd,lcm,floor,comb alph = 'abcdefghijklmnopqrstuvwxyz' #pow(x,mod-2,mod) N,M = map(int, input().split()) A = [] for _ in range(N): s,x = input().split() s = int(s) x = float(x) A.append((x,s)) A.sort() A.append((A[-1][0]+1, M+1)) dp = [0]*(N+1) for i in range(N+1): x,s = A[i] for j in range(i): if A[j][1]<=s: dp[i] = max(dp[i], dp[j]+1) print(N-dp[-1])
Title: Greenhouse Effect Time Limit: None seconds Memory Limit: None megabytes Problem Description: Emuskald is an avid horticulturist and owns the world's longest greenhouse β€” it is effectively infinite in length. Over the years Emuskald has cultivated *n* plants in his greenhouse, of *m* different plant species numbered from 1 to *m*. His greenhouse is very narrow and can be viewed as an infinite line, with each plant occupying a single point on that line. Emuskald has discovered that each species thrives at a different temperature, so he wants to arrange *m*<=-<=1 borders that would divide the greenhouse into *m* sections numbered from 1 to *m* from left to right with each section housing a single species. He is free to place the borders, but in the end all of the *i*-th species plants must reside in *i*-th section from the left. Of course, it is not always possible to place the borders in such way, so Emuskald needs to replant some of his plants. He can remove each plant from its position and place it anywhere in the greenhouse (at any real coordinate) with no plant already in it. Since replanting is a lot of stress for the plants, help Emuskald find the minimum number of plants he has to replant to be able to place the borders. Input Specification: The first line of input contains two space-separated integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=5000, *n*<=β‰₯<=*m*), the number of plants and the number of different species. Each of the following *n* lines contain two space-separated numbers: one integer number *s**i* (1<=≀<=*s**i*<=≀<=*m*), and one real number *x**i* (0<=≀<=*x**i*<=≀<=109), the species and position of the *i*-th plant. Each *x**i* will contain no more than 6 digits after the decimal point. It is guaranteed that all *x**i* are different; there is at least one plant of each species; the plants are given in order "from left to the right", that is in the ascending order of their *x**i* coordinates (*x**i*<=&lt;<=*x**i*<=+<=1,<=1<=≀<=*i*<=&lt;<=*n*). Output Specification: Output a single integer β€” the minimum number of plants to be replanted. Demo Input: ['3 2\n2 1\n1 2.0\n1 3.100\n', '3 3\n1 5.0\n2 5.5\n3 6.0\n', '6 3\n1 14.284235\n2 17.921382\n1 20.328172\n3 20.842331\n1 25.790145\n1 27.204125\n'] Demo Output: ['1\n', '0\n', '2\n'] Note: In the first test case, Emuskald can replant the first plant to the right of the last plant, so the answer is 1. In the second test case, the species are already in the correct order, so no replanting is needed.
```python import sys input = lambda: sys.stdin.readline().rstrip() from collections import deque,defaultdict,Counter from itertools import permutations,combinations from bisect import * from heapq import * from math import ceil,gcd,lcm,floor,comb alph = 'abcdefghijklmnopqrstuvwxyz' #pow(x,mod-2,mod) N,M = map(int, input().split()) A = [] for _ in range(N): s,x = input().split() s = int(s) x = float(x) A.append((x,s)) A.sort() A.append((A[-1][0]+1, M+1)) dp = [0]*(N+1) for i in range(N+1): x,s = A[i] for j in range(i): if A[j][1]<=s: dp[i] = max(dp[i], dp[j]+1) print(N-dp[-1]) ```
3
208
A
Dubstep
PROGRAMMING
900
[ "strings" ]
null
null
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them. Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club. For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX". Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
[ "WUBWUBABCWUB\n", "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n" ]
[ "ABC ", "WE ARE THE CHAMPIONS MY FRIEND " ]
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya. In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" β€” between them Vasya added two "WUB".
500
[ { "input": "WUBWUBABCWUB", "output": "ABC " }, { "input": "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB", "output": "WE ARE THE CHAMPIONS MY FRIEND " }, { "input": "WUBWUBWUBSR", "output": "SR " }, { "input": "RWUBWUBWUBLWUB", "output": "R L " }, { "input": "ZJWUBWUBWUBJWUBWUBWUBL", "output": "ZJ J L " }, { "input": "CWUBBWUBWUBWUBEWUBWUBWUBQWUBWUBWUB", "output": "C B E Q " }, { "input": "WUBJKDWUBWUBWBIRAQKFWUBWUBYEWUBWUBWUBWVWUBWUB", "output": "JKD WBIRAQKF YE WV " }, { "input": "WUBKSDHEMIXUJWUBWUBRWUBWUBWUBSWUBWUBWUBHWUBWUBWUB", "output": "KSDHEMIXUJ R S H " }, { "input": "OGWUBWUBWUBXWUBWUBWUBIWUBWUBWUBKOWUBWUB", "output": "OG X I KO " }, { "input": "QWUBQQWUBWUBWUBIWUBWUBWWWUBWUBWUBJOPJPBRH", "output": "Q QQ I WW JOPJPBRH " }, { "input": "VSRNVEATZTLGQRFEGBFPWUBWUBWUBAJWUBWUBWUBPQCHNWUBCWUB", "output": "VSRNVEATZTLGQRFEGBFP AJ PQCHN C " }, { "input": "WUBWUBEWUBWUBWUBIQMJNIQWUBWUBWUBGZZBQZAUHYPWUBWUBWUBPMRWUBWUBWUBDCV", "output": "E IQMJNIQ GZZBQZAUHYP PMR DCV " }, { "input": "WUBWUBWUBFVWUBWUBWUBBPSWUBWUBWUBRXNETCJWUBWUBWUBJDMBHWUBWUBWUBBWUBWUBVWUBWUBB", "output": "FV BPS RXNETCJ JDMBH B V B " }, { "input": "WUBWUBWUBFBQWUBWUBWUBIDFSYWUBWUBWUBCTWDMWUBWUBWUBSXOWUBWUBWUBQIWUBWUBWUBL", "output": "FBQ IDFSY CTWDM SXO QI L " }, { "input": "IWUBWUBQLHDWUBYIIKZDFQWUBWUBWUBCXWUBWUBUWUBWUBWUBKWUBWUBWUBNL", "output": "I QLHD YIIKZDFQ CX U K NL " }, { "input": "KWUBUPDYXGOKUWUBWUBWUBAGOAHWUBIZDWUBWUBWUBIYWUBWUBWUBVWUBWUBWUBPWUBWUBWUBE", "output": "K UPDYXGOKU AGOAH IZD IY V P E " }, { "input": "WUBWUBOWUBWUBWUBIPVCQAFWYWUBWUBWUBQWUBWUBWUBXHDKCPYKCTWWYWUBWUBWUBVWUBWUBWUBFZWUBWUB", "output": "O IPVCQAFWY Q XHDKCPYKCTWWY V FZ " }, { "input": "PAMJGYWUBWUBWUBXGPQMWUBWUBWUBTKGSXUYWUBWUBWUBEWUBWUBWUBNWUBWUBWUBHWUBWUBWUBEWUBWUB", "output": "PAMJGY XGPQM TKGSXUY E N H E " }, { "input": "WUBYYRTSMNWUWUBWUBWUBCWUBWUBWUBCWUBWUBWUBFSYUINDWOBVWUBWUBWUBFWUBWUBWUBAUWUBWUBWUBVWUBWUBWUBJB", "output": "YYRTSMNWU C C FSYUINDWOBV F AU V JB " }, { "input": "WUBWUBYGPYEYBNRTFKOQCWUBWUBWUBUYGRTQEGWLFYWUBWUBWUBFVWUBHPWUBWUBWUBXZQWUBWUBWUBZDWUBWUBWUBM", "output": "YGPYEYBNRTFKOQC UYGRTQEGWLFY FV HP XZQ ZD M " }, { "input": "WUBZVMJWUBWUBWUBFOIMJQWKNZUBOFOFYCCWUBWUBWUBAUWWUBRDRADWUBWUBWUBCHQVWUBWUBWUBKFTWUBWUBWUBW", "output": "ZVMJ FOIMJQWKNZUBOFOFYCC AUW RDRAD CHQV KFT W " }, { "input": "WUBWUBZBKOKHQLGKRVIMZQMQNRWUBWUBWUBDACWUBWUBNZHFJMPEYKRVSWUBWUBWUBPPHGAVVPRZWUBWUBWUBQWUBWUBAWUBG", "output": "ZBKOKHQLGKRVIMZQMQNR DAC NZHFJMPEYKRVS PPHGAVVPRZ Q A G " }, { "input": "WUBWUBJWUBWUBWUBNFLWUBWUBWUBGECAWUBYFKBYJWTGBYHVSSNTINKWSINWSMAWUBWUBWUBFWUBWUBWUBOVWUBWUBLPWUBWUBWUBN", "output": "J NFL GECA YFKBYJWTGBYHVSSNTINKWSINWSMA F OV LP N " }, { "input": "WUBWUBLCWUBWUBWUBZGEQUEATJVIXETVTWUBWUBWUBEXMGWUBWUBWUBRSWUBWUBWUBVWUBWUBWUBTAWUBWUBWUBCWUBWUBWUBQG", "output": "LC ZGEQUEATJVIXETVT EXMG RS V TA C QG " }, { "input": "WUBMPWUBWUBWUBORWUBWUBDLGKWUBWUBWUBVVZQCAAKVJTIKWUBWUBWUBTJLUBZJCILQDIFVZWUBWUBYXWUBWUBWUBQWUBWUBWUBLWUB", "output": "MP OR DLGK VVZQCAAKVJTIK TJLUBZJCILQDIFVZ YX Q L " }, { "input": "WUBNXOLIBKEGXNWUBWUBWUBUWUBGITCNMDQFUAOVLWUBWUBWUBAIJDJZJHFMPVTPOXHPWUBWUBWUBISCIOWUBWUBWUBGWUBWUBWUBUWUB", "output": "NXOLIBKEGXN U GITCNMDQFUAOVL AIJDJZJHFMPVTPOXHP ISCIO G U " }, { "input": "WUBWUBNMMWCZOLYPNBELIYVDNHJUNINWUBWUBWUBDXLHYOWUBWUBWUBOJXUWUBWUBWUBRFHTGJCEFHCGWARGWUBWUBWUBJKWUBWUBSJWUBWUB", "output": "NMMWCZOLYPNBELIYVDNHJUNIN DXLHYO OJXU RFHTGJCEFHCGWARG JK SJ " }, { "input": "SGWLYSAUJOJBNOXNWUBWUBWUBBOSSFWKXPDPDCQEWUBWUBWUBDIRZINODWUBWUBWUBWWUBWUBWUBPPHWUBWUBWUBRWUBWUBWUBQWUBWUBWUBJWUB", "output": "SGWLYSAUJOJBNOXN BOSSFWKXPDPDCQE DIRZINOD W PPH R Q J " }, { "input": "TOWUBWUBWUBGBTBNWUBWUBWUBJVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSAWUBWUBWUBSWUBWUBWUBTOLVXWUBWUBWUBNHWUBWUBWUBO", "output": "TO GBTBN JVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSA S TOLVX NH O " }, { "input": "WUBWUBWSPLAYSZSAUDSWUBWUBWUBUWUBWUBWUBKRWUBWUBWUBRSOKQMZFIYZQUWUBWUBWUBELSHUWUBWUBWUBUKHWUBWUBWUBQXEUHQWUBWUBWUBBWUBWUBWUBR", "output": "WSPLAYSZSAUDS U KR RSOKQMZFIYZQU ELSHU UKH QXEUHQ B R " }, { "input": "WUBXEMWWVUHLSUUGRWUBWUBWUBAWUBXEGILZUNKWUBWUBWUBJDHHKSWUBWUBWUBDTSUYSJHWUBWUBWUBPXFWUBMOHNJWUBWUBWUBZFXVMDWUBWUBWUBZMWUBWUB", "output": "XEMWWVUHLSUUGR A XEGILZUNK JDHHKS DTSUYSJH PXF MOHNJ ZFXVMD ZM " }, { "input": "BMBWUBWUBWUBOQKWUBWUBWUBPITCIHXHCKLRQRUGXJWUBWUBWUBVWUBWUBWUBJCWUBWUBWUBQJPWUBWUBWUBBWUBWUBWUBBMYGIZOOXWUBWUBWUBTAGWUBWUBHWUB", "output": "BMB OQK PITCIHXHCKLRQRUGXJ V JC QJP B BMYGIZOOX TAG H " }, { "input": "CBZNWUBWUBWUBNHWUBWUBWUBYQSYWUBWUBWUBMWUBWUBWUBXRHBTMWUBWUBWUBPCRCWUBWUBWUBTZUYLYOWUBWUBWUBCYGCWUBWUBWUBCLJWUBWUBWUBSWUBWUBWUB", "output": "CBZN NH YQSY M XRHBTM PCRC TZUYLYO CYGC CLJ S " }, { "input": "DPDWUBWUBWUBEUQKWPUHLTLNXHAEKGWUBRRFYCAYZFJDCJLXBAWUBWUBWUBHJWUBOJWUBWUBWUBNHBJEYFWUBWUBWUBRWUBWUBWUBSWUBWWUBWUBWUBXDWUBWUBWUBJWUB", "output": "DPD EUQKWPUHLTLNXHAEKG RRFYCAYZFJDCJLXBA HJ OJ NHBJEYF R S W XD J " }, { "input": "WUBWUBWUBISERPQITVIYERSCNWUBWUBWUBQWUBWUBWUBDGSDIPWUBWUBWUBCAHKDZWEXBIBJVVSKKVQJWUBWUBWUBKIWUBWUBWUBCWUBWUBWUBAWUBWUBWUBPWUBWUBWUBHWUBWUBWUBF", "output": "ISERPQITVIYERSCN Q DGSDIP CAHKDZWEXBIBJVVSKKVQJ KI C A P H F " }, { "input": "WUBWUBWUBIWUBWUBLIKNQVWUBWUBWUBPWUBWUBWUBHWUBWUBWUBMWUBWUBWUBDPRSWUBWUBWUBBSAGYLQEENWXXVWUBWUBWUBXMHOWUBWUBWUBUWUBWUBWUBYRYWUBWUBWUBCWUBWUBWUBY", "output": "I LIKNQV P H M DPRS BSAGYLQEENWXXV XMHO U YRY C Y " }, { "input": "WUBWUBWUBMWUBWUBWUBQWUBWUBWUBITCFEYEWUBWUBWUBHEUWGNDFNZGWKLJWUBWUBWUBMZPWUBWUBWUBUWUBWUBWUBBWUBWUBWUBDTJWUBHZVIWUBWUBWUBPWUBFNHHWUBWUBWUBVTOWUB", "output": "M Q ITCFEYE HEUWGNDFNZGWKLJ MZP U B DTJ HZVI P FNHH VTO " }, { "input": "WUBWUBNDNRFHYJAAUULLHRRDEDHYFSRXJWUBWUBWUBMUJVDTIRSGYZAVWKRGIFWUBWUBWUBHMZWUBWUBWUBVAIWUBWUBWUBDDKJXPZRGWUBWUBWUBSGXWUBWUBWUBIFKWUBWUBWUBUWUBWUBWUBW", "output": "NDNRFHYJAAUULLHRRDEDHYFSRXJ MUJVDTIRSGYZAVWKRGIF HMZ VAI DDKJXPZRG SGX IFK U W " }, { "input": "WUBOJMWRSLAXXHQRTPMJNCMPGWUBWUBWUBNYGMZIXNLAKSQYWDWUBWUBWUBXNIWUBWUBWUBFWUBWUBWUBXMBWUBWUBWUBIWUBWUBWUBINWUBWUBWUBWDWUBWUBWUBDDWUBWUBWUBD", "output": "OJMWRSLAXXHQRTPMJNCMPG NYGMZIXNLAKSQYWD XNI F XMB I IN WD DD D " }, { "input": "WUBWUBWUBREHMWUBWUBWUBXWUBWUBWUBQASNWUBWUBWUBNLSMHLCMTICWUBWUBWUBVAWUBWUBWUBHNWUBWUBWUBNWUBWUBWUBUEXLSFOEULBWUBWUBWUBXWUBWUBWUBJWUBWUBWUBQWUBWUBWUBAWUBWUB", "output": "REHM X QASN NLSMHLCMTIC VA HN N UEXLSFOEULB X J Q A " }, { "input": "WUBWUBWUBSTEZTZEFFIWUBWUBWUBSWUBWUBWUBCWUBFWUBHRJPVWUBWUBWUBDYJUWUBWUBWUBPWYDKCWUBWUBWUBCWUBWUBWUBUUEOGCVHHBWUBWUBWUBEXLWUBWUBWUBVCYWUBWUBWUBMWUBWUBWUBYWUB", "output": "STEZTZEFFI S C F HRJPV DYJU PWYDKC C UUEOGCVHHB EXL VCY M Y " }, { "input": "WPPNMSQOQIWUBWUBWUBPNQXWUBWUBWUBHWUBWUBWUBNFLWUBWUBWUBGWSGAHVJFNUWUBWUBWUBFWUBWUBWUBWCMLRICFSCQQQTNBWUBWUBWUBSWUBWUBWUBKGWUBWUBWUBCWUBWUBWUBBMWUBWUBWUBRWUBWUB", "output": "WPPNMSQOQI PNQX H NFL GWSGAHVJFNU F WCMLRICFSCQQQTNB S KG C BM R " }, { "input": "YZJOOYITZRARKVFYWUBWUBRZQGWUBWUBWUBUOQWUBWUBWUBIWUBWUBWUBNKVDTBOLETKZISTWUBWUBWUBWLWUBQQFMMGSONZMAWUBZWUBWUBWUBQZUXGCWUBWUBWUBIRZWUBWUBWUBLTTVTLCWUBWUBWUBY", "output": "YZJOOYITZRARKVFY RZQG UOQ I NKVDTBOLETKZIST WL QQFMMGSONZMA Z QZUXGC IRZ LTTVTLC Y " }, { "input": "WUBCAXNCKFBVZLGCBWCOAWVWOFKZVQYLVTWUBWUBWUBNLGWUBWUBWUBAMGDZBDHZMRMQMDLIRMIWUBWUBWUBGAJSHTBSWUBWUBWUBCXWUBWUBWUBYWUBZLXAWWUBWUBWUBOHWUBWUBWUBZWUBWUBWUBGBWUBWUBWUBE", "output": "CAXNCKFBVZLGCBWCOAWVWOFKZVQYLVT NLG AMGDZBDHZMRMQMDLIRMI GAJSHTBS CX Y ZLXAW OH Z GB E " }, { "input": "WUBWUBCHXSOWTSQWUBWUBWUBCYUZBPBWUBWUBWUBSGWUBWUBWKWORLRRLQYUUFDNWUBWUBWUBYYGOJNEVEMWUBWUBWUBRWUBWUBWUBQWUBWUBWUBIHCKWUBWUBWUBKTWUBWUBWUBRGSNTGGWUBWUBWUBXCXWUBWUBWUBS", "output": "CHXSOWTSQ CYUZBPB SG WKWORLRRLQYUUFDN YYGOJNEVEM R Q IHCK KT RGSNTGG XCX S " }, { "input": "WUBWUBWUBHJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQWUBWUBWUBXTZKGIITWUBWUBWUBAWUBWUBWUBVNCXPUBCQWUBWUBWUBIDPNAWUBWUBWUBOWUBWUBWUBYGFWUBWUBWUBMQOWUBWUBWUBKWUBWUBWUBAZVWUBWUBWUBEP", "output": "HJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQ XTZKGIIT A VNCXPUBCQ IDPNA O YGF MQO K AZV EP " }, { "input": "WUBKYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTVWUBWUBWUBLRMIIWUBWUBWUBGWUBWUBWUBADPSWUBWUBWUBANBWUBWUBPCWUBWUBWUBPWUBWUBWUBGPVNLSWIRFORYGAABUXMWUBWUBWUBOWUBWUBWUBNWUBWUBWUBYWUBWUB", "output": "KYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTV LRMII G ADPS ANB PC P GPVNLSWIRFORYGAABUXM O N Y " }, { "input": "REWUBWUBWUBJDWUBWUBWUBNWUBWUBWUBTWWUBWUBWUBWZDOCKKWUBWUBWUBLDPOVBFRCFWUBWUBAKZIBQKEUAZEEWUBWUBWUBLQYPNPFWUBYEWUBWUBWUBFWUBWUBWUBBPWUBWUBWUBAWWUBWUBWUBQWUBWUBWUBBRWUBWUBWUBXJL", "output": "RE JD N TW WZDOCKK LDPOVBFRCF AKZIBQKEUAZEE LQYPNPF YE F BP AW Q BR XJL " }, { "input": "CUFGJDXGMWUBWUBWUBOMWUBWUBWUBSIEWUBWUBWUBJJWKNOWUBWUBWUBYBHVNRNORGYWUBWUBWUBOAGCAWUBWUBWUBSBLBKTPFKPBIWUBWUBWUBJBWUBWUBWUBRMFCJPGWUBWUBWUBDWUBWUBWUBOJOWUBWUBWUBZPWUBWUBWUBMWUBRWUBWUBWUBFXWWUBWUBWUBO", "output": "CUFGJDXGM OM SIE JJWKNO YBHVNRNORGY OAGCA SBLBKTPFKPBI JB RMFCJPG D OJO ZP M R FXW O " }, { "input": "WUBJZGAEXFMFEWMAKGQLUWUBWUBWUBICYTPQWGENELVYWANKUOJYWUBWUBWUBGWUBWUBWUBHYCJVLPHTUPNEGKCDGQWUBWUBWUBOFWUBWUBWUBCPGSOGZBRPRPVJJEWUBWUBWUBDQBCWUBWUBWUBHWUBWUBWUBMHOHYBMATWUBWUBWUBVWUBWUBWUBSWUBWUBWUBKOWU", "output": "JZGAEXFMFEWMAKGQLU ICYTPQWGENELVYWANKUOJY G HYCJVLPHTUPNEGKCDGQ OF CPGSOGZBRPRPVJJE DQBC H MHOHYBMAT V S KOWU " }, { "input": "A", "output": "A " }, { "input": "WUBA", "output": "A " }, { "input": "WUBWUBA", "output": "A " }, { "input": "AWUBWUBWUB", "output": "A " }, { "input": "AWUBBWUBCWUBD", "output": "A B C D " }, { "input": "WUBWWUBWUBWUBUWUBWUBBWUB", "output": "W U B " }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA " }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAWUBAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA " }, { "input": "WUWUBBWWUBUB", "output": "WU BW UB " }, { "input": "WUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUABWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUB", "output": "WUAB " }, { "input": "ZWUB", "output": "Z " }, { "input": "WU", "output": "WU " }, { "input": "UB", "output": "UB " }, { "input": "U", "output": "U " }, { "input": "WUBW", "output": "W " }, { "input": "WUBWU", "output": "WU " }, { "input": "WUWUB", "output": "WU " }, { "input": "UBWUB", "output": "UB " }, { "input": "WUWUBUBWUBUWUB", "output": "WU UB U " }, { "input": "WUBWWUBAWUB", "output": "W A " }, { "input": "WUUUUU", "output": "WUUUUU " } ]
1,687,680,552
2,147,483,647
Python 3
OK
TESTS
71
92
0
x = input().split("WUB") z = '' for i in x: if i == '': continue z += (i + ' ') print(z)
Title: Dubstep Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them. Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club. For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX". Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song. Input Specification: The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word. Output Specification: Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space. Demo Input: ['WUBWUBABCWUB\n', 'WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n'] Demo Output: ['ABC ', 'WE ARE THE CHAMPIONS MY FRIEND '] Note: In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya. In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" β€” between them Vasya added two "WUB".
```python x = input().split("WUB") z = '' for i in x: if i == '': continue z += (i + ' ') print(z) ```
3
486
A
Calculating Function
PROGRAMMING
800
[ "implementation", "math" ]
null
null
For a positive integer *n* let's define a function *f*: *f*(*n*)<==<=<=-<=1<=+<=2<=-<=3<=+<=..<=+<=(<=-<=1)*n**n* Your task is to calculate *f*(*n*) for a given integer *n*.
The single line contains the positive integer *n* (1<=≀<=*n*<=≀<=1015).
Print *f*(*n*) in a single line.
[ "4\n", "5\n" ]
[ "2\n", "-3\n" ]
*f*(4) =  - 1 + 2 - 3 + 4 = 2 *f*(5) =  - 1 + 2 - 3 + 4 - 5 =  - 3
500
[ { "input": "4", "output": "2" }, { "input": "5", "output": "-3" }, { "input": "1000000000", "output": "500000000" }, { "input": "1000000001", "output": "-500000001" }, { "input": "1000000000000000", "output": "500000000000000" }, { "input": "100", "output": "50" }, { "input": "101", "output": "-51" }, { "input": "102", "output": "51" }, { "input": "103", "output": "-52" }, { "input": "104", "output": "52" }, { "input": "105", "output": "-53" }, { "input": "106", "output": "53" }, { "input": "107", "output": "-54" }, { "input": "108", "output": "54" }, { "input": "109", "output": "-55" }, { "input": "208170109961052", "output": "104085054980526" }, { "input": "46017661651072", "output": "23008830825536" }, { "input": "4018154546667", "output": "-2009077273334" }, { "input": "288565475053", "output": "-144282737527" }, { "input": "3052460231", "output": "-1526230116" }, { "input": "29906716", "output": "14953358" }, { "input": "87897701693326", "output": "43948850846663" }, { "input": "8240", "output": "4120" }, { "input": "577935", "output": "-288968" }, { "input": "62", "output": "31" }, { "input": "1", "output": "-1" }, { "input": "2", "output": "1" }, { "input": "9999999999999", "output": "-5000000000000" }, { "input": "1000000000000", "output": "500000000000" }, { "input": "99999999999999", "output": "-50000000000000" }, { "input": "999999999999999", "output": "-500000000000000" }, { "input": "42191359342", "output": "21095679671" }, { "input": "100000000000000", "output": "50000000000000" }, { "input": "145645214654154", "output": "72822607327077" }, { "input": "4294967296", "output": "2147483648" }, { "input": "3037000499", "output": "-1518500250" }, { "input": "10000000000001", "output": "-5000000000001" }, { "input": "100000017040846", "output": "50000008520423" }, { "input": "98979894985999", "output": "-49489947493000" } ]
1,693,927,038
2,147,483,647
Python 3
OK
TESTS
39
46
0
n=int(input()) if(n%2==0): p=(int)(n/2) else: p= (int)(-(n+1)/2) print(p)
Title: Calculating Function Time Limit: None seconds Memory Limit: None megabytes Problem Description: For a positive integer *n* let's define a function *f*: *f*(*n*)<==<=<=-<=1<=+<=2<=-<=3<=+<=..<=+<=(<=-<=1)*n**n* Your task is to calculate *f*(*n*) for a given integer *n*. Input Specification: The single line contains the positive integer *n* (1<=≀<=*n*<=≀<=1015). Output Specification: Print *f*(*n*) in a single line. Demo Input: ['4\n', '5\n'] Demo Output: ['2\n', '-3\n'] Note: *f*(4) =  - 1 + 2 - 3 + 4 = 2 *f*(5) =  - 1 + 2 - 3 + 4 - 5 =  - 3
```python n=int(input()) if(n%2==0): p=(int)(n/2) else: p= (int)(-(n+1)/2) print(p) ```
3
102
B
Sum of Digits
PROGRAMMING
1,000
[ "implementation" ]
B. Sum of Digits
2
265
Having watched the last Harry Potter film, little Gerald also decided to practice magic. He found in his father's magical book a spell that turns any number in the sum of its digits. At the moment Gerald learned that, he came across a number *n*. How many times can Gerald put a spell on it until the number becomes one-digit?
The first line contains the only integer *n* (0<=≀<=*n*<=≀<=10100000). It is guaranteed that *n* doesn't contain any leading zeroes.
Print the number of times a number can be replaced by the sum of its digits until it only contains one digit.
[ "0\n", "10\n", "991\n" ]
[ "0\n", "1\n", "3\n" ]
In the first sample the number already is one-digit β€” Herald can't cast a spell. The second test contains number 10. After one casting of a spell it becomes 1, and here the process is completed. Thus, Gerald can only cast the spell once. The third test contains number 991. As one casts a spell the following transformations take place: 991 → 19 → 10 → 1. After three transformations the number becomes one-digit.
1,000
[ { "input": "0", "output": "0" }, { "input": "10", "output": "1" }, { "input": "991", "output": "3" }, { "input": "99", "output": "2" }, { "input": "100", "output": "1" }, { "input": "123456789", "output": "2" }, { "input": "32", "output": "1" }, { "input": "86", "output": "2" }, { "input": "2", "output": "0" }, { "input": "8", "output": "0" }, { "input": "34", "output": "1" }, { "input": "13", "output": "1" }, { "input": "28", "output": "2" }, { "input": "23", "output": "1" }, { "input": "57", "output": "2" }, { "input": "29", "output": "2" }, { "input": "353869285", "output": "3" }, { "input": "549548646", "output": "2" }, { "input": "858893424", "output": "2" }, { "input": "644818852", "output": "3" }, { "input": "360322525", "output": "3" }, { "input": "122937520", "output": "2" }, { "input": "288403032", "output": "2" }, { "input": "677257481", "output": "3" }, { "input": "58059561", "output": "3" }, { "input": "211288847", "output": "2" }, { "input": "339900034079539584", "output": "2" }, { "input": "784084029310269952", "output": "3" }, { "input": "774730557264864000", "output": "3" }, { "input": "478233807148352256", "output": "3" }, { "input": "165646874056812544", "output": "3" }, { "input": "477533739511673792", "output": "3" }, { "input": "660119944377002240", "output": "3" }, { "input": "448375218506078080", "output": "3" }, { "input": "77213334785795616", "output": "3" }, { "input": "165767221702271872", "output": "3" }, { "input": "1", "output": "0" }, { "input": "5", "output": "0" }, { "input": "8", "output": "0" }, { "input": "156161456146164104103460452045416165146141414651641564105461465156445621465146514562146145465165145145614561465145614561", "output": "3" }, { "input": "9", "output": "0" } ]
1,674,611,029
2,147,483,647
PyPy 3-64
OK
TESTS
51
124
1,638,400
def fun(s) : if len(s)==1 : return 0 sum=0 for me in s : sum+=int(me) return 1+fun(str(sum)) s=input() print(fun(s))
Title: Sum of Digits Time Limit: 2 seconds Memory Limit: 265 megabytes Problem Description: Having watched the last Harry Potter film, little Gerald also decided to practice magic. He found in his father's magical book a spell that turns any number in the sum of its digits. At the moment Gerald learned that, he came across a number *n*. How many times can Gerald put a spell on it until the number becomes one-digit? Input Specification: The first line contains the only integer *n* (0<=≀<=*n*<=≀<=10100000). It is guaranteed that *n* doesn't contain any leading zeroes. Output Specification: Print the number of times a number can be replaced by the sum of its digits until it only contains one digit. Demo Input: ['0\n', '10\n', '991\n'] Demo Output: ['0\n', '1\n', '3\n'] Note: In the first sample the number already is one-digit β€” Herald can't cast a spell. The second test contains number 10. After one casting of a spell it becomes 1, and here the process is completed. Thus, Gerald can only cast the spell once. The third test contains number 991. As one casts a spell the following transformations take place: 991 → 19 → 10 → 1. After three transformations the number becomes one-digit.
```python def fun(s) : if len(s)==1 : return 0 sum=0 for me in s : sum+=int(me) return 1+fun(str(sum)) s=input() print(fun(s)) ```
3.966052
268
A
Games
PROGRAMMING
800
[ "brute force" ]
null
null
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*Β·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
The first line contains an integer *n* (2<=≀<=*n*<=≀<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≀<=*h**i*,<=*a**i*<=≀<=100) β€” the colors of the *i*-th team's home and guest uniforms, respectively.
In a single line print the number of games where the host team is going to play in the guest uniform.
[ "3\n1 2\n2 4\n3 4\n", "4\n100 42\n42 100\n5 42\n100 5\n", "2\n1 2\n1 2\n" ]
[ "1\n", "5\n", "0\n" ]
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
500
[ { "input": "3\n1 2\n2 4\n3 4", "output": "1" }, { "input": "4\n100 42\n42 100\n5 42\n100 5", "output": "5" }, { "input": "2\n1 2\n1 2", "output": "0" }, { "input": "7\n4 7\n52 55\n16 4\n55 4\n20 99\n3 4\n7 52", "output": "6" }, { "input": "10\n68 42\n1 35\n25 70\n59 79\n65 63\n46 6\n28 82\n92 62\n43 96\n37 28", "output": "1" }, { "input": "30\n10 39\n89 1\n78 58\n75 99\n36 13\n77 50\n6 97\n79 28\n27 52\n56 5\n93 96\n40 21\n33 74\n26 37\n53 59\n98 56\n61 65\n42 57\n9 7\n25 63\n74 34\n96 84\n95 47\n12 23\n34 21\n71 6\n27 13\n15 47\n64 14\n12 77", "output": "6" }, { "input": "30\n46 100\n87 53\n34 84\n44 66\n23 20\n50 34\n90 66\n17 39\n13 22\n94 33\n92 46\n63 78\n26 48\n44 61\n3 19\n41 84\n62 31\n65 89\n23 28\n58 57\n19 85\n26 60\n75 66\n69 67\n76 15\n64 15\n36 72\n90 89\n42 69\n45 35", "output": "4" }, { "input": "2\n46 6\n6 46", "output": "2" }, { "input": "29\n8 18\n33 75\n69 22\n97 95\n1 97\n78 10\n88 18\n13 3\n19 64\n98 12\n79 92\n41 72\n69 15\n98 31\n57 74\n15 56\n36 37\n15 66\n63 100\n16 42\n47 56\n6 4\n73 15\n30 24\n27 71\n12 19\n88 69\n85 6\n50 11", "output": "10" }, { "input": "23\n43 78\n31 28\n58 80\n66 63\n20 4\n51 95\n40 20\n50 14\n5 34\n36 39\n77 42\n64 97\n62 89\n16 56\n8 34\n58 16\n37 35\n37 66\n8 54\n50 36\n24 8\n68 48\n85 33", "output": "6" }, { "input": "13\n76 58\n32 85\n99 79\n23 58\n96 59\n72 35\n53 43\n96 55\n41 78\n75 10\n28 11\n72 7\n52 73", "output": "0" }, { "input": "18\n6 90\n70 79\n26 52\n67 81\n29 95\n41 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 2", "output": "1" }, { "input": "18\n6 90\n100 79\n26 100\n67 100\n29 100\n100 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 100", "output": "8" }, { "input": "30\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "450" }, { "input": "30\n100 99\n58 59\n56 57\n54 55\n52 53\n50 51\n48 49\n46 47\n44 45\n42 43\n40 41\n38 39\n36 37\n34 35\n32 33\n30 31\n28 29\n26 27\n24 25\n22 23\n20 21\n18 19\n16 17\n14 15\n12 13\n10 11\n8 9\n6 7\n4 5\n2 3", "output": "0" }, { "input": "15\n9 3\n2 6\n7 6\n5 10\n9 5\n8 1\n10 5\n2 8\n4 5\n9 8\n5 3\n3 8\n9 8\n4 10\n8 5", "output": "20" }, { "input": "15\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n1 2", "output": "108" }, { "input": "25\n2 1\n1 2\n1 2\n1 2\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n1 2\n2 1\n2 1\n2 1\n2 1\n1 2", "output": "312" }, { "input": "25\n91 57\n2 73\n54 57\n2 57\n23 57\n2 6\n57 54\n57 23\n91 54\n91 23\n57 23\n91 57\n54 2\n6 91\n57 54\n2 57\n57 91\n73 91\n57 23\n91 57\n2 73\n91 2\n23 6\n2 73\n23 6", "output": "96" }, { "input": "28\n31 66\n31 91\n91 31\n97 66\n31 66\n31 66\n66 91\n91 31\n97 31\n91 97\n97 31\n66 31\n66 97\n91 31\n31 66\n31 66\n66 31\n31 97\n66 97\n97 31\n31 91\n66 91\n91 66\n31 66\n91 66\n66 31\n66 31\n91 97", "output": "210" }, { "input": "29\n78 27\n50 68\n24 26\n68 43\n38 78\n26 38\n78 28\n28 26\n27 24\n23 38\n24 26\n24 43\n61 50\n38 78\n27 23\n61 26\n27 28\n43 23\n28 78\n43 27\n43 78\n27 61\n28 38\n61 78\n50 26\n43 27\n26 78\n28 50\n43 78", "output": "73" }, { "input": "29\n80 27\n69 80\n27 80\n69 80\n80 27\n80 27\n80 27\n80 69\n27 69\n80 69\n80 27\n27 69\n69 27\n80 69\n27 69\n69 80\n27 69\n80 69\n80 27\n69 27\n27 69\n27 80\n80 27\n69 80\n27 69\n80 69\n69 80\n69 80\n27 80", "output": "277" }, { "input": "30\n19 71\n7 89\n89 71\n21 7\n19 21\n7 89\n19 71\n89 8\n89 21\n19 8\n21 7\n8 89\n19 89\n7 21\n19 8\n19 7\n7 19\n8 21\n71 21\n71 89\n7 19\n7 19\n21 7\n21 19\n21 19\n71 8\n21 8\n71 19\n19 71\n8 21", "output": "154" }, { "input": "30\n44 17\n44 17\n44 17\n17 44\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n44 17\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n17 44\n44 17\n44 17\n44 17\n17 44\n17 44\n44 17\n17 44\n44 17\n44 17\n44 17", "output": "418" }, { "input": "22\n78 92\n15 92\n92 78\n78 80\n92 16\n24 80\n92 16\n16 92\n78 16\n24 78\n80 78\n92 80\n16 80\n80 78\n15 78\n92 16\n24 15\n24 80\n80 16\n16 80\n92 80\n24 80", "output": "74" }, { "input": "24\n9 83\n90 31\n83 3\n83 3\n21 31\n83 3\n32 31\n12 21\n31 21\n90 32\n32 21\n12 9\n12 31\n9 83\n83 12\n32 3\n32 83\n90 31\n9 32\n31 21\n83 90\n32 21\n21 3\n32 9", "output": "59" }, { "input": "30\n67 21\n85 39\n85 87\n21 39\n66 85\n10 95\n10 21\n87 85\n82 21\n67 21\n95 10\n21 39\n82 21\n21 66\n66 39\n95 30\n67 85\n66 82\n85 82\n21 66\n10 39\n67 10\n21 85\n10 82\n85 95\n10 85\n21 39\n85 39\n39 10\n95 67", "output": "100" }, { "input": "4\n8 7\n8 7\n7 8\n7 8", "output": "8" }, { "input": "6\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1", "output": "10" }, { "input": "12\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "72" }, { "input": "4\n1 2\n1 2\n2 1\n2 1", "output": "8" } ]
1,695,948,164
2,147,483,647
Python 3
OK
TESTS
31
92
0
num_of_teams= eval(input()) home_wear=list() guest_wear=list() for x in range (0,num_of_teams): home,guest=input().split(' ') home_wear.append(home) guest_wear.append(guest) counter=0 for y in home_wear: for z in guest_wear : if y==z: counter+=1 print(counter)
Title: Games Time Limit: None seconds Memory Limit: None megabytes Problem Description: Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*Β·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question. Input Specification: The first line contains an integer *n* (2<=≀<=*n*<=≀<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≀<=*h**i*,<=*a**i*<=≀<=100) β€” the colors of the *i*-th team's home and guest uniforms, respectively. Output Specification: In a single line print the number of games where the host team is going to play in the guest uniform. Demo Input: ['3\n1 2\n2 4\n3 4\n', '4\n100 42\n42 100\n5 42\n100 5\n', '2\n1 2\n1 2\n'] Demo Output: ['1\n', '5\n', '0\n'] Note: In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
```python num_of_teams= eval(input()) home_wear=list() guest_wear=list() for x in range (0,num_of_teams): home,guest=input().split(' ') home_wear.append(home) guest_wear.append(guest) counter=0 for y in home_wear: for z in guest_wear : if y==z: counter+=1 print(counter) ```
3
379
A
New Year Candles
PROGRAMMING
1,000
[ "implementation" ]
null
null
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles. Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle. Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
The single line contains two integers, *a* and *b* (1<=≀<=*a*<=≀<=1000;Β 2<=≀<=*b*<=≀<=1000).
Print a single integer β€” the number of hours Vasily can light up the room for.
[ "4 2\n", "6 3\n" ]
[ "7\n", "8\n" ]
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
500
[ { "input": "4 2", "output": "7" }, { "input": "6 3", "output": "8" }, { "input": "1000 1000", "output": "1001" }, { "input": "123 5", "output": "153" }, { "input": "1000 2", "output": "1999" }, { "input": "1 2", "output": "1" }, { "input": "1 3", "output": "1" }, { "input": "1 4", "output": "1" }, { "input": "2 2", "output": "3" }, { "input": "3 2", "output": "5" }, { "input": "3 3", "output": "4" }, { "input": "999 2", "output": "1997" }, { "input": "1000 3", "output": "1499" }, { "input": "1000 4", "output": "1333" }, { "input": "1 1000", "output": "1" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "80 970", "output": "80" }, { "input": "10 4", "output": "13" }, { "input": "4 3", "output": "5" }, { "input": "91 5", "output": "113" }, { "input": "777 17", "output": "825" }, { "input": "100 4", "output": "133" }, { "input": "5 3", "output": "7" }, { "input": "6 4", "output": "7" }, { "input": "26 8", "output": "29" }, { "input": "9 4", "output": "11" }, { "input": "20 3", "output": "29" }, { "input": "17 3", "output": "25" } ]
1,681,970,719
2,147,483,647
Python 3
OK
TESTS
32
46
0
a,b=map(int,input().split()) hour=0 while a>0: a=a-1 hour=hour+1 if hour%b==0: a=a+1 print(hour)
Title: New Year Candles Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles. Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle. Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number. Input Specification: The single line contains two integers, *a* and *b* (1<=≀<=*a*<=≀<=1000;Β 2<=≀<=*b*<=≀<=1000). Output Specification: Print a single integer β€” the number of hours Vasily can light up the room for. Demo Input: ['4 2\n', '6 3\n'] Demo Output: ['7\n', '8\n'] Note: Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
```python a,b=map(int,input().split()) hour=0 while a>0: a=a-1 hour=hour+1 if hour%b==0: a=a+1 print(hour) ```
3
218
B
Airport
PROGRAMMING
1,100
[ "implementation" ]
null
null
Lolek and Bolek are about to travel abroad by plane. The local airport has a special "Choose Your Plane" offer. The offer's conditions are as follows: - it is up to a passenger to choose a plane to fly on; - if the chosen plane has *x* (*x*<=&gt;<=0) empty seats at the given moment, then the ticket for such a plane costs *x* zlotys (units of Polish currency). The only ticket office of the airport already has a queue of *n* passengers in front of it. Lolek and Bolek have not stood in the queue yet, but they are already wondering what is the maximum and the minimum number of zlotys the airport administration can earn if all *n* passengers buy tickets according to the conditions of this offer? The passengers buy tickets in turn, the first person in the queue goes first, then goes the second one, and so on up to *n*-th person.
The first line contains two integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=1000) β€” the number of passengers in the queue and the number of planes in the airport, correspondingly. The next line contains *m* integers *a*1,<=*a*2,<=...,<=*a**m* (1<=≀<=*a**i*<=≀<=1000) β€” *a**i* stands for the number of empty seats in the *i*-th plane before the ticket office starts selling tickets. The numbers in the lines are separated by a space. It is guaranteed that there are at least *n* empty seats in total.
Print two integers β€” the maximum and the minimum number of zlotys that the airport administration can earn, correspondingly.
[ "4 3\n2 1 1\n", "4 3\n2 2 2\n" ]
[ "5 5\n", "7 6\n" ]
In the first test sample the number of passengers is equal to the number of empty seats, so regardless of the way the planes are chosen, the administration will earn the same sum. In the second sample the sum is maximized if the 1-st person in the queue buys a ticket to the 1-st plane, the 2-nd person β€” to the 2-nd plane, the 3-rd person β€” to the 3-rd plane, the 4-th person β€” to the 1-st plane. The sum is minimized if the 1-st person in the queue buys a ticket to the 1-st plane, the 2-nd person β€” to the 1-st plane, the 3-rd person β€” to the 2-nd plane, the 4-th person β€” to the 2-nd plane.
500
[ { "input": "4 3\n2 1 1", "output": "5 5" }, { "input": "4 3\n2 2 2", "output": "7 6" }, { "input": "10 5\n10 3 3 1 2", "output": "58 26" }, { "input": "10 1\n10", "output": "55 55" }, { "input": "10 1\n100", "output": "955 955" }, { "input": "10 2\n4 7", "output": "37 37" }, { "input": "40 10\n1 2 3 4 5 6 7 10 10 10", "output": "223 158" }, { "input": "1 1\n6", "output": "6 6" }, { "input": "1 2\n10 9", "output": "10 9" }, { "input": "2 1\n7", "output": "13 13" }, { "input": "2 2\n7 2", "output": "13 3" }, { "input": "3 2\n4 7", "output": "18 9" }, { "input": "3 3\n2 1 1", "output": "4 4" }, { "input": "3 3\n2 1 1", "output": "4 4" }, { "input": "10 10\n3 1 2 2 1 1 2 1 2 3", "output": "20 13" }, { "input": "10 2\n7 3", "output": "34 34" }, { "input": "10 1\n19", "output": "145 145" }, { "input": "100 3\n29 36 35", "output": "1731 1731" }, { "input": "100 5\n3 38 36 35 2", "output": "2019 1941" }, { "input": "510 132\n50 76 77 69 94 30 47 65 14 62 18 121 26 35 49 17 105 93 47 16 78 3 7 74 7 37 30 36 30 83 71 113 7 58 86 10 65 57 34 102 55 44 43 47 106 44 115 75 109 70 47 45 16 57 62 55 20 88 74 40 45 84 41 1 9 53 65 25 67 31 115 2 63 51 123 70 65 65 18 14 75 14 103 26 117 105 36 104 81 37 35 61 44 90 71 70 88 89 26 21 64 77 89 16 87 99 13 79 27 3 46 120 116 11 14 17 32 70 113 94 108 57 29 100 53 48 44 29 70 30 32 62", "output": "50279 5479" }, { "input": "510 123\n5 2 3 2 5 7 2 3 1 3 6 6 3 1 5 3 5 6 2 2 1 5 5 5 2 2 3 1 6 3 5 8 4 6 1 5 4 5 1 6 5 5 3 6 4 1 6 1 3 5 2 7 5 2 4 4 5 6 5 5 4 3 4 6 5 4 4 3 5 8 5 5 6 3 1 7 4 4 3 3 5 3 6 3 3 6 2 5 3 2 4 5 4 5 2 2 4 4 4 7 3 4 6 5 3 6 4 7 1 6 5 7 6 5 7 3 7 4 4 1 6 6 4", "output": "1501 1501" }, { "input": "610 33\n15 44 8 8 17 11 39 39 38 25 17 36 17 25 21 37 10 11 34 30 29 50 29 50 4 20 32 13 41 14 2 11 2", "output": "12204 8871" } ]
1,694,948,737
2,147,483,647
PyPy 3-64
OK
TESTS
33
154
2,252,800
n, m = map(int, input().split()) AMAX = list(map(int, input().split())) AMIN = [] for i in range(len(AMAX)): AMIN.append(AMAX[i]) MAX = 0 MIN = 0 # MAX for i in range(n): max_index = 0 amax = AMAX[0] for j in range(m): if AMAX[j] > amax: max_index = j amax = AMAX[j] AMAX[max_index] -= 1 MAX += amax # MIN for i in range(n): amin = 999999999999 min_index = -1 for j in range(m): if AMIN[j] < amin and AMIN[j] != 0: min_index = j amin = AMIN[j] AMIN[min_index] -= 1 MIN += amin print(MAX, MIN)
Title: Airport Time Limit: None seconds Memory Limit: None megabytes Problem Description: Lolek and Bolek are about to travel abroad by plane. The local airport has a special "Choose Your Plane" offer. The offer's conditions are as follows: - it is up to a passenger to choose a plane to fly on; - if the chosen plane has *x* (*x*<=&gt;<=0) empty seats at the given moment, then the ticket for such a plane costs *x* zlotys (units of Polish currency). The only ticket office of the airport already has a queue of *n* passengers in front of it. Lolek and Bolek have not stood in the queue yet, but they are already wondering what is the maximum and the minimum number of zlotys the airport administration can earn if all *n* passengers buy tickets according to the conditions of this offer? The passengers buy tickets in turn, the first person in the queue goes first, then goes the second one, and so on up to *n*-th person. Input Specification: The first line contains two integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=1000) β€” the number of passengers in the queue and the number of planes in the airport, correspondingly. The next line contains *m* integers *a*1,<=*a*2,<=...,<=*a**m* (1<=≀<=*a**i*<=≀<=1000) β€” *a**i* stands for the number of empty seats in the *i*-th plane before the ticket office starts selling tickets. The numbers in the lines are separated by a space. It is guaranteed that there are at least *n* empty seats in total. Output Specification: Print two integers β€” the maximum and the minimum number of zlotys that the airport administration can earn, correspondingly. Demo Input: ['4 3\n2 1 1\n', '4 3\n2 2 2\n'] Demo Output: ['5 5\n', '7 6\n'] Note: In the first test sample the number of passengers is equal to the number of empty seats, so regardless of the way the planes are chosen, the administration will earn the same sum. In the second sample the sum is maximized if the 1-st person in the queue buys a ticket to the 1-st plane, the 2-nd person β€” to the 2-nd plane, the 3-rd person β€” to the 3-rd plane, the 4-th person β€” to the 1-st plane. The sum is minimized if the 1-st person in the queue buys a ticket to the 1-st plane, the 2-nd person β€” to the 1-st plane, the 3-rd person β€” to the 2-nd plane, the 4-th person β€” to the 2-nd plane.
```python n, m = map(int, input().split()) AMAX = list(map(int, input().split())) AMIN = [] for i in range(len(AMAX)): AMIN.append(AMAX[i]) MAX = 0 MIN = 0 # MAX for i in range(n): max_index = 0 amax = AMAX[0] for j in range(m): if AMAX[j] > amax: max_index = j amax = AMAX[j] AMAX[max_index] -= 1 MAX += amax # MIN for i in range(n): amin = 999999999999 min_index = -1 for j in range(m): if AMIN[j] < amin and AMIN[j] != 0: min_index = j amin = AMIN[j] AMIN[min_index] -= 1 MIN += amin print(MAX, MIN) ```
3
120
C
Winnie-the-Pooh and honey
PROGRAMMING
1,100
[ "implementation", "math" ]
null
null
As we all know, Winnie-the-Pooh just adores honey. Ones he and the Piglet found out that the Rabbit has recently gotten hold of an impressive amount of this sweet and healthy snack. As you may guess, Winnie and the Piglet asked to come at the Rabbit's place. Thus, there are *n* jars of honey lined up in front of Winnie-the-Pooh, jar number *i* contains *a**i* kilos of honey. Winnie-the-Pooh eats the honey like that: each time he chooses a jar containing most honey. If the jar has less that *k* kilos of honey or if Winnie-the-Pooh has already eaten from it three times, he gives the jar to Piglet. Otherwise he eats exactly *k* kilos of honey from the jar and puts it back. Winnie does so until he gives all jars to the Piglet. Count how much honey Piglet will overall get after Winnie satisfies his hunger.
The first line contains two integers *n* and *k* (1<=≀<=*n*<=≀<=100,<=1<=≀<=*k*<=≀<=100). The second line contains *n* integers *a*1, *a*2, ..., *a**n*, separated by spaces (1<=≀<=*a**i*<=≀<=100).
Print a single number β€” how many kilos of honey gets Piglet.
[ "3 3\n15 8 10\n" ]
[ "9\n" ]
none
0
[ { "input": "3 3\n15 8 10", "output": "9" }, { "input": "1 3\n3", "output": "0" }, { "input": "3 4\n3 8 2", "output": "5" }, { "input": "3 2\n95 25 49", "output": "151" }, { "input": "3 1\n8 3 2", "output": "5" }, { "input": "5 1\n4 7 9 5 7", "output": "17" }, { "input": "8 6\n19 15 1 14 7 2 10 14", "output": "16" }, { "input": "8 5\n5 2 17 12 16 12 17 3", "output": "14" }, { "input": "10 7\n26 11 10 8 5 20 9 27 30 9", "output": "43" }, { "input": "10 10\n20 82 19 82 18 96 40 99 87 2", "output": "325" }, { "input": "10 10\n75 52 78 83 60 31 46 28 33 17", "output": "233" }, { "input": "20 5\n33 45 36 13 46 40 15 11 29 44 43 50 14 19 46 46 46 26 42 6", "output": "375" }, { "input": "20 2\n4 2 6 9 8 4 4 7 2 3 7 7 10 6 3 5 2 9 8 5", "output": "21" }, { "input": "30 3\n20 37 89 77 74 6 52 87 19 58 3 38 40 38 42 12 1 23 29 38 12 65 15 1 92 45 23 94 61 73", "output": "1021" }, { "input": "30 2\n10 5 46 30 28 18 24 35 73 2 10 24 72 86 97 95 71 12 14 57 27 94 81 59 43 77 22 58 16 96", "output": "1208" }, { "input": "50 13\n53 55 51 81 59 22 11 20 30 80 38 17 8 38 69 52 11 74 16 38 80 97 39 74 78 56 75 28 4 58 80 88 78 89 95 8 13 70 36 29 49 15 74 44 19 52 42 59 92 37", "output": "1012" }, { "input": "100 33\n84 70 12 53 10 38 4 66 42 1 100 98 42 10 31 26 22 94 19 43 86 5 37 64 77 98 81 40 17 66 52 43 5 7 79 92 44 78 9 95 10 86 42 56 34 91 12 17 26 16 24 99 11 37 89 100 60 74 32 66 13 29 3 24 41 99 93 87 85 74 5 3 70 46 23 12 43 10 24 32 95 2 57 86 29 100 29 62 17 24 4 40 40 73 29 11 69 89 10 31", "output": "1467" }, { "input": "100 12\n90 59 100 12 82 31 66 28 7 13 43 42 48 94 60 32 20 92 37 39 22 55 14 23 77 56 21 55 10 89 93 79 5 80 40 80 6 15 56 82 68 61 32 100 23 7 13 92 32 82 17 85 49 85 13 75 4 7 42 14 84 22 50 12 11 75 4 85 32 96 56 13 34 100 66 37 58 58 24 58 81 63 59 55 89 97 90 69 29 11 71 58 58 43 72 96 81 72 14 64", "output": "2377" }, { "input": "100 3\n92 51 91 67 32 97 40 24 78 72 93 90 57 77 66 13 55 24 17 90 65 35 69 97 79 31 85 2 90 80 49 44 73 77 34 45 74 75 35 14 34 56 60 54 36 55 16 49 12 54 92 68 70 71 5 79 67 89 64 80 20 84 4 39 55 84 53 59 68 11 89 89 15 73 67 86 91 78 49 24 58 83 55 34 82 97 27 29 78 15 20 48 9 87 41 34 91 76 82 44", "output": "4839" }, { "input": "100 1\n85 75 55 65 39 26 47 16 9 11 3 4 70 23 56 64 36 34 16 13 18 28 32 80 8 79 76 4 21 75 93 51 85 86 100 88 91 71 97 28 66 22 47 87 91 95 3 56 81 53 88 90 21 30 74 45 58 73 36 40 70 51 28 75 20 54 69 52 14 48 52 53 91 81 32 68 16 48 60 66 91 32 55 42 93 51 3 46 23 64 39 1 30 42 20 83 99 29 35 59", "output": "4801" } ]
1,660,523,005
2,147,483,647
PyPy 3-64
OK
TESTS
20
124
0
with open("input.txt", "r") as fr: n, k = map(int, fr.readline().split()) a = list(map(int, fr.readline().split())) for i in range(n): for j in range(3): if a[i] < k: break a[i] -= k with open("output.txt", "w") as fw: fw.write(str(sum(a)))
Title: Winnie-the-Pooh and honey Time Limit: None seconds Memory Limit: None megabytes Problem Description: As we all know, Winnie-the-Pooh just adores honey. Ones he and the Piglet found out that the Rabbit has recently gotten hold of an impressive amount of this sweet and healthy snack. As you may guess, Winnie and the Piglet asked to come at the Rabbit's place. Thus, there are *n* jars of honey lined up in front of Winnie-the-Pooh, jar number *i* contains *a**i* kilos of honey. Winnie-the-Pooh eats the honey like that: each time he chooses a jar containing most honey. If the jar has less that *k* kilos of honey or if Winnie-the-Pooh has already eaten from it three times, he gives the jar to Piglet. Otherwise he eats exactly *k* kilos of honey from the jar and puts it back. Winnie does so until he gives all jars to the Piglet. Count how much honey Piglet will overall get after Winnie satisfies his hunger. Input Specification: The first line contains two integers *n* and *k* (1<=≀<=*n*<=≀<=100,<=1<=≀<=*k*<=≀<=100). The second line contains *n* integers *a*1, *a*2, ..., *a**n*, separated by spaces (1<=≀<=*a**i*<=≀<=100). Output Specification: Print a single number β€” how many kilos of honey gets Piglet. Demo Input: ['3 3\n15 8 10\n'] Demo Output: ['9\n'] Note: none
```python with open("input.txt", "r") as fr: n, k = map(int, fr.readline().split()) a = list(map(int, fr.readline().split())) for i in range(n): for j in range(3): if a[i] < k: break a[i] -= k with open("output.txt", "w") as fw: fw.write(str(sum(a))) ```
3
588
A
Duff and Meat
PROGRAMMING
900
[ "greedy" ]
null
null
Duff is addicted to meat! Malek wants to keep her happy for *n* days. In order to be happy in *i*-th day, she needs to eat exactly *a**i* kilograms of meat. There is a big shop uptown and Malek wants to buy meat for her from there. In *i*-th day, they sell meat for *p**i* dollars per kilogram. Malek knows all numbers *a*1,<=...,<=*a**n* and *p*1,<=...,<=*p**n*. In each day, he can buy arbitrary amount of meat, also he can keep some meat he has for the future. Malek is a little tired from cooking meat, so he asked for your help. Help him to minimize the total money he spends to keep Duff happy for *n* days.
The first line of input contains integer *n* (1<=≀<=*n*<=≀<=105), the number of days. In the next *n* lines, *i*-th line contains two integers *a**i* and *p**i* (1<=≀<=*a**i*,<=*p**i*<=≀<=100), the amount of meat Duff needs and the cost of meat in that day.
Print the minimum money needed to keep Duff happy for *n* days, in one line.
[ "3\n1 3\n2 2\n3 1\n", "3\n1 3\n2 1\n3 2\n" ]
[ "10\n", "8\n" ]
In the first sample case: An optimal way would be to buy 1 kg on the first day, 2 kg on the second day and 3 kg on the third day. In the second sample case: An optimal way would be to buy 1 kg on the first day and 5 kg (needed meat for the second and third day) on the second day.
750
[ { "input": "3\n1 3\n2 2\n3 1", "output": "10" }, { "input": "3\n1 3\n2 1\n3 2", "output": "8" }, { "input": "1\n39 52", "output": "2028" }, { "input": "2\n25 56\n94 17", "output": "2998" }, { "input": "5\n39 21\n95 89\n73 90\n9 55\n85 32", "output": "6321" }, { "input": "12\n70 11\n74 27\n32 11\n26 83\n57 18\n97 28\n75 43\n75 21\n84 29\n16 2\n89 63\n21 88", "output": "6742" }, { "input": "2\n100 68\n38 80", "output": "9384" } ]
1,549,450,009
2,147,483,647
Python 3
OK
TESTS
30
389
0
N = int(input()) Lowest = 100000 SUM = 0 for i in range(N): X = list(map(int, input().split())) Lowest = min(Lowest, X[1]) SUM += X[0] * Lowest print(SUM)
Title: Duff and Meat Time Limit: None seconds Memory Limit: None megabytes Problem Description: Duff is addicted to meat! Malek wants to keep her happy for *n* days. In order to be happy in *i*-th day, she needs to eat exactly *a**i* kilograms of meat. There is a big shop uptown and Malek wants to buy meat for her from there. In *i*-th day, they sell meat for *p**i* dollars per kilogram. Malek knows all numbers *a*1,<=...,<=*a**n* and *p*1,<=...,<=*p**n*. In each day, he can buy arbitrary amount of meat, also he can keep some meat he has for the future. Malek is a little tired from cooking meat, so he asked for your help. Help him to minimize the total money he spends to keep Duff happy for *n* days. Input Specification: The first line of input contains integer *n* (1<=≀<=*n*<=≀<=105), the number of days. In the next *n* lines, *i*-th line contains two integers *a**i* and *p**i* (1<=≀<=*a**i*,<=*p**i*<=≀<=100), the amount of meat Duff needs and the cost of meat in that day. Output Specification: Print the minimum money needed to keep Duff happy for *n* days, in one line. Demo Input: ['3\n1 3\n2 2\n3 1\n', '3\n1 3\n2 1\n3 2\n'] Demo Output: ['10\n', '8\n'] Note: In the first sample case: An optimal way would be to buy 1 kg on the first day, 2 kg on the second day and 3 kg on the third day. In the second sample case: An optimal way would be to buy 1 kg on the first day and 5 kg (needed meat for the second and third day) on the second day.
```python N = int(input()) Lowest = 100000 SUM = 0 for i in range(N): X = list(map(int, input().split())) Lowest = min(Lowest, X[1]) SUM += X[0] * Lowest print(SUM) ```
3
82
A
Double Cola
PROGRAMMING
1,100
[ "implementation", "math" ]
A. Double Cola
1
256
Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum. For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny. Write a program that will print the name of a man who will drink the *n*-th can. Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon.
The input data consist of a single integer *n* (1<=≀<=*n*<=≀<=109). It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers.
Print the single line β€” the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially.
[ "1\n", "6\n", "1802\n" ]
[ "Sheldon\n", "Sheldon\n", "Penny\n" ]
none
500
[ { "input": "1", "output": "Sheldon" }, { "input": "6", "output": "Sheldon" }, { "input": "1802", "output": "Penny" }, { "input": "1", "output": "Sheldon" }, { "input": "2", "output": "Leonard" }, { "input": "3", "output": "Penny" }, { "input": "4", "output": "Rajesh" }, { "input": "5", "output": "Howard" }, { "input": "10", "output": "Penny" }, { "input": "534", "output": "Rajesh" }, { "input": "5033", "output": "Howard" }, { "input": "10010", "output": "Howard" }, { "input": "500000000", "output": "Penny" }, { "input": "63", "output": "Rajesh" }, { "input": "841", "output": "Leonard" }, { "input": "3667", "output": "Penny" }, { "input": "38614", "output": "Howard" }, { "input": "282798", "output": "Rajesh" }, { "input": "9266286", "output": "Rajesh" }, { "input": "27385966", "output": "Leonard" }, { "input": "121580142", "output": "Penny" }, { "input": "5", "output": "Howard" }, { "input": "300", "output": "Howard" }, { "input": "1745", "output": "Leonard" }, { "input": "8302", "output": "Rajesh" }, { "input": "184518", "output": "Sheldon" }, { "input": "1154414", "output": "Rajesh" }, { "input": "28643950", "output": "Leonard" }, { "input": "159222638", "output": "Howard" }, { "input": "24", "output": "Penny" }, { "input": "505", "output": "Penny" }, { "input": "4425", "output": "Rajesh" }, { "input": "12079", "output": "Sheldon" }, { "input": "469726", "output": "Penny" }, { "input": "3961838", "output": "Penny" }, { "input": "57710446", "output": "Leonard" }, { "input": "80719470", "output": "Howard" }, { "input": "1000000000", "output": "Penny" }, { "input": "999999999", "output": "Penny" }, { "input": "999999998", "output": "Penny" }, { "input": "5", "output": "Howard" } ]
1,629,212,623
2,147,483,647
Python 3
OK
TESTS
41
62
6,758,400
n = int(input()) peeps = ["Sheldon", "Leonard", "Penny", "Rajesh", "Howard"] if n<6: print(peeps[n-1]) else: r = 1 while r*5 < n: n -= r*5 r *= 2 print(peeps[(n-1)//r])
Title: Double Cola Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum. For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny. Write a program that will print the name of a man who will drink the *n*-th can. Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon. Input Specification: The input data consist of a single integer *n* (1<=≀<=*n*<=≀<=109). It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers. Output Specification: Print the single line β€” the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially. Demo Input: ['1\n', '6\n', '1802\n'] Demo Output: ['Sheldon\n', 'Sheldon\n', 'Penny\n'] Note: none
```python n = int(input()) peeps = ["Sheldon", "Leonard", "Penny", "Rajesh", "Howard"] if n<6: print(peeps[n-1]) else: r = 1 while r*5 < n: n -= r*5 r *= 2 print(peeps[(n-1)//r]) ```
3.956411
110
A
Nearly Lucky Number
PROGRAMMING
800
[ "implementation" ]
A. Nearly Lucky Number
2
256
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. Unfortunately, not all numbers are lucky. Petya calls a number nearly lucky if the number of lucky digits in it is a lucky number. He wonders whether number *n* is a nearly lucky number.
The only line contains an integer *n* (1<=≀<=*n*<=≀<=1018). Please do not use the %lld specificator to read or write 64-bit numbers in Π‘++. It is preferred to use the cin, cout streams or the %I64d specificator.
Print on the single line "YES" if *n* is a nearly lucky number. Otherwise, print "NO" (without the quotes).
[ "40047\n", "7747774\n", "1000000000000000000\n" ]
[ "NO\n", "YES\n", "NO\n" ]
In the first sample there are 3 lucky digits (first one and last two), so the answer is "NO". In the second sample there are 7 lucky digits, 7 is lucky number, so the answer is "YES". In the third sample there are no lucky digits, so the answer is "NO".
500
[ { "input": "40047", "output": "NO" }, { "input": "7747774", "output": "YES" }, { "input": "1000000000000000000", "output": "NO" }, { "input": "7", "output": "NO" }, { "input": "4", "output": "NO" }, { "input": "474404774", "output": "NO" }, { "input": "4744000695826", "output": "YES" }, { "input": "10000000004744744", "output": "YES" }, { "input": "446486416781684178", "output": "YES" }, { "input": "999999999", "output": "NO" }, { "input": "7777", "output": "YES" }, { "input": "87414417444", "output": "NO" }, { "input": "111222333444555667", "output": "YES" }, { "input": "1", "output": "NO" }, { "input": "4700", "output": "NO" }, { "input": "3794555488744477", "output": "NO" }, { "input": "444444444444444444", "output": "NO" }, { "input": "474447447774444774", "output": "NO" }, { "input": "777777777777777", "output": "NO" }, { "input": "34777745021000000", "output": "NO" }, { "input": "963", "output": "NO" }, { "input": "855474448854788540", "output": "NO" }, { "input": "999999999999994744", "output": "YES" }, { "input": "400000000474", "output": "YES" }, { "input": "123456789123456789", "output": "YES" }, { "input": "740577777584945874", "output": "NO" }, { "input": "7777777", "output": "YES" }, { "input": "4444000111222333", "output": "YES" }, { "input": "9847745885202111", "output": "YES" }, { "input": "123456000000", "output": "NO" }, { "input": "4744447444444", "output": "NO" }, { "input": "7477", "output": "YES" }, { "input": "4747477", "output": "YES" }, { "input": "777777777444444444", "output": "NO" } ]
1,695,317,659
2,147,483,647
PyPy 3-64
OK
TESTS
34
154
0
def n_lucky(n): c = 0 for d in str(n): if d == '4' or d == '7': c += 1 return lucky(c) def lucky(n): lucky_d = ['4', '7'] for d in str(n): if d not in lucky_d: return "NO" return "YES" n = int(input()) result = n_lucky(n) print(result)
Title: Nearly Lucky Number Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. Unfortunately, not all numbers are lucky. Petya calls a number nearly lucky if the number of lucky digits in it is a lucky number. He wonders whether number *n* is a nearly lucky number. Input Specification: The only line contains an integer *n* (1<=≀<=*n*<=≀<=1018). Please do not use the %lld specificator to read or write 64-bit numbers in Π‘++. It is preferred to use the cin, cout streams or the %I64d specificator. Output Specification: Print on the single line "YES" if *n* is a nearly lucky number. Otherwise, print "NO" (without the quotes). Demo Input: ['40047\n', '7747774\n', '1000000000000000000\n'] Demo Output: ['NO\n', 'YES\n', 'NO\n'] Note: In the first sample there are 3 lucky digits (first one and last two), so the answer is "NO". In the second sample there are 7 lucky digits, 7 is lucky number, so the answer is "YES". In the third sample there are no lucky digits, so the answer is "NO".
```python def n_lucky(n): c = 0 for d in str(n): if d == '4' or d == '7': c += 1 return lucky(c) def lucky(n): lucky_d = ['4', '7'] for d in str(n): if d not in lucky_d: return "NO" return "YES" n = int(input()) result = n_lucky(n) print(result) ```
3.9615
939
A
Love Triangle
PROGRAMMING
800
[ "graphs" ]
null
null
As you could know there are no male planes nor female planes. However, each plane on Earth likes some other plane. There are *n* planes on Earth, numbered from 1 to *n*, and the plane with number *i* likes the plane with number *f**i*, where 1<=≀<=*f**i*<=≀<=*n* and *f**i*<=β‰ <=*i*. We call a love triangle a situation in which plane *A* likes plane *B*, plane *B* likes plane *C* and plane *C* likes plane *A*. Find out if there is any love triangle on Earth.
The first line contains a single integer *n* (2<=≀<=*n*<=≀<=5000)Β β€” the number of planes. The second line contains *n* integers *f*1,<=*f*2,<=...,<=*f**n* (1<=≀<=*f**i*<=≀<=*n*, *f**i*<=β‰ <=*i*), meaning that the *i*-th plane likes the *f**i*-th.
Output Β«YESΒ» if there is a love triangle consisting of planes on Earth. Otherwise, output Β«NOΒ». You can output any letter in lower case or in upper case.
[ "5\n2 4 5 1 3\n", "5\n5 5 5 5 1\n" ]
[ "YES\n", "NO\n" ]
In first example plane 2 likes plane 4, plane 4 likes plane 1, plane 1 likes plane 2 and that is a love triangle. In second example there are no love triangles.
500
[ { "input": "5\n2 4 5 1 3", "output": "YES" }, { "input": "5\n5 5 5 5 1", "output": "NO" }, { "input": "3\n3 1 2", "output": "YES" }, { "input": "10\n4 10 9 5 3 1 5 10 6 4", "output": "NO" }, { "input": "10\n5 5 4 9 10 9 9 5 3 1", "output": "YES" }, { "input": "100\n50 40 60 87 39 58 44 84 46 68 16 57 77 87 92 95 42 31 74 15 36 84 30 3 47 15 87 90 76 66 6 63 74 19 40 49 6 84 41 9 77 34 7 12 11 73 58 24 81 14 81 29 65 100 1 85 64 32 38 4 54 67 32 81 80 7 100 71 29 80 4 52 47 7 78 56 52 75 81 37 16 41 27 28 58 60 62 47 29 40 37 14 59 91 12 54 25 58 12 43", "output": "NO" }, { "input": "100\n25 6 46 37 87 99 70 31 46 12 94 40 87 56 28 8 94 39 13 12 67 13 71 39 83 48 40 14 62 41 16 71 20 41 83 41 68 98 23 82 62 83 62 35 49 22 31 21 66 98 54 39 34 52 11 28 47 89 25 44 68 36 91 46 82 86 88 48 27 93 7 9 53 36 16 100 84 84 44 25 58 66 16 46 72 21 91 78 4 17 44 17 47 67 93 89 75 44 56 50", "output": "YES" }, { "input": "2\n2 1", "output": "NO" }, { "input": "3\n2 3 1", "output": "YES" }, { "input": "5\n2 1 4 5 3", "output": "YES" }, { "input": "5\n5 4 5 5 2", "output": "YES" } ]
1,649,156,116
2,147,483,647
PyPy 3-64
OK
TESTS
16
61
2,560,000
a = int(input()) b = list(map(int,input().split())) c = [] for i in b: if b[b[b[i-1]-1]-1]==i: c.append("YES") c.append("NO") print(c[0])
Title: Love Triangle Time Limit: None seconds Memory Limit: None megabytes Problem Description: As you could know there are no male planes nor female planes. However, each plane on Earth likes some other plane. There are *n* planes on Earth, numbered from 1 to *n*, and the plane with number *i* likes the plane with number *f**i*, where 1<=≀<=*f**i*<=≀<=*n* and *f**i*<=β‰ <=*i*. We call a love triangle a situation in which plane *A* likes plane *B*, plane *B* likes plane *C* and plane *C* likes plane *A*. Find out if there is any love triangle on Earth. Input Specification: The first line contains a single integer *n* (2<=≀<=*n*<=≀<=5000)Β β€” the number of planes. The second line contains *n* integers *f*1,<=*f*2,<=...,<=*f**n* (1<=≀<=*f**i*<=≀<=*n*, *f**i*<=β‰ <=*i*), meaning that the *i*-th plane likes the *f**i*-th. Output Specification: Output Β«YESΒ» if there is a love triangle consisting of planes on Earth. Otherwise, output Β«NOΒ». You can output any letter in lower case or in upper case. Demo Input: ['5\n2 4 5 1 3\n', '5\n5 5 5 5 1\n'] Demo Output: ['YES\n', 'NO\n'] Note: In first example plane 2 likes plane 4, plane 4 likes plane 1, plane 1 likes plane 2 and that is a love triangle. In second example there are no love triangles.
```python a = int(input()) b = list(map(int,input().split())) c = [] for i in b: if b[b[b[i-1]-1]-1]==i: c.append("YES") c.append("NO") print(c[0]) ```
3
716
A
Crazy Computer
PROGRAMMING
800
[ "implementation" ]
null
null
ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear! More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≀<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=&gt;<=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen. For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen. You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything.
The first line contains two integers *n* and *c* (1<=≀<=*n*<=≀<=100<=000,<=1<=≀<=*c*<=≀<=109)Β β€” the number of words ZS the Coder typed and the crazy computer delay respectively. The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≀<=*t*1<=&lt;<=*t*2<=&lt;<=...<=&lt;<=*t**n*<=≀<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word.
Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*.
[ "6 5\n1 3 8 14 19 20\n", "6 1\n1 3 5 7 9 10\n" ]
[ "3", "2" ]
The first sample is already explained in the problem statement. For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 &gt; 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≀ 1.
500
[ { "input": "6 5\n1 3 8 14 19 20", "output": "3" }, { "input": "6 1\n1 3 5 7 9 10", "output": "2" }, { "input": "1 1\n1000000000", "output": "1" }, { "input": "5 5\n1 7 12 13 14", "output": "4" }, { "input": "2 1000000000\n1 1000000000", "output": "2" }, { "input": "3 5\n1 10 20", "output": "1" }, { "input": "3 10\n1 2 3", "output": "3" }, { "input": "2 1\n1 100", "output": "1" }, { "input": "3 1\n1 2 10", "output": "1" }, { "input": "2 1\n1 2", "output": "2" } ]
1,585,575,058
2,147,483,647
PyPy 3
OK
TESTS
81
218
10,547,200
c = int(input().split(' ')[1]) words = list(map(int, input().split(' '))) l = 0; last = 0 for i in words: if i - last > c: l = 1 else: l += 1 last = i print(l)
Title: Crazy Computer Time Limit: None seconds Memory Limit: None megabytes Problem Description: ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear! More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≀<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=&gt;<=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen. For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen. You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything. Input Specification: The first line contains two integers *n* and *c* (1<=≀<=*n*<=≀<=100<=000,<=1<=≀<=*c*<=≀<=109)Β β€” the number of words ZS the Coder typed and the crazy computer delay respectively. The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≀<=*t*1<=&lt;<=*t*2<=&lt;<=...<=&lt;<=*t**n*<=≀<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word. Output Specification: Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*. Demo Input: ['6 5\n1 3 8 14 19 20\n', '6 1\n1 3 5 7 9 10\n'] Demo Output: ['3', '2'] Note: The first sample is already explained in the problem statement. For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 &gt; 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≀ 1.
```python c = int(input().split(' ')[1]) words = list(map(int, input().split(' '))) l = 0; last = 0 for i in words: if i - last > c: l = 1 else: l += 1 last = i print(l) ```
3
893
C
Rumor
PROGRAMMING
1,300
[ "dfs and similar", "graphs", "greedy" ]
null
null
Vova promised himself that he would never play computer games... But recently Firestorm β€” a well-known game developing company β€” published their newest game, World of Farcraft, and it became really popular. Of course, Vova started playing it. Now he tries to solve a quest. The task is to come to a settlement named Overcity and spread a rumor in it. Vova knows that there are *n* characters in Overcity. Some characters are friends to each other, and they share information they got. Also Vova knows that he can bribe each character so he or she starts spreading the rumor; *i*-th character wants *c**i* gold in exchange for spreading the rumor. When a character hears the rumor, he tells it to all his friends, and they start spreading the rumor to their friends (for free), and so on. The quest is finished when all *n* characters know the rumor. What is the minimum amount of gold Vova needs to spend in order to finish the quest? Take a look at the notes if you think you haven't understood the problem completely.
The first line contains two integer numbers *n* and *m* (1<=≀<=*n*<=≀<=105,<=0<=≀<=*m*<=≀<=105) β€” the number of characters in Overcity and the number of pairs of friends. The second line contains *n* integer numbers *c**i* (0<=≀<=*c**i*<=≀<=109) β€” the amount of gold *i*-th character asks to start spreading the rumor. Then *m* lines follow, each containing a pair of numbers (*x**i*,<=*y**i*) which represent that characters *x**i* and *y**i* are friends (1<=≀<=*x**i*,<=*y**i*<=≀<=*n*, *x**i*<=β‰ <=*y**i*). It is guaranteed that each pair is listed at most once.
Print one number β€” the minimum amount of gold Vova has to spend in order to finish the quest.
[ "5 2\n2 5 3 4 8\n1 4\n4 5\n", "10 0\n1 2 3 4 5 6 7 8 9 10\n", "10 5\n1 6 2 7 3 8 4 9 5 10\n1 2\n3 4\n5 6\n7 8\n9 10\n" ]
[ "10\n", "55\n", "15\n" ]
In the first example the best decision is to bribe the first character (he will spread the rumor to fourth character, and the fourth one will spread it to fifth). Also Vova has to bribe the second and the third characters, so they know the rumor. In the second example Vova has to bribe everyone. In the third example the optimal decision is to bribe the first, the third, the fifth, the seventh and the ninth characters.
0
[ { "input": "5 2\n2 5 3 4 8\n1 4\n4 5", "output": "10" }, { "input": "10 0\n1 2 3 4 5 6 7 8 9 10", "output": "55" }, { "input": "10 5\n1 6 2 7 3 8 4 9 5 10\n1 2\n3 4\n5 6\n7 8\n9 10", "output": "15" }, { "input": "1 0\n0", "output": "0" }, { "input": "1 0\n1000000000", "output": "1000000000" }, { "input": "2 0\n0 0", "output": "0" }, { "input": "2 0\n1000000000 0", "output": "1000000000" }, { "input": "2 0\n0 1000000000", "output": "1000000000" }, { "input": "2 0\n1000000000 1000000000", "output": "2000000000" }, { "input": "2 1\n0 0\n1 2", "output": "0" } ]
1,681,501,521
2,147,483,647
Python 3
OK
TESTS
46
1,326
14,336,000
import collections n, m = list(map(int, input().split())) nums = list(map(int, input().split())) INF = 10 ** 9 + 13 arr = [] for index in range(n): arr.append([]) for index in range(m): v, u = list(map(int, input().split())) v -= 1 u -= 1 arr[v].append(u) arr[u].append(v) used = [False] * n res = INF def dfs(v): global arr, used, res used[v] = True res = min(res,nums[v]) for u in arr[v]: if not used[u]: dfs(u) def bfs(v): global arr, used, res q = collections.deque([v]) used[v] = True while q: u = q.pop() res = min(res, nums[u]) for w in arr[u]: if not used[w]: q.append(w) used[w] = True ans = 0 for index in range(n): if not used[index]: res = INF bfs(index) ans += res print(ans)
Title: Rumor Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vova promised himself that he would never play computer games... But recently Firestorm β€” a well-known game developing company β€” published their newest game, World of Farcraft, and it became really popular. Of course, Vova started playing it. Now he tries to solve a quest. The task is to come to a settlement named Overcity and spread a rumor in it. Vova knows that there are *n* characters in Overcity. Some characters are friends to each other, and they share information they got. Also Vova knows that he can bribe each character so he or she starts spreading the rumor; *i*-th character wants *c**i* gold in exchange for spreading the rumor. When a character hears the rumor, he tells it to all his friends, and they start spreading the rumor to their friends (for free), and so on. The quest is finished when all *n* characters know the rumor. What is the minimum amount of gold Vova needs to spend in order to finish the quest? Take a look at the notes if you think you haven't understood the problem completely. Input Specification: The first line contains two integer numbers *n* and *m* (1<=≀<=*n*<=≀<=105,<=0<=≀<=*m*<=≀<=105) β€” the number of characters in Overcity and the number of pairs of friends. The second line contains *n* integer numbers *c**i* (0<=≀<=*c**i*<=≀<=109) β€” the amount of gold *i*-th character asks to start spreading the rumor. Then *m* lines follow, each containing a pair of numbers (*x**i*,<=*y**i*) which represent that characters *x**i* and *y**i* are friends (1<=≀<=*x**i*,<=*y**i*<=≀<=*n*, *x**i*<=β‰ <=*y**i*). It is guaranteed that each pair is listed at most once. Output Specification: Print one number β€” the minimum amount of gold Vova has to spend in order to finish the quest. Demo Input: ['5 2\n2 5 3 4 8\n1 4\n4 5\n', '10 0\n1 2 3 4 5 6 7 8 9 10\n', '10 5\n1 6 2 7 3 8 4 9 5 10\n1 2\n3 4\n5 6\n7 8\n9 10\n'] Demo Output: ['10\n', '55\n', '15\n'] Note: In the first example the best decision is to bribe the first character (he will spread the rumor to fourth character, and the fourth one will spread it to fifth). Also Vova has to bribe the second and the third characters, so they know the rumor. In the second example Vova has to bribe everyone. In the third example the optimal decision is to bribe the first, the third, the fifth, the seventh and the ninth characters.
```python import collections n, m = list(map(int, input().split())) nums = list(map(int, input().split())) INF = 10 ** 9 + 13 arr = [] for index in range(n): arr.append([]) for index in range(m): v, u = list(map(int, input().split())) v -= 1 u -= 1 arr[v].append(u) arr[u].append(v) used = [False] * n res = INF def dfs(v): global arr, used, res used[v] = True res = min(res,nums[v]) for u in arr[v]: if not used[u]: dfs(u) def bfs(v): global arr, used, res q = collections.deque([v]) used[v] = True while q: u = q.pop() res = min(res, nums[u]) for w in arr[u]: if not used[w]: q.append(w) used[w] = True ans = 0 for index in range(n): if not used[index]: res = INF bfs(index) ans += res print(ans) ```
3
834
A
The Useless Toy
PROGRAMMING
900
[ "implementation" ]
null
null
Walking through the streets of Marshmallow City, Slastyona have spotted some merchants selling a kind of useless toy which is very popular nowadays – caramel spinner! Wanting to join the craze, she has immediately bought the strange contraption. Spinners in Sweetland have the form of V-shaped pieces of caramel. Each spinner can, well, spin around an invisible magic axis. At a specific point in time, a spinner can take 4 positions shown below (each one rotated 90 degrees relative to the previous, with the fourth one followed by the first one): After the spinner was spun, it starts its rotation, which is described by a following algorithm: the spinner maintains its position for a second then majestically switches to the next position in clockwise or counter-clockwise order, depending on the direction the spinner was spun in. Slastyona managed to have spinner rotating for exactly *n* seconds. Being fascinated by elegance of the process, she completely forgot the direction the spinner was spun in! Lucky for her, she managed to recall the starting position, and wants to deduct the direction given the information she knows. Help her do this.
There are two characters in the first string – the starting and the ending position of a spinner. The position is encoded with one of the following characters: v (ASCII code 118, lowercase v), &lt; (ASCII code 60), ^ (ASCII code 94) or &gt; (ASCII code 62) (see the picture above for reference). Characters are separated by a single space. In the second strings, a single number *n* is given (0<=≀<=*n*<=≀<=109) – the duration of the rotation. It is guaranteed that the ending position of a spinner is a result of a *n* second spin in any of the directions, assuming the given starting position.
Output cw, if the direction is clockwise, ccw – if counter-clockwise, and undefined otherwise.
[ "^ &gt;\n1\n", "&lt; ^\n3\n", "^ v\n6\n" ]
[ "cw\n", "ccw\n", "undefined\n" ]
none
500
[ { "input": "^ >\n1", "output": "cw" }, { "input": "< ^\n3", "output": "ccw" }, { "input": "^ v\n6", "output": "undefined" }, { "input": "^ >\n999999999", "output": "ccw" }, { "input": "> v\n1", "output": "cw" }, { "input": "v <\n1", "output": "cw" }, { "input": "< ^\n1", "output": "cw" }, { "input": "v <\n422435957", "output": "cw" }, { "input": "v >\n139018901", "output": "ccw" }, { "input": "v ^\n571728018", "output": "undefined" }, { "input": "^ ^\n0", "output": "undefined" }, { "input": "< >\n2", "output": "undefined" }, { "input": "> >\n1000000000", "output": "undefined" }, { "input": "v v\n8", "output": "undefined" }, { "input": "< <\n1568", "output": "undefined" }, { "input": "^ v\n2", "output": "undefined" }, { "input": "^ <\n1", "output": "ccw" }, { "input": "< v\n1", "output": "ccw" }, { "input": "v >\n1", "output": "ccw" }, { "input": "> ^\n1", "output": "ccw" }, { "input": "v <\n422435957", "output": "cw" }, { "input": "v v\n927162384", "output": "undefined" }, { "input": "v ^\n571728018", "output": "undefined" }, { "input": "^ <\n467441155", "output": "cw" }, { "input": "^ >\n822875521", "output": "cw" }, { "input": "^ <\n821690113", "output": "ccw" }, { "input": "^ <\n171288453", "output": "ccw" }, { "input": "^ <\n110821381", "output": "ccw" }, { "input": "^ ^\n539580280", "output": "undefined" }, { "input": "^ >\n861895563", "output": "ccw" }, { "input": "v v\n4", "output": "undefined" }, { "input": "^ ^\n4", "output": "undefined" }, { "input": "> >\n4", "output": "undefined" }, { "input": "< <\n8", "output": "undefined" }, { "input": "v v\n0", "output": "undefined" }, { "input": "^ <\n11", "output": "cw" }, { "input": "< <\n4", "output": "undefined" }, { "input": "< <\n0", "output": "undefined" }, { "input": "< v\n3", "output": "cw" }, { "input": "^ <\n3", "output": "cw" }, { "input": "^ <\n7", "output": "cw" }, { "input": "< >\n6", "output": "undefined" }, { "input": "v >\n3", "output": "cw" }, { "input": "> >\n300", "output": "undefined" }, { "input": "> >\n0", "output": "undefined" }, { "input": "v <\n3", "output": "ccw" }, { "input": "> >\n12", "output": "undefined" } ]
1,502,384,288
2,147,483,647
Python 3
OK
TESTS
47
62
4,608,000
char1, char2 = input().split() n = int(input())%4 cw = "v<^>v<^>" ccw = "v>^<v>^<" if n%2==1 and cw[cw.find(char1)+n]==char2: print("cw") elif n%2==1 and ccw[ccw.find(char1)+n]==char2: print("ccw") else: print("undefined")
Title: The Useless Toy Time Limit: None seconds Memory Limit: None megabytes Problem Description: Walking through the streets of Marshmallow City, Slastyona have spotted some merchants selling a kind of useless toy which is very popular nowadays – caramel spinner! Wanting to join the craze, she has immediately bought the strange contraption. Spinners in Sweetland have the form of V-shaped pieces of caramel. Each spinner can, well, spin around an invisible magic axis. At a specific point in time, a spinner can take 4 positions shown below (each one rotated 90 degrees relative to the previous, with the fourth one followed by the first one): After the spinner was spun, it starts its rotation, which is described by a following algorithm: the spinner maintains its position for a second then majestically switches to the next position in clockwise or counter-clockwise order, depending on the direction the spinner was spun in. Slastyona managed to have spinner rotating for exactly *n* seconds. Being fascinated by elegance of the process, she completely forgot the direction the spinner was spun in! Lucky for her, she managed to recall the starting position, and wants to deduct the direction given the information she knows. Help her do this. Input Specification: There are two characters in the first string – the starting and the ending position of a spinner. The position is encoded with one of the following characters: v (ASCII code 118, lowercase v), &lt; (ASCII code 60), ^ (ASCII code 94) or &gt; (ASCII code 62) (see the picture above for reference). Characters are separated by a single space. In the second strings, a single number *n* is given (0<=≀<=*n*<=≀<=109) – the duration of the rotation. It is guaranteed that the ending position of a spinner is a result of a *n* second spin in any of the directions, assuming the given starting position. Output Specification: Output cw, if the direction is clockwise, ccw – if counter-clockwise, and undefined otherwise. Demo Input: ['^ &gt;\n1\n', '&lt; ^\n3\n', '^ v\n6\n'] Demo Output: ['cw\n', 'ccw\n', 'undefined\n'] Note: none
```python char1, char2 = input().split() n = int(input())%4 cw = "v<^>v<^>" ccw = "v>^<v>^<" if n%2==1 and cw[cw.find(char1)+n]==char2: print("cw") elif n%2==1 and ccw[ccw.find(char1)+n]==char2: print("ccw") else: print("undefined") ```
3
841
A
Generous Kefa
PROGRAMMING
900
[ "brute force", "implementation" ]
null
null
One day Kefa found *n* baloons. For convenience, we denote color of *i*-th baloon as *s**i* β€” lowercase letter of the Latin alphabet. Also Kefa has *k* friends. Friend will be upset, If he get two baloons of the same color. Kefa want to give out all baloons to his friends. Help Kefa to find out, can he give out all his baloons, such that no one of his friens will be upset β€” print Β«YESΒ», if he can, and Β«NOΒ», otherwise. Note, that Kefa's friend will not upset, if he doesn't get baloons at all.
The first line contains two integers *n* and *k* (1<=≀<=*n*,<=*k*<=≀<=100) β€” the number of baloons and friends. Next line contains string *s* β€” colors of baloons.
Answer to the task β€” Β«YESΒ» or Β«NOΒ» in a single line. You can choose the case (lower or upper) for each letter arbitrary.
[ "4 2\naabb\n", "6 3\naacaab\n" ]
[ "YES\n", "NO\n" ]
In the first sample Kefa can give 1-st and 3-rd baloon to the first friend, and 2-nd and 4-th to the second. In the second sample Kefa needs to give to all his friends baloons of color a, but one baloon will stay, thats why answer is Β«NOΒ».
500
[ { "input": "4 2\naabb", "output": "YES" }, { "input": "6 3\naacaab", "output": "NO" }, { "input": "2 2\nlu", "output": "YES" }, { "input": "5 3\novvoo", "output": "YES" }, { "input": "36 13\nbzbzcffczzcbcbzzfzbbfzfzzbfbbcbfccbf", "output": "YES" }, { "input": "81 3\nooycgmvvrophvcvpoupepqllqttwcocuilvyxbyumdmmfapvpnxhjhxfuagpnntonibicaqjvwfhwxhbv", "output": "NO" }, { "input": "100 100\nxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx", "output": "YES" }, { "input": "100 1\nnubcvvjvbjgnjsdkajimdcxvewbcytvfkihunycdrlconddlwgzjasjlsrttlrzsumzpyumpveglfqzmaofbshbojmwuwoxxvrod", "output": "NO" }, { "input": "100 13\nvyldolgryldqrvoldvzvrdrgorlorszddtgqvrlisxxrxdxlqtvtgsrqlzixoyrozxzogqxlsgzdddzqrgitxxritoolzolgrtvl", "output": "YES" }, { "input": "18 6\njzwtnkvmscqhmdlsxy", "output": "YES" }, { "input": "21 2\nfscegcqgzesefghhwcexs", "output": "NO" }, { "input": "32 22\ncduamsptaklqtxlyoutlzepxgyfkvngc", "output": "YES" }, { "input": "49 27\noxyorfnkzwsfllnyvdhdanppuzrnbxehugvmlkgeymqjlmfxd", "output": "YES" }, { "input": "50 24\nxxutzjwbggcwvxztttkmzovtmuwttzcbwoztttohzzxghuuthv", "output": "YES" }, { "input": "57 35\nglxshztrqqfyxthqamagvtmrdparhelnzrqvcwqxjytkbuitovkdxueul", "output": "YES" }, { "input": "75 23\nittttiiuitutuiiuuututiuttiuiuutuuuiuiuuuuttuuttuutuiiuiuiiuiitttuututuiuuii", "output": "NO" }, { "input": "81 66\nfeqevfqfebhvubhuuvfuqheuqhbeeuebehuvhffvbqvqvfbqqvvhevqffbqqhvvqhfeehuhqeqhueuqqq", "output": "YES" }, { "input": "93 42\npqeiafraiavfcteumflpcbpozcomlvpovlzdbldvoopnhdoeqaopzthiuzbzmeieiatthdeqovaqfipqlddllmfcrrnhb", "output": "YES" }, { "input": "100 53\nizszyqyndzwzyzgsdagdwdazadiawizinagqqgczaqqnawgijziziawzszdjdcqjdjqiwgadydcnqisaayjiqqsscwwzjzaycwwc", "output": "YES" }, { "input": "100 14\nvkrdcqbvkwuckpmnbydmczdxoagdsgtqxvhaxntdcxhjcrjyvukhugoglbmyoaqexgtcfdgemmizoniwtmisqqwcwfusmygollab", "output": "YES" }, { "input": "100 42\naaaaaiiiiaiiiaaiaiiaaiiiiiaaaaaiaiiiaiiiiaiiiaaaaaiiiaaaiiaaiiiaiiiaiaaaiaiiiiaaiiiaiiaiaiiaiiiaaaia", "output": "NO" }, { "input": "100 89\ntjbkmydejporbqhcbztkcumxjjgsrvxpuulbhzeeckkbchpbxwhedrlhjsabcexcohgdzouvsgphjdthpuqrlkgzxvqbuhqxdsmf", "output": "YES" }, { "input": "100 100\njhpyiuuzizhubhhpxbbhpyxzhbpjphzppuhiahihiappbhuypyauhizpbibzixjbzxzpbphuiaypyujappuxiyuyaajaxjupbahb", "output": "YES" }, { "input": "100 3\nsszoovvzysavsvzsozzvoozvysozsaszayaszasaysszzzysosyayyvzozovavzoyavsooaoyvoozvvozsaosvayyovazzszzssa", "output": "NO" }, { "input": "100 44\ndluthkxwnorabqsukgnxnvhmsmzilyulpursnxkdsavgemiuizbyzebhyjejgqrvuckhaqtuvdmpziesmpmewpvozdanjyvwcdgo", "output": "YES" }, { "input": "100 90\ntljonbnwnqounictqqctgonktiqoqlocgoblngijqokuquoolciqwnctgoggcbojtwjlculoikbggquqncittwnjbkgkgubnioib", "output": "YES" }, { "input": "100 79\nykxptzgvbqxlregvkvucewtydvnhqhuggdsyqlvcfiuaiddnrrnstityyehiamrggftsqyduwxpuldztyzgmfkehprrneyvtknmf", "output": "YES" }, { "input": "100 79\naagwekyovbviiqeuakbqbqifwavkfkutoriovgfmittulhwojaptacekdirgqoovlleeoqkkdukpadygfwavppohgdrmymmulgci", "output": "YES" }, { "input": "100 93\nearrehrehenaddhdnrdddhdahnadndheeennrearrhraharddreaeraddhehhhrdnredanndneheddrraaneerreedhnadnerhdn", "output": "YES" }, { "input": "100 48\nbmmaebaebmmmbbmxvmammbvvebvaemvbbaxvbvmaxvvmveaxmbbxaaemxmxvxxxvxbmmxaaaevvaxmvamvvmaxaxavexbmmbmmev", "output": "YES" }, { "input": "100 55\nhsavbkehaaesffaeeffakhkhfehbbvbeasahbbbvkesbfvkefeesesevbsvfkbffakvshsbkahfkfakebsvafkbvsskfhfvaasss", "output": "YES" }, { "input": "100 2\ncscffcffsccffsfsfffccssfsscfsfsssffcffsscfccssfffcfscfsscsccccfsssffffcfcfsfffcsfsccffscffcfccccfffs", "output": "NO" }, { "input": "100 3\nzrgznxgdpgfoiifrrrsjfuhvtqxjlgochhyemismjnanfvvpzzvsgajcbsulxyeoepjfwvhkqogiiwqxjkrpsyaqdlwffoockxnc", "output": "NO" }, { "input": "100 5\njbltyyfjakrjeodqepxpkjideulofbhqzxjwlarufwzwsoxhaexpydpqjvhybmvjvntuvhvflokhshpicbnfgsqsmrkrfzcrswwi", "output": "NO" }, { "input": "100 1\nfnslnqktlbmxqpvcvnemxcutebdwepoxikifkzaaixzzydffpdxodmsxjribmxuqhueifdlwzytxkklwhljswqvlejedyrgguvah", "output": "NO" }, { "input": "100 21\nddjenetwgwmdtjbpzssyoqrtirvoygkjlqhhdcjgeurqpunxpupwaepcqkbjjfhnvgpyqnozhhrmhfwararmlcvpgtnopvjqsrka", "output": "YES" }, { "input": "100 100\nnjrhiauqlgkkpkuvciwzivjbbplipvhslqgdkfnmqrxuxnycmpheenmnrglotzuyxycosfediqcuadklsnzjqzfxnbjwvfljnlvq", "output": "YES" }, { "input": "100 100\nbbbbbbbtbbttbtbbbttbttbtbbttttbbbtbttbbbtbttbtbbttttbbbbbtbbttbtbbtbttbbbtbtbtbtbtbtbbbttbbtbtbtbbtb", "output": "YES" }, { "input": "14 5\nfssmmsfffmfmmm", "output": "NO" }, { "input": "2 1\nff", "output": "NO" }, { "input": "2 1\nhw", "output": "YES" }, { "input": "2 2\nss", "output": "YES" }, { "input": "1 1\nl", "output": "YES" }, { "input": "100 50\nfffffttttttjjjuuuvvvvvdddxxxxwwwwgggbsssncccczzyyyyyhhhhhkrreeeeeeaaaaaiiillllllllooooqqqqqqmmpppppp", "output": "YES" }, { "input": "100 50\nbbbbbbbbgggggggggggaaaaaaaahhhhhhhhhhpppppppppsssssssrrrrrrrrllzzzzzzzeeeeeeekkkkkkkwwwwwwwwjjjjjjjj", "output": "YES" }, { "input": "100 50\nwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxxxxzzzzzzzzzzzzzzzzzzbbbbbbbbbbbbbbbbbbbbjjjjjjjjjjjjjjjjjjjjjjjj", "output": "YES" }, { "input": "100 80\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm", "output": "YES" }, { "input": "100 10\nbbttthhhhiiiiiiijjjjjvvvvpppssssseeeeeeewwwwgggkkkkkkkkmmmddddduuuzzzzllllnnnnnxxyyyffffccraaaaooooq", "output": "YES" }, { "input": "100 20\nssssssssssbbbbbbbhhhhhhhyyyyyyyzzzzzzzzzzzzcccccxxxxxxxxxxddddmmmmmmmeeeeeeejjjjjjjjjwwwwwwwtttttttt", "output": "YES" }, { "input": "1 2\na", "output": "YES" }, { "input": "3 1\nabb", "output": "NO" }, { "input": "2 1\naa", "output": "NO" }, { "input": "2 1\nab", "output": "YES" }, { "input": "6 2\naaaaaa", "output": "NO" }, { "input": "8 4\naaaaaaaa", "output": "NO" }, { "input": "4 2\naaaa", "output": "NO" }, { "input": "4 3\naaaa", "output": "NO" }, { "input": "1 3\na", "output": "YES" }, { "input": "4 3\nzzzz", "output": "NO" }, { "input": "4 1\naaaa", "output": "NO" }, { "input": "3 4\nabc", "output": "YES" }, { "input": "2 5\nab", "output": "YES" }, { "input": "2 4\nab", "output": "YES" }, { "input": "1 10\na", "output": "YES" }, { "input": "5 2\nzzzzz", "output": "NO" }, { "input": "53 26\naaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbbbbbbb", "output": "NO" }, { "input": "4 1\nabab", "output": "NO" }, { "input": "4 1\nabcb", "output": "NO" }, { "input": "4 2\nabbb", "output": "NO" }, { "input": "5 2\nabccc", "output": "NO" }, { "input": "2 3\nab", "output": "YES" }, { "input": "4 3\nbbbs", "output": "YES" }, { "input": "10 2\nazzzzzzzzz", "output": "NO" }, { "input": "1 2\nb", "output": "YES" }, { "input": "1 3\nb", "output": "YES" }, { "input": "4 5\nabcd", "output": "YES" }, { "input": "4 6\naabb", "output": "YES" }, { "input": "5 2\naaaab", "output": "NO" }, { "input": "3 5\naaa", "output": "YES" }, { "input": "5 3\nazzzz", "output": "NO" }, { "input": "4 100\naabb", "output": "YES" }, { "input": "3 10\naaa", "output": "YES" }, { "input": "3 4\naaa", "output": "YES" }, { "input": "12 5\naaaaabbbbbbb", "output": "NO" }, { "input": "5 2\naabbb", "output": "NO" }, { "input": "10 5\nzzzzzzzzzz", "output": "NO" }, { "input": "2 4\naa", "output": "YES" }, { "input": "1 5\na", "output": "YES" }, { "input": "10 5\naaaaaaaaaa", "output": "NO" }, { "input": "6 3\naaaaaa", "output": "NO" }, { "input": "7 1\nabcdeee", "output": "NO" }, { "input": "18 3\naaaaaabbbbbbcccccc", "output": "NO" }, { "input": "8 2\naabbccdd", "output": "YES" }, { "input": "4 2\nzzzz", "output": "NO" }, { "input": "4 2\nabaa", "output": "NO" }, { "input": "3 2\naaa", "output": "NO" }, { "input": "3 1\nzzz", "output": "NO" }, { "input": "5 4\nzzzzz", "output": "NO" }, { "input": "6 2\naabbbc", "output": "NO" }, { "input": "3 6\naaa", "output": "YES" }, { "input": "2 1\nzz", "output": "NO" }, { "input": "10 3\naaaeeeeeee", "output": "NO" }, { "input": "4 5\naabb", "output": "YES" }, { "input": "3 1\naaa", "output": "NO" }, { "input": "5 2\naazzz", "output": "NO" }, { "input": "6 2\nabbbbc", "output": "NO" }, { "input": "4 2\nxxxx", "output": "NO" }, { "input": "6 3\nzzzzzz", "output": "NO" }, { "input": "3 2\nabb", "output": "YES" }, { "input": "3 2\nzzz", "output": "NO" }, { "input": "6 5\nzzzzzz", "output": "NO" }, { "input": "6 3\nbcaaaa", "output": "NO" }, { "input": "100 100\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "YES" }, { "input": "3 6\nabc", "output": "YES" } ]
1,606,027,679
2,147,483,647
Python 3
OK
TESTS
114
108
0
n, k = map(int, input().split()) balloons_color = sorted(input()) dic = {} for x in balloons_color: if x in dic: dic[x] += 1 else: dic[x] = 1 if int(max(dic.values())) > k: print("NO") else: print("YES")
Title: Generous Kefa Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Kefa found *n* baloons. For convenience, we denote color of *i*-th baloon as *s**i* β€” lowercase letter of the Latin alphabet. Also Kefa has *k* friends. Friend will be upset, If he get two baloons of the same color. Kefa want to give out all baloons to his friends. Help Kefa to find out, can he give out all his baloons, such that no one of his friens will be upset β€” print Β«YESΒ», if he can, and Β«NOΒ», otherwise. Note, that Kefa's friend will not upset, if he doesn't get baloons at all. Input Specification: The first line contains two integers *n* and *k* (1<=≀<=*n*,<=*k*<=≀<=100) β€” the number of baloons and friends. Next line contains string *s* β€” colors of baloons. Output Specification: Answer to the task β€” Β«YESΒ» or Β«NOΒ» in a single line. You can choose the case (lower or upper) for each letter arbitrary. Demo Input: ['4 2\naabb\n', '6 3\naacaab\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample Kefa can give 1-st and 3-rd baloon to the first friend, and 2-nd and 4-th to the second. In the second sample Kefa needs to give to all his friends baloons of color a, but one baloon will stay, thats why answer is Β«NOΒ».
```python n, k = map(int, input().split()) balloons_color = sorted(input()) dic = {} for x in balloons_color: if x in dic: dic[x] += 1 else: dic[x] = 1 if int(max(dic.values())) > k: print("NO") else: print("YES") ```
3
127
A
Wasted Time
PROGRAMMING
900
[ "geometry" ]
null
null
Mr. Scrooge, a very busy man, decided to count the time he wastes on all sorts of useless stuff to evaluate the lost profit. He has already counted the time he wastes sleeping and eating. And now Mr. Scrooge wants to count the time he has wasted signing papers. Mr. Scrooge's signature can be represented as a polyline *A*1*A*2... *A**n*. Scrooge signs like that: first it places a pen at the point *A*1, then draws a segment from point *A*1 to point *A*2, then he draws a segment from point *A*2 to point *A*3 and so on to point *A**n*, where he stops signing and takes the pen off the paper. At that the resulting line can intersect with itself and partially repeat itself but Scrooge pays no attention to it and never changes his signing style. As Scrooge makes the signature, he never takes the pen off the paper and his writing speed is constant β€” 50 millimeters per second. Scrooge signed exactly *k* papers throughout his life and all those signatures look the same. Find the total time Scrooge wasted signing the papers.
The first line contains two integers *n* and *k* (2<=≀<=*n*<=≀<=100, 1<=≀<=*k*<=≀<=1000). Each of the following *n* lines contains the coordinates of the polyline's endpoints. The *i*-th one contains coordinates of the point *A**i* β€” integers *x**i* and *y**i*, separated by a space. All points *A**i* are different. The absolute value of all coordinates does not exceed 20. The coordinates are measured in millimeters.
Print one real number β€” the total time Scrooges wastes on signing the papers in seconds. The absolute or relative error should not exceed 10<=-<=6.
[ "2 1\n0 0\n10 0\n", "5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0\n", "6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0\n" ]
[ "0.200000000", "6.032163204", "3.000000000" ]
none
500
[ { "input": "2 1\n0 0\n10 0", "output": "0.200000000" }, { "input": "5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0", "output": "6.032163204" }, { "input": "6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0", "output": "3.000000000" }, { "input": "10 95\n-20 -5\n2 -8\n14 13\n10 3\n17 11\n13 -12\n-6 11\n14 -15\n-13 14\n19 8", "output": "429.309294877" }, { "input": "30 1000\n4 -13\n14 13\n-14 -16\n-9 18\n17 11\n2 -8\n2 15\n8 -1\n-9 13\n8 -12\n-2 20\n11 -12\n19 8\n9 -15\n-20 -5\n-18 20\n-13 14\n-12 -17\n-4 3\n13 -12\n11 -10\n18 7\n-6 11\n10 13\n10 3\n6 -14\n-1 10\n14 -15\n2 11\n-8 10", "output": "13629.282573522" }, { "input": "2 1\n-20 -10\n-10 -6", "output": "0.215406592" }, { "input": "2 13\n13 -10\n-3 -2", "output": "4.651021393" }, { "input": "2 21\n13 8\n14 10", "output": "0.939148551" }, { "input": "2 75\n-3 12\n1 12", "output": "6.000000000" }, { "input": "2 466\n10 16\n-6 -3", "output": "231.503997374" }, { "input": "2 999\n6 16\n-17 -14", "output": "755.286284531" }, { "input": "2 1000\n-17 -14\n-14 -8", "output": "134.164078650" }, { "input": "3 384\n-4 -19\n-17 -2\n3 4", "output": "324.722285390" }, { "input": "5 566\n-11 8\n2 -7\n7 0\n-7 -9\n-7 5", "output": "668.956254495" }, { "input": "7 495\n-10 -13\n-9 -5\n4 9\n8 13\n-4 2\n2 10\n-18 15", "output": "789.212495576" }, { "input": "10 958\n7 13\n20 19\n12 -7\n10 -10\n-13 -15\n-10 -7\n20 -5\n-11 19\n-7 3\n-4 18", "output": "3415.618464093" }, { "input": "13 445\n-15 16\n-8 -14\n8 7\n4 15\n8 -13\n15 -11\n-12 -4\n2 -13\n-5 0\n-20 -14\n-8 -7\n-10 -18\n18 -5", "output": "2113.552527680" }, { "input": "18 388\n11 -8\n13 10\n18 -17\n-15 3\n-13 -15\n20 -7\n1 -10\n-13 -12\n-12 -15\n-17 -8\n1 -2\n3 -20\n-8 -9\n15 -13\n-19 -6\n17 3\n-17 2\n6 6", "output": "2999.497312668" }, { "input": "25 258\n-5 -3\n-18 -14\n12 3\n6 11\n4 2\n-19 -3\n19 -7\n-15 19\n-19 -12\n-11 -10\n-5 17\n10 15\n-4 1\n-3 -20\n6 16\n18 -19\n11 -19\n-17 10\n-17 17\n-2 -17\n-3 -9\n18 13\n14 8\n-2 -5\n-11 4", "output": "2797.756635934" }, { "input": "29 848\n11 -10\n-19 1\n18 18\n19 -19\n0 -5\n16 10\n-20 -14\n7 15\n6 8\n-15 -16\n9 3\n16 -20\n-12 12\n18 -1\n-11 14\n18 10\n11 -20\n-20 -16\n-1 11\n13 10\n-6 13\n-7 -10\n-11 -10\n-10 3\n15 -13\n-4 11\n-13 -11\n-11 -17\n11 -5", "output": "12766.080247922" }, { "input": "36 3\n-11 20\n-11 13\n-17 9\n15 9\n-6 9\n-1 11\n12 -11\n16 -10\n-20 7\n-18 6\n-15 -2\n20 -20\n16 4\n-20 -8\n-12 -15\n-13 -6\n-9 -4\n0 -10\n8 -1\n1 4\n5 8\n8 -15\n16 -12\n19 1\n0 -4\n13 -4\n17 -13\n-7 11\n14 9\n-14 -9\n5 -8\n11 -8\n-17 -5\n1 -3\n-16 -17\n2 -3", "output": "36.467924851" }, { "input": "48 447\n14 9\n9 -17\n-17 11\n-14 14\n19 -8\n-14 -17\n-7 10\n-6 -11\n-9 -19\n19 10\n-4 2\n-5 16\n20 9\n-10 20\n-7 -17\n14 -16\n-2 -10\n-18 -17\n14 12\n-6 -19\n5 -18\n-3 2\n-3 10\n-5 5\n13 -12\n10 -18\n10 -12\n-2 4\n7 -15\n-5 -5\n11 14\n11 10\n-6 -9\n13 -4\n13 9\n6 12\n-13 17\n-9 -12\n14 -19\n10 12\n-15 8\n-1 -11\n19 8\n11 20\n-9 -3\n16 1\n-14 19\n8 -4", "output": "9495.010556306" }, { "input": "50 284\n-17 -13\n7 12\n-13 0\n13 1\n14 6\n14 -9\n-5 -1\n0 -10\n12 -3\n-14 6\n-8 10\n-16 17\n0 -1\n4 -9\n2 6\n1 8\n-8 -14\n3 9\n1 -15\n-4 -19\n-7 -20\n18 10\n3 -11\n10 16\n2 -6\n-9 19\n-3 -1\n20 9\n-12 -5\n-10 -2\n16 -7\n-16 -18\n-2 17\n2 8\n7 -15\n4 1\n6 -17\n19 9\n-10 -20\n5 2\n10 -2\n3 7\n20 0\n8 -14\n-16 -1\n-20 7\n20 -19\n17 18\n-11 -18\n-16 14", "output": "6087.366930474" }, { "input": "57 373\n18 3\n-4 -1\n18 5\n-7 -15\n-6 -10\n-19 1\n20 15\n15 4\n-1 -2\n13 -14\n0 12\n10 3\n-16 -17\n-14 -9\n-11 -10\n17 19\n-2 6\n-12 -15\n10 20\n16 7\n9 -1\n4 13\n8 -2\n-1 -16\n-3 8\n14 11\n-12 3\n-5 -6\n3 4\n5 7\n-9 9\n11 4\n-19 10\n-7 4\n-20 -12\n10 16\n13 11\n13 -11\n7 -1\n17 18\n-19 7\n14 13\n5 -1\n-7 6\n-1 -6\n6 20\n-16 2\n4 17\n16 -11\n-4 -20\n19 -18\n17 16\n-14 -8\n3 2\n-6 -16\n10 -10\n-13 -11", "output": "8929.162822862" }, { "input": "60 662\n15 17\n-2 -19\n-4 -17\n10 0\n15 10\n-8 -14\n14 9\n-15 20\n6 5\n-9 0\n-13 20\n13 -2\n10 9\n7 5\n4 18\n-10 1\n6 -15\n15 -16\n6 13\n4 -6\n2 5\n18 19\n8 3\n-7 14\n-12 -20\n14 19\n-15 0\n-2 -12\n9 18\n14 4\n2 -20\n3 0\n20 9\n-5 11\n-11 1\n2 -19\n-14 -4\n18 6\n16 16\n15 3\n-1 -5\n9 20\n12 -8\n-1 10\n-4 -9\n3 6\n3 -12\n14 -10\n-8 10\n-18 6\n14 -2\n-14 -12\n-10 -7\n10 -6\n14 1\n6 14\n15 19\n4 14\n3 -14\n-9 -13", "output": "16314.207721932" }, { "input": "61 764\n-9 15\n11 -8\n-6 -7\n-13 -19\n16 -16\n-5 -1\n20 -19\n-14 -1\n-11 4\n7 -2\n-3 2\n-14 -17\n15 18\n20 15\n-13 -2\n15 8\n3 13\n19 -10\n2 -6\n15 -3\n-12 11\n4 -16\n-14 20\n0 2\n11 -7\n-6 -11\n16 7\n8 -3\n16 -10\n-3 9\n9 5\n4 -1\n-17 9\n14 -4\n8 6\n-19 12\n10 -17\n-5 7\n7 -3\n5 3\n6 -14\n9 9\n-16 -19\n11 -16\n-17 15\n8 5\n16 -19\n-7 10\n14 -15\n15 19\n-20 -16\n6 -2\n-4 6\n7 -15\n1 -8\n20 -17\n3 7\n10 12\n10 -11\n-19 10\n0 -11", "output": "22153.369189802" } ]
1,556,536,017
2,147,483,647
Python 3
OK
TESTS
42
216
0
from math import sqrt X, Last, SUM = list(map(int, input().split())), list(map(int, input().split())), 0 for i in range(X[0] - 1): Temp = list(map(int, input().split())) SUM += sqrt((Last[0] - Temp[0]) ** 2 + (Last[1] - Temp[1]) ** 2) Last = Temp print((SUM * X[1]) / 50)
Title: Wasted Time Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mr. Scrooge, a very busy man, decided to count the time he wastes on all sorts of useless stuff to evaluate the lost profit. He has already counted the time he wastes sleeping and eating. And now Mr. Scrooge wants to count the time he has wasted signing papers. Mr. Scrooge's signature can be represented as a polyline *A*1*A*2... *A**n*. Scrooge signs like that: first it places a pen at the point *A*1, then draws a segment from point *A*1 to point *A*2, then he draws a segment from point *A*2 to point *A*3 and so on to point *A**n*, where he stops signing and takes the pen off the paper. At that the resulting line can intersect with itself and partially repeat itself but Scrooge pays no attention to it and never changes his signing style. As Scrooge makes the signature, he never takes the pen off the paper and his writing speed is constant β€” 50 millimeters per second. Scrooge signed exactly *k* papers throughout his life and all those signatures look the same. Find the total time Scrooge wasted signing the papers. Input Specification: The first line contains two integers *n* and *k* (2<=≀<=*n*<=≀<=100, 1<=≀<=*k*<=≀<=1000). Each of the following *n* lines contains the coordinates of the polyline's endpoints. The *i*-th one contains coordinates of the point *A**i* β€” integers *x**i* and *y**i*, separated by a space. All points *A**i* are different. The absolute value of all coordinates does not exceed 20. The coordinates are measured in millimeters. Output Specification: Print one real number β€” the total time Scrooges wastes on signing the papers in seconds. The absolute or relative error should not exceed 10<=-<=6. Demo Input: ['2 1\n0 0\n10 0\n', '5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0\n', '6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0\n'] Demo Output: ['0.200000000', '6.032163204', '3.000000000'] Note: none
```python from math import sqrt X, Last, SUM = list(map(int, input().split())), list(map(int, input().split())), 0 for i in range(X[0] - 1): Temp = list(map(int, input().split())) SUM += sqrt((Last[0] - Temp[0]) ** 2 + (Last[1] - Temp[1]) ** 2) Last = Temp print((SUM * X[1]) / 50) ```
3
146
A
Lucky Ticket
PROGRAMMING
800
[ "implementation" ]
null
null
Petya loves lucky numbers very much. Everybody knows that lucky numbers are positive integers whose decimal record contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. Petya loves tickets very much. As we know, each ticket has a number that is a positive integer. Its length equals *n* (*n* is always even). Petya calls a ticket lucky if the ticket's number is a lucky number and the sum of digits in the first half (the sum of the first *n*<=/<=2 digits) equals the sum of digits in the second half (the sum of the last *n*<=/<=2 digits). Check if the given ticket is lucky.
The first line contains an even integer *n* (2<=≀<=*n*<=≀<=50) β€” the length of the ticket number that needs to be checked. The second line contains an integer whose length equals exactly *n* β€” the ticket number. The number may contain leading zeros.
On the first line print "YES" if the given ticket number is lucky. Otherwise, print "NO" (without the quotes).
[ "2\n47\n", "4\n4738\n", "4\n4774\n" ]
[ "NO\n", "NO\n", "YES\n" ]
In the first sample the sum of digits in the first half does not equal the sum of digits in the second half (4 ≠ 7). In the second sample the ticket number is not the lucky number.
500
[ { "input": "2\n47", "output": "NO" }, { "input": "4\n4738", "output": "NO" }, { "input": "4\n4774", "output": "YES" }, { "input": "4\n4570", "output": "NO" }, { "input": "6\n477477", "output": "YES" }, { "input": "6\n777777", "output": "YES" }, { "input": "20\n44444444444444444444", "output": "YES" }, { "input": "2\n44", "output": "YES" }, { "input": "10\n4745474547", "output": "NO" }, { "input": "14\n77770004444444", "output": "NO" }, { "input": "10\n4747777744", "output": "YES" }, { "input": "10\n1234567890", "output": "NO" }, { "input": "50\n44444444444444444444444444444444444444444444444444", "output": "YES" }, { "input": "50\n44444444444444444444444444444444444444444444444447", "output": "NO" }, { "input": "50\n74444444444444444444444444444444444444444444444444", "output": "NO" }, { "input": "50\n07777777777777777777777777777777777777777777777770", "output": "NO" }, { "input": "50\n77777777777777777777777777777777777777777777777777", "output": "YES" }, { "input": "50\n44747747774474747747747447777447774747447477444474", "output": "YES" }, { "input": "48\n447474444777444474747747744774447444747474774474", "output": "YES" }, { "input": "32\n74474474777444474444747774474774", "output": "YES" }, { "input": "40\n4747777444447747777447447747447474774777", "output": "YES" }, { "input": "10\n4477477444", "output": "YES" }, { "input": "18\n447747474447744747", "output": "YES" }, { "input": "26\n44747744444774744774474447", "output": "YES" }, { "input": "50\n44707747774474747747747447777447774747447477444474", "output": "NO" }, { "input": "40\n4747777444447737777447447747447474774777", "output": "NO" }, { "input": "36\n764477744747444444447747747474744444", "output": "NO" }, { "input": "22\n4477407474777477744447", "output": "NO" }, { "input": "32\n74274474777444474444747774474774", "output": "NO" }, { "input": "16\n4744447974444747", "output": "NO" }, { "input": "2\n11", "output": "NO" }, { "input": "2\n22", "output": "NO" }, { "input": "2\n33", "output": "NO" }, { "input": "2\n74", "output": "NO" }, { "input": "2\n55", "output": "NO" }, { "input": "2\n66", "output": "NO" }, { "input": "2\n77", "output": "YES" }, { "input": "2\n88", "output": "NO" }, { "input": "2\n99", "output": "NO" }, { "input": "4\n4004", "output": "NO" }, { "input": "14\n00077774444444", "output": "NO" }, { "input": "6\n004444", "output": "NO" }, { "input": "4\n0044", "output": "NO" }, { "input": "14\n77771114444444", "output": "NO" }, { "input": "14\n44444447777000", "output": "NO" }, { "input": "6\n004774", "output": "NO" } ]
1,657,713,521
2,147,483,647
PyPy 3-64
OK
TESTS
46
154
0
n=int(input()) a=input() k=0 for i in range(n): if a[i]!='4' and a[i]!='7': k+=1 if k!=0: print('NO') else: k=int(n/2) b=a[:k] c=a[-k:] s=0 s1=0 for i in range(k): s+=int(b[i]) s1+=int(c[i]) if s==s1: print('YES') else: print("NO")
Title: Lucky Ticket Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petya loves lucky numbers very much. Everybody knows that lucky numbers are positive integers whose decimal record contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. Petya loves tickets very much. As we know, each ticket has a number that is a positive integer. Its length equals *n* (*n* is always even). Petya calls a ticket lucky if the ticket's number is a lucky number and the sum of digits in the first half (the sum of the first *n*<=/<=2 digits) equals the sum of digits in the second half (the sum of the last *n*<=/<=2 digits). Check if the given ticket is lucky. Input Specification: The first line contains an even integer *n* (2<=≀<=*n*<=≀<=50) β€” the length of the ticket number that needs to be checked. The second line contains an integer whose length equals exactly *n* β€” the ticket number. The number may contain leading zeros. Output Specification: On the first line print "YES" if the given ticket number is lucky. Otherwise, print "NO" (without the quotes). Demo Input: ['2\n47\n', '4\n4738\n', '4\n4774\n'] Demo Output: ['NO\n', 'NO\n', 'YES\n'] Note: In the first sample the sum of digits in the first half does not equal the sum of digits in the second half (4 ≠ 7). In the second sample the ticket number is not the lucky number.
```python n=int(input()) a=input() k=0 for i in range(n): if a[i]!='4' and a[i]!='7': k+=1 if k!=0: print('NO') else: k=int(n/2) b=a[:k] c=a[-k:] s=0 s1=0 for i in range(k): s+=int(b[i]) s1+=int(c[i]) if s==s1: print('YES') else: print("NO") ```
3
50
A
Domino piling
PROGRAMMING
800
[ "greedy", "math" ]
A. Domino piling
2
256
You are given a rectangular board of *M*<=Γ—<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=Γ—<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions.
In a single line you are given two integers *M* and *N* β€” board sizes in squares (1<=≀<=*M*<=≀<=*N*<=≀<=16).
Output one number β€” the maximal number of dominoes, which can be placed.
[ "2 4\n", "3 3\n" ]
[ "4\n", "4\n" ]
none
500
[ { "input": "2 4", "output": "4" }, { "input": "3 3", "output": "4" }, { "input": "1 5", "output": "2" }, { "input": "1 6", "output": "3" }, { "input": "1 15", "output": "7" }, { "input": "1 16", "output": "8" }, { "input": "2 5", "output": "5" }, { "input": "2 6", "output": "6" }, { "input": "2 7", "output": "7" }, { "input": "2 14", "output": "14" }, { "input": "2 15", "output": "15" }, { "input": "1 4", "output": "2" }, { "input": "2 16", "output": "16" }, { "input": "3 5", "output": "7" }, { "input": "3 6", "output": "9" }, { "input": "3 10", "output": "15" }, { "input": "3 14", "output": "21" }, { "input": "3 15", "output": "22" }, { "input": "3 16", "output": "24" }, { "input": "5 7", "output": "17" }, { "input": "16 16", "output": "128" }, { "input": "15 16", "output": "120" }, { "input": "2 3", "output": "3" }, { "input": "15 15", "output": "112" }, { "input": "14 16", "output": "112" }, { "input": "11 13", "output": "71" }, { "input": "5 16", "output": "40" }, { "input": "8 15", "output": "60" }, { "input": "2 2", "output": "2" }, { "input": "3 4", "output": "6" }, { "input": "4 4", "output": "8" }, { "input": "1 1", "output": "0" }, { "input": "1 2", "output": "1" }, { "input": "1 3", "output": "1" }, { "input": "14 15", "output": "105" } ]
1,657,457,033
2,147,483,647
Python 3
OK
TESTS
35
92
0
a, b = input().split() a, b = int(a), int(b) print((a*b)//2)
Title: Domino piling Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: You are given a rectangular board of *M*<=Γ—<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=Γ—<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions. Input Specification: In a single line you are given two integers *M* and *N* β€” board sizes in squares (1<=≀<=*M*<=≀<=*N*<=≀<=16). Output Specification: Output one number β€” the maximal number of dominoes, which can be placed. Demo Input: ['2 4\n', '3 3\n'] Demo Output: ['4\n', '4\n'] Note: none
```python a, b = input().split() a, b = int(a), int(b) print((a*b)//2) ```
3.977
25
A
IQ test
PROGRAMMING
1,300
[ "brute force" ]
A. IQ test
2
256
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob β€” to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
The first line contains integer *n* (3<=≀<=*n*<=≀<=100) β€” amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
[ "5\n2 4 7 8 10\n", "4\n1 2 1 1\n" ]
[ "3\n", "2\n" ]
none
0
[ { "input": "5\n2 4 7 8 10", "output": "3" }, { "input": "4\n1 2 1 1", "output": "2" }, { "input": "3\n1 2 2", "output": "1" }, { "input": "3\n100 99 100", "output": "2" }, { "input": "3\n5 3 2", "output": "3" }, { "input": "4\n43 28 1 91", "output": "2" }, { "input": "4\n75 13 94 77", "output": "3" }, { "input": "4\n97 8 27 3", "output": "2" }, { "input": "10\n95 51 12 91 85 3 1 31 25 7", "output": "3" }, { "input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46", "output": "4" }, { "input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36", "output": "26" }, { "input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83", "output": "48" }, { "input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25", "output": "1" }, { "input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46", "output": "25" }, { "input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73", "output": "13" }, { "input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76", "output": "99" }, { "input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14", "output": "1" }, { "input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22", "output": "93" }, { "input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23", "output": "1" }, { "input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98", "output": "1" }, { "input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94", "output": "93" }, { "input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29", "output": "32" }, { "input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47", "output": "26" }, { "input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72", "output": "56" }, { "input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86", "output": "97" }, { "input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42", "output": "79" }, { "input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52", "output": "25" }, { "input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86", "output": "78" }, { "input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68", "output": "70" }, { "input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81", "output": "39" }, { "input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83", "output": "88" }, { "input": "3\n100 100 1", "output": "3" } ]
1,662,294,940
2,147,483,647
PyPy 3-64
OK
TESTS
32
124
0
x=input() y=list(map(int,input().split())) a=[] b=[] for i in y: if i%2==0: a.append(i) else: b.append(i) if len(a)<len(b): print(y.index(a[0])+1) else: print(y.index(b[0])+1)
Title: IQ test Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob β€” to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness. Input Specification: The first line contains integer *n* (3<=≀<=*n*<=≀<=100) β€” amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness. Output Specification: Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order. Demo Input: ['5\n2 4 7 8 10\n', '4\n1 2 1 1\n'] Demo Output: ['3\n', '2\n'] Note: none
```python x=input() y=list(map(int,input().split())) a=[] b=[] for i in y: if i%2==0: a.append(i) else: b.append(i) if len(a)<len(b): print(y.index(a[0])+1) else: print(y.index(b[0])+1) ```
3.969
961
B
Lecture Sleep
PROGRAMMING
1,200
[ "data structures", "dp", "implementation", "two pointers" ]
null
null
Your friend Mishka and you attend a calculus lecture. Lecture lasts *n* minutes. Lecturer tells *a**i* theorems during the *i*-th minute. Mishka is really interested in calculus, though it is so hard to stay awake for all the time of lecture. You are given an array *t* of Mishka's behavior. If Mishka is asleep during the *i*-th minute of the lecture then *t**i* will be equal to 0, otherwise it will be equal to 1. When Mishka is awake he writes down all the theorems he is being told β€” *a**i* during the *i*-th minute. Otherwise he writes nothing. You know some secret technique to keep Mishka awake for *k* minutes straight. However you can use it only once. You can start using it at the beginning of any minute between 1 and *n*<=-<=*k*<=+<=1. If you use it on some minute *i* then Mishka will be awake during minutes *j* such that and will write down all the theorems lecturer tells. You task is to calculate the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up.
The first line of the input contains two integer numbers *n* and *k* (1<=≀<=*k*<=≀<=*n*<=≀<=105) β€” the duration of the lecture in minutes and the number of minutes you can keep Mishka awake. The second line of the input contains *n* integer numbers *a*1,<=*a*2,<=... *a**n* (1<=≀<=*a**i*<=≀<=104) β€” the number of theorems lecturer tells during the *i*-th minute. The third line of the input contains *n* integer numbers *t*1,<=*t*2,<=... *t**n* (0<=≀<=*t**i*<=≀<=1) β€” type of Mishka's behavior at the *i*-th minute of the lecture.
Print only one integer β€” the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up.
[ "6 3\n1 3 5 2 5 4\n1 1 0 1 0 0\n" ]
[ "16\n" ]
In the sample case the better way is to use the secret technique at the beginning of the third minute. Then the number of theorems Mishka will be able to write down will be equal to 16.
0
[ { "input": "6 3\n1 3 5 2 5 4\n1 1 0 1 0 0", "output": "16" }, { "input": "5 3\n1 9999 10000 10000 10000\n0 0 0 0 0", "output": "30000" }, { "input": "3 3\n10 10 10\n1 1 0", "output": "30" }, { "input": "1 1\n423\n0", "output": "423" }, { "input": "6 6\n1 3 5 2 5 4\n1 1 0 1 0 0", "output": "20" }, { "input": "5 2\n1 2 3 4 20\n0 0 0 1 0", "output": "24" }, { "input": "3 1\n1 2 3\n0 0 1", "output": "5" }, { "input": "4 2\n4 5 6 8\n1 0 1 0", "output": "18" }, { "input": "6 3\n1 3 5 2 1 15\n1 1 0 1 0 0", "output": "22" }, { "input": "5 5\n1 2 3 4 5\n1 1 1 0 1", "output": "15" }, { "input": "3 3\n3 3 3\n1 0 1", "output": "9" }, { "input": "5 5\n500 44 3 4 50\n1 0 0 0 0", "output": "601" }, { "input": "2 2\n3 2\n1 0", "output": "5" }, { "input": "7 6\n4 9 1 7 1 8 4\n0 0 0 1 0 1 0", "output": "30" }, { "input": "4 3\n6 5 9 6\n1 1 0 1", "output": "26" }, { "input": "2 1\n3 2\n0 0", "output": "3" }, { "input": "1 1\n10\n0", "output": "10" }, { "input": "2 1\n3 2\n1 0", "output": "5" }, { "input": "4 2\n3 6 7 2\n0 0 1 1", "output": "18" }, { "input": "10 5\n3 5 9 2 5 9 3 8 8 1\n0 1 1 1 0 1 0 0 0 0", "output": "49" }, { "input": "10 4\n9 5 6 4 3 9 5 1 10 7\n0 0 0 0 0 0 1 0 0 1", "output": "36" }, { "input": "9 8\n3 3 7 7 1 9 10 7 1\n1 1 1 1 1 1 1 1 1", "output": "48" }, { "input": "2 1\n3 4\n0 0", "output": "4" }, { "input": "2 1\n3 2\n0 1", "output": "5" }, { "input": "10 1\n6 6 8 7 6 6 3 2 5 6\n0 0 1 0 0 1 0 1 1 1", "output": "34" }, { "input": "3 2\n10 10 6\n0 0 0", "output": "20" }, { "input": "6 3\n1 3 5 2 5 4\n1 1 1 1 1 1", "output": "20" }, { "input": "10 5\n1 1 1 1 1 1 1 1 10000 1\n1 1 1 1 1 1 1 1 0 1", "output": "10009" } ]
1,662,396,574
2,147,483,647
Python 3
OK
TESTS
37
218
7,372,800
from collections import deque,Counter from math import * import sys import random from bisect import * from functools import reduce from sys import stdin import copy n,k = map(int,input().split()) arr = list(map(int,input().split())) sleep = list(map(int,input().split())) pre = [0 for i in range(n+1)] one = 0 for i in range(n): if sleep[i] == 1: one+=arr[i] arr[i] = 0 for i in range(0,n): pre[i] = arr[i]+pre[i-1] start = None m = 0 for i in range(n): if sleep[i] == 0: x = n-1 if (i+k-1)>=n else i+k-1 val = (pre[x]-pre[i-1]) if val>m: m = val start = i print(m+one)
Title: Lecture Sleep Time Limit: None seconds Memory Limit: None megabytes Problem Description: Your friend Mishka and you attend a calculus lecture. Lecture lasts *n* minutes. Lecturer tells *a**i* theorems during the *i*-th minute. Mishka is really interested in calculus, though it is so hard to stay awake for all the time of lecture. You are given an array *t* of Mishka's behavior. If Mishka is asleep during the *i*-th minute of the lecture then *t**i* will be equal to 0, otherwise it will be equal to 1. When Mishka is awake he writes down all the theorems he is being told β€” *a**i* during the *i*-th minute. Otherwise he writes nothing. You know some secret technique to keep Mishka awake for *k* minutes straight. However you can use it only once. You can start using it at the beginning of any minute between 1 and *n*<=-<=*k*<=+<=1. If you use it on some minute *i* then Mishka will be awake during minutes *j* such that and will write down all the theorems lecturer tells. You task is to calculate the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up. Input Specification: The first line of the input contains two integer numbers *n* and *k* (1<=≀<=*k*<=≀<=*n*<=≀<=105) β€” the duration of the lecture in minutes and the number of minutes you can keep Mishka awake. The second line of the input contains *n* integer numbers *a*1,<=*a*2,<=... *a**n* (1<=≀<=*a**i*<=≀<=104) β€” the number of theorems lecturer tells during the *i*-th minute. The third line of the input contains *n* integer numbers *t*1,<=*t*2,<=... *t**n* (0<=≀<=*t**i*<=≀<=1) β€” type of Mishka's behavior at the *i*-th minute of the lecture. Output Specification: Print only one integer β€” the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up. Demo Input: ['6 3\n1 3 5 2 5 4\n1 1 0 1 0 0\n'] Demo Output: ['16\n'] Note: In the sample case the better way is to use the secret technique at the beginning of the third minute. Then the number of theorems Mishka will be able to write down will be equal to 16.
```python from collections import deque,Counter from math import * import sys import random from bisect import * from functools import reduce from sys import stdin import copy n,k = map(int,input().split()) arr = list(map(int,input().split())) sleep = list(map(int,input().split())) pre = [0 for i in range(n+1)] one = 0 for i in range(n): if sleep[i] == 1: one+=arr[i] arr[i] = 0 for i in range(0,n): pre[i] = arr[i]+pre[i-1] start = None m = 0 for i in range(n): if sleep[i] == 0: x = n-1 if (i+k-1)>=n else i+k-1 val = (pre[x]-pre[i-1]) if val>m: m = val start = i print(m+one) ```
3
935
A
Fafa and his Company
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
Fafa owns a company that works on huge projects. There are *n* employees in Fafa's company. Whenever the company has a new project to start working on, Fafa has to divide the tasks of this project among all the employees. Fafa finds doing this every time is very tiring for him. So, he decided to choose the best *l* employees in his company as team leaders. Whenever there is a new project, Fafa will divide the tasks among only the team leaders and each team leader will be responsible of some positive number of employees to give them the tasks. To make this process fair for the team leaders, each one of them should be responsible for the same number of employees. Moreover, every employee, who is not a team leader, has to be under the responsibility of exactly one team leader, and no team leader is responsible for another team leader. Given the number of employees *n*, find in how many ways Fafa could choose the number of team leaders *l* in such a way that it is possible to divide employees between them evenly.
The input consists of a single line containing a positive integer *n* (2<=≀<=*n*<=≀<=105) β€” the number of employees in Fafa's company.
Print a single integer representing the answer to the problem.
[ "2\n", "10\n" ]
[ "1\n", "3\n" ]
In the second sample Fafa has 3 ways: - choose only 1 employee as a team leader with 9 employees under his responsibility. - choose 2 employees as team leaders with 4 employees under the responsibility of each of them. - choose 5 employees as team leaders with 1 employee under the responsibility of each of them.
500
[ { "input": "2", "output": "1" }, { "input": "10", "output": "3" }, { "input": "3", "output": "1" }, { "input": "4", "output": "2" }, { "input": "6", "output": "3" }, { "input": "13", "output": "1" }, { "input": "100000", "output": "35" }, { "input": "1024", "output": "10" }, { "input": "99999", "output": "11" }, { "input": "10007", "output": "1" }, { "input": "4096", "output": "12" }, { "input": "65536", "output": "16" }, { "input": "40320", "output": "95" }, { "input": "30030", "output": "63" }, { "input": "161", "output": "3" }, { "input": "1000", "output": "15" }, { "input": "10000", "output": "24" }, { "input": "777", "output": "7" }, { "input": "121", "output": "2" }, { "input": "25", "output": "2" }, { "input": "40000", "output": "34" }, { "input": "99990", "output": "47" }, { "input": "98765", "output": "3" }, { "input": "56789", "output": "3" }, { "input": "13579", "output": "3" }, { "input": "97531", "output": "3" }, { "input": "12345", "output": "7" }, { "input": "54321", "output": "7" }, { "input": "83160", "output": "127" }, { "input": "9", "output": "2" }, { "input": "21", "output": "3" }, { "input": "11", "output": "1" }, { "input": "15", "output": "3" } ]
1,661,408,625
2,147,483,647
Python 3
OK
TESTS
33
62
0
a=int(input()) ans=0 for i in range(1,a): b=a-i if b%i==0: ans+=1 print(ans)
Title: Fafa and his Company Time Limit: None seconds Memory Limit: None megabytes Problem Description: Fafa owns a company that works on huge projects. There are *n* employees in Fafa's company. Whenever the company has a new project to start working on, Fafa has to divide the tasks of this project among all the employees. Fafa finds doing this every time is very tiring for him. So, he decided to choose the best *l* employees in his company as team leaders. Whenever there is a new project, Fafa will divide the tasks among only the team leaders and each team leader will be responsible of some positive number of employees to give them the tasks. To make this process fair for the team leaders, each one of them should be responsible for the same number of employees. Moreover, every employee, who is not a team leader, has to be under the responsibility of exactly one team leader, and no team leader is responsible for another team leader. Given the number of employees *n*, find in how many ways Fafa could choose the number of team leaders *l* in such a way that it is possible to divide employees between them evenly. Input Specification: The input consists of a single line containing a positive integer *n* (2<=≀<=*n*<=≀<=105) β€” the number of employees in Fafa's company. Output Specification: Print a single integer representing the answer to the problem. Demo Input: ['2\n', '10\n'] Demo Output: ['1\n', '3\n'] Note: In the second sample Fafa has 3 ways: - choose only 1 employee as a team leader with 9 employees under his responsibility. - choose 2 employees as team leaders with 4 employees under the responsibility of each of them. - choose 5 employees as team leaders with 1 employee under the responsibility of each of them.
```python a=int(input()) ans=0 for i in range(1,a): b=a-i if b%i==0: ans+=1 print(ans) ```
3
785
A
Anton and Polyhedrons
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons: - Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces. All five kinds of polyhedrons are shown on the picture below: Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number!
The first line of the input contains a single integer *n* (1<=≀<=*n*<=≀<=200<=000)Β β€” the number of polyhedrons in Anton's collection. Each of the following *n* lines of the input contains a string *s**i*Β β€” the name of the *i*-th polyhedron in Anton's collection. The string can look like this: - "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron.
Output one numberΒ β€” the total number of faces in all the polyhedrons in Anton's collection.
[ "4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n", "3\nDodecahedron\nOctahedron\nOctahedron\n" ]
[ "42\n", "28\n" ]
In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces.
500
[ { "input": "4\nIcosahedron\nCube\nTetrahedron\nDodecahedron", "output": "42" }, { "input": "3\nDodecahedron\nOctahedron\nOctahedron", "output": "28" }, { "input": "25\nIcosahedron\nOctahedron\nTetrahedron\nDodecahedron\nCube\nIcosahedron\nOctahedron\nCube\nTetrahedron\nIcosahedron\nIcosahedron\nTetrahedron\nOctahedron\nDodecahedron\nIcosahedron\nOctahedron\nIcosahedron\nTetrahedron\nDodecahedron\nTetrahedron\nOctahedron\nCube\nCube\nDodecahedron\nTetrahedron", "output": "256" }, { "input": "1\nTetrahedron", "output": "4" }, { "input": "1\nCube", "output": "6" }, { "input": "1\nOctahedron", "output": "8" }, { "input": "1\nDodecahedron", "output": "12" }, { "input": "1\nIcosahedron", "output": "20" }, { "input": "28\nOctahedron\nDodecahedron\nOctahedron\nOctahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nDodecahedron\nDodecahedron\nCube\nDodecahedron\nCube\nTetrahedron\nCube\nCube\nTetrahedron\nDodecahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nIcosahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron", "output": "340" } ]
1,699,524,634
2,147,483,647
Python 3
OK
TESTS
30
218
0
Tetrahedron=4 Cube=6 Octahedron=8 Dodecahedron=12 Icosahedron=20 n=int(input()) r=0 for i in range(n): s=input() if s=="Tetrahedron": r+=Tetrahedron elif s=="Cube": r+=Cube elif s=="Octahedron": r+=Octahedron elif s=="Dodecahedron": r+=Dodecahedron elif s=="Icosahedron": r+=Icosahedron else: print("Try again.....") print(r)
Title: Anton and Polyhedrons Time Limit: None seconds Memory Limit: None megabytes Problem Description: Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons: - Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces. All five kinds of polyhedrons are shown on the picture below: Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number! Input Specification: The first line of the input contains a single integer *n* (1<=≀<=*n*<=≀<=200<=000)Β β€” the number of polyhedrons in Anton's collection. Each of the following *n* lines of the input contains a string *s**i*Β β€” the name of the *i*-th polyhedron in Anton's collection. The string can look like this: - "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron. Output Specification: Output one numberΒ β€” the total number of faces in all the polyhedrons in Anton's collection. Demo Input: ['4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n', '3\nDodecahedron\nOctahedron\nOctahedron\n'] Demo Output: ['42\n', '28\n'] Note: In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces.
```python Tetrahedron=4 Cube=6 Octahedron=8 Dodecahedron=12 Icosahedron=20 n=int(input()) r=0 for i in range(n): s=input() if s=="Tetrahedron": r+=Tetrahedron elif s=="Cube": r+=Cube elif s=="Octahedron": r+=Octahedron elif s=="Dodecahedron": r+=Dodecahedron elif s=="Icosahedron": r+=Icosahedron else: print("Try again.....") print(r) ```
3
867
A
Between the Offices
PROGRAMMING
800
[ "implementation" ]
null
null
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane. You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
The first line of input contains single integer *n* (2<=≀<=*n*<=≀<=100)Β β€” the number of days. The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise. You can print each letter in any case (upper or lower).
[ "4\nFSSF\n", "2\nSF\n", "10\nFFFFFFFFFF\n", "10\nSSFFSFFSFF\n" ]
[ "NO\n", "YES\n", "NO\n", "YES\n" ]
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO". In the second example you just flew from Seattle to San Francisco, so the answer is "YES". In the third example you stayed the whole period in San Francisco, so the answer is "NO". In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of Ο€ in binary representation. Not very useful information though.
500
[ { "input": "4\nFSSF", "output": "NO" }, { "input": "2\nSF", "output": "YES" }, { "input": "10\nFFFFFFFFFF", "output": "NO" }, { "input": "10\nSSFFSFFSFF", "output": "YES" }, { "input": "20\nSFSFFFFSSFFFFSSSSFSS", "output": "NO" }, { "input": "20\nSSFFFFFSFFFFFFFFFFFF", "output": "YES" }, { "input": "20\nSSFSFSFSFSFSFSFSSFSF", "output": "YES" }, { "input": "20\nSSSSFSFSSFSFSSSSSSFS", "output": "NO" }, { "input": "100\nFFFSFSFSFSSFSFFSSFFFFFSSSSFSSFFFFSFFFFFSFFFSSFSSSFFFFSSFFSSFSFFSSFSSSFSFFSFSFFSFSFFSSFFSFSSSSFSFSFSS", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFSS", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFSFFFFFFFFFSFSSFFFFFFFFFFFFFFFFFFFFFFSFFSFFFFFSFFFFFFFFSFFFFFFFFFFFFFSFFFFFFFFSFFFFFFFSF", "output": "NO" }, { "input": "100\nSFFSSFFFFFFSSFFFSSFSFFFFFSSFFFSFFFFFFSFSSSFSFSFFFFSFSSFFFFFFFFSFFFFFSFFFFFSSFFFSFFSFSFFFFSFFSFFFFFFF", "output": "YES" }, { "input": "100\nFFFFSSSSSFFSSSFFFSFFFFFSFSSFSFFSFFSSFFSSFSFFFFFSFSFSFSFFFFFFFFFSFSFFSFFFFSFSFFFFFFFFFFFFSFSSFFSSSSFF", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFSSFFFFSFSFFFSFSSSFSSSSSFSSSSFFSSFFFSFSFSSFFFSSSFFSFSFSSFSFSSFSFFFSFFFFFSSFSFFFSSSFSSSFFS", "output": "NO" }, { "input": "100\nFFFSSSFSFSSSSFSSFSFFSSSFFSSFSSFFSSFFSFSSSSFFFSFFFSFSFSSSFSSFSFSFSFFSSSSSFSSSFSFSFFSSFSFSSFFSSFSFFSFS", "output": "NO" }, { "input": "100\nFFSSSSFSSSFSSSSFSSSFFSFSSFFSSFSSSFSSSFFSFFSSSSSSSSSSSSFSSFSSSSFSFFFSSFFFFFFSFSFSSSSSSFSSSFSFSSFSSFSS", "output": "NO" }, { "input": "100\nSSSFFFSSSSFFSSSSSFSSSSFSSSFSSSSSFSSSSSSSSFSFFSSSFFSSFSSSSFFSSSSSSFFSSSSFSSSSSSFSSSFSSSSSSSFSSSSFSSSS", "output": "NO" }, { "input": "100\nFSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSSSSSSFSSSSSSSSSSSSSFSSFSSSSSFSSFSSSSSSSSSFFSSSSSFSFSSSFFSSSSSSSSSSSSS", "output": "NO" }, { "input": "100\nSSSSSSSSSSSSSFSSSSSSSSSSSSFSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSFS", "output": "NO" }, { "input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS", "output": "NO" }, { "input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "YES" }, { "input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFSFFFFFFFFFFFSFSFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "YES" }, { "input": "100\nSFFFFFFFFFFFFSSFFFFSFFFFFFFFFFFFFFFFFFFSFFFSSFFFFSFSFFFSFFFFFFFFFFFFFFFSSFFFFFFFFSSFFFFFFFFFFFFFFSFF", "output": "YES" }, { "input": "100\nSFFSSSFFSFSFSFFFFSSFFFFSFFFFFFFFSFSFFFSFFFSFFFSFFFFSFSFFFFFFFSFFFFFFFFFFSFFSSSFFSSFFFFSFFFFSFFFFSFFF", "output": "YES" }, { "input": "100\nSFFFSFFFFSFFFSSFFFSFSFFFSFFFSSFSFFFFFSFFFFFFFFSFSFSFFSFFFSFSSFSFFFSFSFFSSFSFSSSFFFFFFSSFSFFSFFFFFFFF", "output": "YES" }, { "input": "100\nSSSSFFFFSFFFFFFFSFFFFSFSFFFFSSFFFFFFFFFSFFSSFFFFFFSFSFSSFSSSFFFFFFFSFSFFFSSSFFFFFFFSFFFSSFFFFSSFFFSF", "output": "YES" }, { "input": "100\nSSSFSSFFFSFSSSSFSSFSSSSFSSFFFFFSFFSSSSFFSSSFSSSFSSSSFSSSSFSSSSSSSFSFSSFFFSSFFSFFSSSSFSSFFSFSSFSFFFSF", "output": "YES" }, { "input": "100\nSFFSFSSSSSSSFFSSSFSSSSFSFSSFFFSSSSSSFSSSSFSSFSSSFSSSSSSSFSSFSFFFSSFSSFSFSFSSSSSSSSSSSSFFFFSSSSSFSFFF", "output": "YES" }, { "input": "100\nSSSFSFFSFSFFSSSSSFSSSFSSSFFFSSSSSSSSSFSFSFSSSSFSFSSFFFFFSSSSSSSSSSSSSSSSSSSFFSSSSSFSFSSSSFFSSSSFSSSF", "output": "YES" }, { "input": "100\nSSSFSSSSSSSSSSFSSSSFSSSSSSFSSSSSSFSSSSSSSSSSSSSSFSSSFSSSFSSSSSSSSSSSFSSSSSSFSFSSSSFSSSSSSFSSSSSSSSFF", "output": "YES" }, { "input": "100\nSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFFSSSSSSSSSFSSSSSSSSSSSSSSSSSF", "output": "YES" }, { "input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSF", "output": "YES" }, { "input": "2\nSS", "output": "NO" } ]
1,586,533,704
2,147,483,647
PyPy 3
OK
TESTS
34
140
0
n = int(input()) s = str(input()) f=0 sf=0 for i in range(len(s)-1): if s[i] == 'S' and s[i+1] == 'F': f=f+1 elif s[i] == 'F' and s[i+1] == 'S': sf=sf+1 if f>sf: print("YES") else: print("NO")
Title: Between the Offices Time Limit: None seconds Memory Limit: None megabytes Problem Description: As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane. You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not. Input Specification: The first line of input contains single integer *n* (2<=≀<=*n*<=≀<=100)Β β€” the number of days. The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence. Output Specification: Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise. You can print each letter in any case (upper or lower). Demo Input: ['4\nFSSF\n', '2\nSF\n', '10\nFFFFFFFFFF\n', '10\nSSFFSFFSFF\n'] Demo Output: ['NO\n', 'YES\n', 'NO\n', 'YES\n'] Note: In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO". In the second example you just flew from Seattle to San Francisco, so the answer is "YES". In the third example you stayed the whole period in San Francisco, so the answer is "NO". In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of Ο€ in binary representation. Not very useful information though.
```python n = int(input()) s = str(input()) f=0 sf=0 for i in range(len(s)-1): if s[i] == 'S' and s[i+1] == 'F': f=f+1 elif s[i] == 'F' and s[i+1] == 'S': sf=sf+1 if f>sf: print("YES") else: print("NO") ```
3
509
A
Maximum in Table
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
An *n*<=Γ—<=*n* table *a* is defined as follows: - The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1. These conditions define all the values in the table. You are given a number *n*. You need to determine the maximum value in the *n*<=Γ—<=*n* table defined by the rules above.
The only line of input contains a positive integer *n* (1<=≀<=*n*<=≀<=10) β€” the number of rows and columns of the table.
Print a single line containing a positive integer *m* β€” the maximum value in the table.
[ "1\n", "5\n" ]
[ "1", "70" ]
In the second test the rows of the table look as follows:
0
[ { "input": "1", "output": "1" }, { "input": "5", "output": "70" }, { "input": "2", "output": "2" }, { "input": "3", "output": "6" }, { "input": "4", "output": "20" }, { "input": "6", "output": "252" }, { "input": "7", "output": "924" }, { "input": "9", "output": "12870" }, { "input": "10", "output": "48620" }, { "input": "8", "output": "3432" } ]
1,609,072,815
2,147,483,647
PyPy 3
OK
TESTS
10
155
0
n = int(input()) if n == 1: print(n) else: l = [[1] * n] * n for i in range(1, n): for j in range(1, n): l[i][j] = l[i][j - 1] + l[i - 1][j] print(l[n-1][n-1])
Title: Maximum in Table Time Limit: None seconds Memory Limit: None megabytes Problem Description: An *n*<=Γ—<=*n* table *a* is defined as follows: - The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1. These conditions define all the values in the table. You are given a number *n*. You need to determine the maximum value in the *n*<=Γ—<=*n* table defined by the rules above. Input Specification: The only line of input contains a positive integer *n* (1<=≀<=*n*<=≀<=10) β€” the number of rows and columns of the table. Output Specification: Print a single line containing a positive integer *m* β€” the maximum value in the table. Demo Input: ['1\n', '5\n'] Demo Output: ['1', '70'] Note: In the second test the rows of the table look as follows:
```python n = int(input()) if n == 1: print(n) else: l = [[1] * n] * n for i in range(1, n): for j in range(1, n): l[i][j] = l[i][j - 1] + l[i - 1][j] print(l[n-1][n-1]) ```
3
0
none
none
none
0
[ "none" ]
null
null
Some time ago Leonid have known about idempotent functions. Idempotent function defined on a set {1,<=2,<=...,<=*n*} is such function , that for any the formula *g*(*g*(*x*))<==<=*g*(*x*) holds. Let's denote as *f*(*k*)(*x*) the function *f* applied *k* times to the value *x*. More formally, *f*(1)(*x*)<==<=*f*(*x*), *f*(*k*)(*x*)<==<=*f*(*f*(*k*<=-<=1)(*x*)) for each *k*<=&gt;<=1. You are given some function . Your task is to find minimum positive integer *k* such that function *f*(*k*)(*x*) is idempotent.
In the first line of the input there is a single integer *n* (1<=≀<=*n*<=≀<=200) β€” the size of function *f* domain. In the second line follow *f*(1),<=*f*(2),<=...,<=*f*(*n*) (1<=≀<=*f*(*i*)<=≀<=*n* for each 1<=≀<=*i*<=≀<=*n*), the values of a function.
Output minimum *k* such that function *f*(*k*)(*x*) is idempotent.
[ "4\n1 2 2 4\n", "3\n2 3 3\n", "3\n2 3 1\n" ]
[ "1\n", "2\n", "3\n" ]
In the first sample test function *f*(*x*) = *f*<sup class="upper-index">(1)</sup>(*x*) is already idempotent since *f*(*f*(1)) = *f*(1) = 1, *f*(*f*(2)) = *f*(2) = 2, *f*(*f*(3)) = *f*(3) = 2, *f*(*f*(4)) = *f*(4) = 4. In the second sample test: - function *f*(*x*) = *f*<sup class="upper-index">(1)</sup>(*x*) isn't idempotent because *f*(*f*(1)) = 3 but *f*(1) = 2; - function *f*(*x*) = *f*<sup class="upper-index">(2)</sup>(*x*) is idempotent since for any *x* it is true that *f*<sup class="upper-index">(2)</sup>(*x*) = 3, so it is also true that *f*<sup class="upper-index">(2)</sup>(*f*<sup class="upper-index">(2)</sup>(*x*)) = 3. In the third sample test: - function *f*(*x*) = *f*<sup class="upper-index">(1)</sup>(*x*) isn't idempotent because *f*(*f*(1)) = 3 but *f*(1) = 2; - function *f*(*f*(*x*)) = *f*<sup class="upper-index">(2)</sup>(*x*) isn't idempotent because *f*<sup class="upper-index">(2)</sup>(*f*<sup class="upper-index">(2)</sup>(1)) = 2 but *f*<sup class="upper-index">(2)</sup>(1) = 3; - function *f*(*f*(*f*(*x*))) = *f*<sup class="upper-index">(3)</sup>(*x*) is idempotent since it is identity function: *f*<sup class="upper-index">(3)</sup>(*x*) = *x* for any <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/46a8c73444c646004dfde04451775e7af924d108.png" style="max-width: 100.0%;max-height: 100.0%;"/> meaning that the formula *f*<sup class="upper-index">(3)</sup>(*f*<sup class="upper-index">(3)</sup>(*x*)) = *f*<sup class="upper-index">(3)</sup>(*x*) also holds.
0
[ { "input": "4\n1 2 2 4", "output": "1" }, { "input": "3\n2 3 3", "output": "2" }, { "input": "3\n2 3 1", "output": "3" }, { "input": "1\n1", "output": "1" }, { "input": "16\n1 4 13 9 11 16 14 6 5 12 7 8 15 2 3 10", "output": "105" }, { "input": "20\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20", "output": "1" }, { "input": "20\n11 14 2 10 17 5 9 6 18 3 17 7 4 15 17 1 4 14 10 11", "output": "7" }, { "input": "100\n46 7 63 48 75 82 85 90 65 23 36 96 96 29 76 67 26 2 72 76 18 30 48 98 100 61 55 74 18 28 36 89 4 65 94 48 53 19 66 77 91 35 94 97 19 45 82 56 11 23 24 51 62 85 25 11 68 19 57 92 53 31 36 28 70 36 62 78 19 10 12 35 46 74 31 79 15 98 15 80 24 59 98 96 92 1 92 16 13 73 99 100 76 52 52 40 85 54 49 89", "output": "24" }, { "input": "100\n61 41 85 52 22 82 98 25 60 35 67 78 65 69 55 86 34 91 92 36 24 2 26 15 76 99 4 95 79 31 13 16 100 83 21 90 73 32 19 33 77 40 72 62 88 43 84 14 10 9 46 70 23 45 42 96 94 38 97 58 47 93 59 51 57 7 27 74 1 30 64 3 63 49 50 54 5 37 48 11 81 44 12 17 75 71 89 39 56 20 6 8 53 28 80 66 29 87 18 68", "output": "14549535" }, { "input": "2\n1 2", "output": "1" }, { "input": "2\n1 1", "output": "1" }, { "input": "2\n2 2", "output": "1" }, { "input": "2\n2 1", "output": "2" }, { "input": "5\n2 1 2 3 4", "output": "4" }, { "input": "3\n2 1 2", "output": "2" }, { "input": "4\n2 1 2 3", "output": "2" }, { "input": "6\n2 1 2 3 4 5", "output": "4" }, { "input": "4\n2 3 1 1", "output": "3" }, { "input": "5\n2 3 1 1 4", "output": "3" }, { "input": "6\n2 3 1 1 4 5", "output": "3" }, { "input": "7\n2 3 1 1 4 5 6", "output": "6" }, { "input": "8\n2 3 1 1 4 5 6 7", "output": "6" }, { "input": "142\n131 32 130 139 5 11 36 2 39 92 111 91 8 14 65 82 90 72 140 80 26 124 97 15 43 77 58 132 21 68 31 45 6 69 70 79 141 27 125 78 93 88 115 104 17 55 86 28 56 117 121 136 12 59 85 95 74 18 87 22 106 112 60 119 81 66 52 14 25 127 29 103 24 48 126 30 120 107 51 47 133 129 96 138 113 37 64 114 53 73 108 62 1 123 63 57 142 76 16 4 35 54 19 110 42 116 7 10 118 9 71 49 75 23 89 99 3 137 38 98 61 128 102 13 122 33 50 94 100 105 109 134 40 20 135 46 34 41 83 67 44 84", "output": "137" }, { "input": "142\n34 88 88 88 88 88 131 53 88 130 131 88 88 130 88 131 53 130 130 34 88 88 131 130 53 88 88 34 131 130 88 131 130 34 130 53 53 34 53 34 130 34 88 88 130 88 131 130 34 53 88 34 53 88 130 53 34 53 88 131 130 34 88 88 130 88 130 130 131 131 130 53 131 130 131 130 53 34 131 34 88 53 88 53 34 130 88 88 130 53 130 34 131 130 53 131 130 88 130 131 53 130 34 130 88 53 88 88 53 88 34 131 88 131 130 53 130 130 53 130 88 88 131 53 88 53 53 34 53 130 131 130 34 131 34 53 130 88 34 34 53 34", "output": "1" }, { "input": "142\n25 46 7 30 112 34 76 5 130 122 7 132 54 82 139 97 79 112 79 79 112 43 25 50 118 112 87 11 51 30 90 56 119 46 9 81 5 103 78 18 49 37 43 129 124 90 109 6 31 50 90 20 79 99 130 31 131 62 50 84 5 34 6 41 79 112 9 30 141 114 34 11 46 92 97 30 95 112 24 24 74 121 65 31 127 28 140 30 79 90 9 10 56 88 9 65 128 79 56 37 109 37 30 95 37 105 3 102 120 18 28 90 107 29 128 137 59 62 62 77 34 43 26 5 99 97 44 130 115 130 130 47 83 53 77 80 131 79 28 98 10 52", "output": "8" }, { "input": "142\n138 102 2 111 17 64 25 11 3 90 118 120 46 33 131 87 119 9 72 141 62 116 44 136 81 122 93 106 123 62 35 17 98 49 46 124 32 67 93 90 91 99 36 46 138 5 52 73 139 2 11 97 6 9 47 56 134 134 112 90 94 55 97 98 118 37 109 31 132 58 95 98 76 76 63 7 110 28 133 50 46 136 115 57 113 55 4 96 63 66 9 52 107 17 95 78 95 118 69 105 18 10 52 94 29 36 113 86 132 39 77 42 113 116 135 93 136 39 48 119 124 35 10 133 138 45 78 107 132 130 49 28 73 85 135 4 119 38 78 116 108 125", "output": "20" }, { "input": "9\n7 3 8 9 9 3 5 3 2", "output": "6" }, { "input": "5\n2 1 4 5 3", "output": "6" }, { "input": "7\n2 3 4 5 6 7 6", "output": "6" }, { "input": "129\n2 1 4 5 3 7 8 9 10 6 12 13 14 15 16 17 11 19 20 21 22 23 24 25 26 27 28 18 30 31 32 33 34 35 36 37 38 39 40 41 29 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 42 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 59 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 78 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 101", "output": "6469693230" }, { "input": "4\n2 3 4 1", "output": "4" } ]
1,430,670,463
1,663
Python 3
OK
TESTS
65
62
0
n = int(input()) f = list(map(int, input().split())) for i in range(n): f[i] -= 1 def gcd(a, b): while (a != 0 and b != 0): a, b = b, a % b return a + b def lcm(a, b): return a * b // gcd(a, b) ans = 1 minn = 0 for i in range(n): vis = [False] * n cur = i st, pr = 0, 0 while not vis[cur]: vis[cur] = True cur = f[cur] st += 1 fs = cur cur = i while cur != fs: pr += 1 cur = f[cur] minn = max(minn, pr) ans = lcm(ans, st - pr) print(((max(0, minn - 1))// ans + 1) * ans)
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: Some time ago Leonid have known about idempotent functions. Idempotent function defined on a set {1,<=2,<=...,<=*n*} is such function , that for any the formula *g*(*g*(*x*))<==<=*g*(*x*) holds. Let's denote as *f*(*k*)(*x*) the function *f* applied *k* times to the value *x*. More formally, *f*(1)(*x*)<==<=*f*(*x*), *f*(*k*)(*x*)<==<=*f*(*f*(*k*<=-<=1)(*x*)) for each *k*<=&gt;<=1. You are given some function . Your task is to find minimum positive integer *k* such that function *f*(*k*)(*x*) is idempotent. Input Specification: In the first line of the input there is a single integer *n* (1<=≀<=*n*<=≀<=200) β€” the size of function *f* domain. In the second line follow *f*(1),<=*f*(2),<=...,<=*f*(*n*) (1<=≀<=*f*(*i*)<=≀<=*n* for each 1<=≀<=*i*<=≀<=*n*), the values of a function. Output Specification: Output minimum *k* such that function *f*(*k*)(*x*) is idempotent. Demo Input: ['4\n1 2 2 4\n', '3\n2 3 3\n', '3\n2 3 1\n'] Demo Output: ['1\n', '2\n', '3\n'] Note: In the first sample test function *f*(*x*) = *f*<sup class="upper-index">(1)</sup>(*x*) is already idempotent since *f*(*f*(1)) = *f*(1) = 1, *f*(*f*(2)) = *f*(2) = 2, *f*(*f*(3)) = *f*(3) = 2, *f*(*f*(4)) = *f*(4) = 4. In the second sample test: - function *f*(*x*) = *f*<sup class="upper-index">(1)</sup>(*x*) isn't idempotent because *f*(*f*(1)) = 3 but *f*(1) = 2; - function *f*(*x*) = *f*<sup class="upper-index">(2)</sup>(*x*) is idempotent since for any *x* it is true that *f*<sup class="upper-index">(2)</sup>(*x*) = 3, so it is also true that *f*<sup class="upper-index">(2)</sup>(*f*<sup class="upper-index">(2)</sup>(*x*)) = 3. In the third sample test: - function *f*(*x*) = *f*<sup class="upper-index">(1)</sup>(*x*) isn't idempotent because *f*(*f*(1)) = 3 but *f*(1) = 2; - function *f*(*f*(*x*)) = *f*<sup class="upper-index">(2)</sup>(*x*) isn't idempotent because *f*<sup class="upper-index">(2)</sup>(*f*<sup class="upper-index">(2)</sup>(1)) = 2 but *f*<sup class="upper-index">(2)</sup>(1) = 3; - function *f*(*f*(*f*(*x*))) = *f*<sup class="upper-index">(3)</sup>(*x*) is idempotent since it is identity function: *f*<sup class="upper-index">(3)</sup>(*x*) = *x* for any <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/46a8c73444c646004dfde04451775e7af924d108.png" style="max-width: 100.0%;max-height: 100.0%;"/> meaning that the formula *f*<sup class="upper-index">(3)</sup>(*f*<sup class="upper-index">(3)</sup>(*x*)) = *f*<sup class="upper-index">(3)</sup>(*x*) also holds.
```python n = int(input()) f = list(map(int, input().split())) for i in range(n): f[i] -= 1 def gcd(a, b): while (a != 0 and b != 0): a, b = b, a % b return a + b def lcm(a, b): return a * b // gcd(a, b) ans = 1 minn = 0 for i in range(n): vis = [False] * n cur = i st, pr = 0, 0 while not vis[cur]: vis[cur] = True cur = f[cur] st += 1 fs = cur cur = i while cur != fs: pr += 1 cur = f[cur] minn = max(minn, pr) ans = lcm(ans, st - pr) print(((max(0, minn - 1))// ans + 1) * ans) ```
3
535
B
Tavas and SaDDas
PROGRAMMING
1,100
[ "bitmasks", "brute force", "combinatorics", "implementation" ]
null
null
Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you." The problem is: You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. If we sort all lucky numbers in increasing order, what's the 1-based index of *n*? Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back.
The first and only line of input contains a lucky number *n* (1<=≀<=*n*<=≀<=109).
Print the index of *n* among all lucky numbers.
[ "4\n", "7\n", "77\n" ]
[ "1\n", "2\n", "6\n" ]
none
1,000
[ { "input": "4", "output": "1" }, { "input": "7", "output": "2" }, { "input": "77", "output": "6" }, { "input": "4", "output": "1" }, { "input": "474744", "output": "83" }, { "input": "777774", "output": "125" }, { "input": "447", "output": "8" }, { "input": "774", "output": "13" }, { "input": "4", "output": "1" }, { "input": "4447747", "output": "140" }, { "input": "7747474", "output": "233" }, { "input": "4444", "output": "15" }, { "input": "4447", "output": "16" }, { "input": "7", "output": "2" }, { "input": "4", "output": "1" }, { "input": "4447744", "output": "139" }, { "input": "77474", "output": "57" }, { "input": "7747", "output": "28" }, { "input": "444", "output": "7" }, { "input": "7", "output": "2" }, { "input": "7774477", "output": "242" }, { "input": "4477774", "output": "157" }, { "input": "7444", "output": "23" }, { "input": "7474747", "output": "212" }, { "input": "77", "output": "6" }, { "input": "774477", "output": "114" }, { "input": "7", "output": "2" }, { "input": "47", "output": "4" }, { "input": "747777", "output": "110" }, { "input": "444444444", "output": "511" }, { "input": "777777777", "output": "1022" }, { "input": "477477447", "output": "728" }, { "input": "777744747", "output": "996" } ]
1,692,316,580
2,147,483,647
PyPy 3
OK
TESTS
33
93
0
n = input().replace("4" , "0").replace("7" , "1") length = len(n) num = 2 ** (length) - 2 for index , i in enumerate(n): if int(i): num += 2 ** (length - index - 1) print(num + 1)
Title: Tavas and SaDDas Time Limit: None seconds Memory Limit: None megabytes Problem Description: Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you." The problem is: You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. If we sort all lucky numbers in increasing order, what's the 1-based index of *n*? Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back. Input Specification: The first and only line of input contains a lucky number *n* (1<=≀<=*n*<=≀<=109). Output Specification: Print the index of *n* among all lucky numbers. Demo Input: ['4\n', '7\n', '77\n'] Demo Output: ['1\n', '2\n', '6\n'] Note: none
```python n = input().replace("4" , "0").replace("7" , "1") length = len(n) num = 2 ** (length) - 2 for index , i in enumerate(n): if int(i): num += 2 ** (length - index - 1) print(num + 1) ```
3
476
A
Dreamoon and Stairs
PROGRAMMING
1,000
[ "implementation", "math" ]
null
null
Dreamoon wants to climb up a stair of *n* steps. He can climb 1 or 2 steps at each move. Dreamoon wants the number of moves to be a multiple of an integer *m*. What is the minimal number of moves making him climb to the top of the stairs that satisfies his condition?
The single line contains two space separated integers *n*, *m* (0<=&lt;<=*n*<=≀<=10000,<=1<=&lt;<=*m*<=≀<=10).
Print a single integer β€” the minimal number of moves being a multiple of *m*. If there is no way he can climb satisfying condition print <=-<=1 instead.
[ "10 2\n", "3 5\n" ]
[ "6\n", "-1\n" ]
For the first sample, Dreamoon could climb in 6 moves with following sequence of steps: {2, 2, 2, 2, 1, 1}. For the second sample, there are only three valid sequence of steps {2, 1}, {1, 2}, {1, 1, 1} with 2, 2, and 3 steps respectively. All these numbers are not multiples of 5.
500
[ { "input": "10 2", "output": "6" }, { "input": "3 5", "output": "-1" }, { "input": "29 7", "output": "21" }, { "input": "2 2", "output": "2" }, { "input": "1 2", "output": "-1" }, { "input": "10000 2", "output": "5000" }, { "input": "10000 3", "output": "5001" }, { "input": "10000 10", "output": "5000" }, { "input": "9999 3", "output": "5001" }, { "input": "9999 2", "output": "5000" }, { "input": "9999 10", "output": "5000" }, { "input": "9999 9", "output": "5004" }, { "input": "18 10", "output": "10" }, { "input": "19 10", "output": "10" }, { "input": "20 10", "output": "10" }, { "input": "21 10", "output": "20" }, { "input": "7688 5", "output": "3845" }, { "input": "4608 5", "output": "2305" }, { "input": "3979 2", "output": "1990" }, { "input": "9985 6", "output": "4998" }, { "input": "3230 8", "output": "1616" }, { "input": "24 9", "output": "18" }, { "input": "3275 8", "output": "1640" }, { "input": "6240 7", "output": "3122" }, { "input": "5227 4", "output": "2616" }, { "input": "3832 6", "output": "1920" }, { "input": "4 2", "output": "2" }, { "input": "6 3", "output": "3" }, { "input": "10 5", "output": "5" }, { "input": "3 2", "output": "2" }, { "input": "6 4", "output": "4" }, { "input": "5 2", "output": "4" }, { "input": "8 2", "output": "4" }, { "input": "9 9", "output": "9" }, { "input": "4 5", "output": "-1" } ]
1,673,623,159
2,147,483,647
PyPy 3
OK
TESTS
35
77
0
import math def main(): n,m=map(int,input().split()) if n<m: print(-1) return temp=n/2 if temp%m==0: print(int(temp)) else: temp/=m temp=math.ceil(temp) temp*=m print(temp) main()
Title: Dreamoon and Stairs Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dreamoon wants to climb up a stair of *n* steps. He can climb 1 or 2 steps at each move. Dreamoon wants the number of moves to be a multiple of an integer *m*. What is the minimal number of moves making him climb to the top of the stairs that satisfies his condition? Input Specification: The single line contains two space separated integers *n*, *m* (0<=&lt;<=*n*<=≀<=10000,<=1<=&lt;<=*m*<=≀<=10). Output Specification: Print a single integer β€” the minimal number of moves being a multiple of *m*. If there is no way he can climb satisfying condition print <=-<=1 instead. Demo Input: ['10 2\n', '3 5\n'] Demo Output: ['6\n', '-1\n'] Note: For the first sample, Dreamoon could climb in 6 moves with following sequence of steps: {2, 2, 2, 2, 1, 1}. For the second sample, there are only three valid sequence of steps {2, 1}, {1, 2}, {1, 1, 1} with 2, 2, and 3 steps respectively. All these numbers are not multiples of 5.
```python import math def main(): n,m=map(int,input().split()) if n<m: print(-1) return temp=n/2 if temp%m==0: print(int(temp)) else: temp/=m temp=math.ceil(temp) temp*=m print(temp) main() ```
3
439
A
Devu, the Singer and Churu, the Joker
PROGRAMMING
900
[ "greedy", "implementation" ]
null
null
Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited. Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly. The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly. People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest. You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions: - The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible. If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event.
The first line contains two space separated integers *n*, *d* (1<=≀<=*n*<=≀<=100;Β 1<=≀<=*d*<=≀<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≀<=*t**i*<=≀<=100).
If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event.
[ "3 30\n2 2 1\n", "3 20\n2 1 1\n" ]
[ "5\n", "-1\n" ]
Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way: - First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes. Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes. Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.
500
[ { "input": "3 30\n2 2 1", "output": "5" }, { "input": "3 20\n2 1 1", "output": "-1" }, { "input": "50 10000\n5 4 10 9 9 6 7 7 7 3 3 7 7 4 7 4 10 10 1 7 10 3 1 4 5 7 2 10 10 10 2 3 4 7 6 1 8 4 7 3 8 8 4 10 1 1 9 2 6 1", "output": "1943" }, { "input": "50 10000\n4 7 15 9 11 12 20 9 14 14 10 13 6 13 14 17 6 8 20 12 10 15 13 17 5 12 13 11 7 5 5 2 3 15 13 7 14 14 19 2 13 14 5 15 3 19 15 16 4 1", "output": "1891" }, { "input": "100 9000\n5 2 3 1 1 3 4 9 9 6 7 10 10 10 2 10 6 8 8 6 7 9 9 5 6 2 1 10 10 9 4 5 9 2 4 3 8 5 6 1 1 5 3 6 2 6 6 6 5 8 3 6 7 3 1 10 9 1 8 3 10 9 5 6 3 4 1 1 10 10 2 3 4 8 10 10 5 1 5 3 6 8 10 6 10 2 1 8 10 1 7 6 9 10 5 2 3 5 3 2", "output": "1688" }, { "input": "100 8007\n5 19 14 18 9 6 15 8 1 14 11 20 3 17 7 12 2 6 3 17 7 20 1 14 20 17 2 10 13 7 18 18 9 10 16 8 1 11 11 9 13 18 9 20 12 12 7 15 12 17 11 5 11 15 9 2 15 1 18 3 18 16 15 4 10 5 18 13 13 12 3 8 17 2 12 2 13 3 1 13 2 4 9 10 18 10 14 4 4 17 12 19 2 9 6 5 5 20 18 12", "output": "1391" }, { "input": "39 2412\n1 1 1 1 1 1 26 1 1 1 99 1 1 1 1 1 1 1 1 1 1 88 7 1 1 1 1 76 1 1 1 93 40 1 13 1 68 1 32", "output": "368" }, { "input": "39 2617\n47 1 1 1 63 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 70 1 99 63 1 1 1 1 1 1 1 1 64 1 1", "output": "435" }, { "input": "39 3681\n83 77 1 94 85 47 1 98 29 16 1 1 1 71 96 85 31 97 96 93 40 50 98 1 60 51 1 96 100 72 1 1 1 89 1 93 1 92 100", "output": "326" }, { "input": "45 894\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 28 28 1 1 1 1 1 1 1 1 1 1 1 1 1 1 99 3 1 1", "output": "139" }, { "input": "45 4534\n1 99 65 99 4 46 54 80 51 30 96 1 28 30 44 70 78 1 1 100 1 62 1 1 1 85 1 1 1 61 1 46 75 1 61 77 97 26 67 1 1 63 81 85 86", "output": "514" }, { "input": "72 3538\n52 1 8 1 1 1 7 1 1 1 1 48 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 40 1 1 38 1 1 1 1 1 1 1 1 1 1 1 35 1 93 79 1 1 1 1 1 1 1 1 1 51 1 1 1 1 1 1 1 1 1 1 1 1 96 1", "output": "586" }, { "input": "81 2200\n1 59 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 93 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 50 1 1 1 1 1 1 1 1 1 1 1", "output": "384" }, { "input": "81 2577\n85 91 1 1 2 1 1 100 1 80 1 1 17 86 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 37 1 66 24 1 1 96 49 1 66 1 44 1 1 1 1 98 1 1 1 1 35 1 37 3 35 1 1 87 64 1 24 1 58 1 1 42 83 5 1 1 1 1 1 95 1 94 1 50 1 1", "output": "174" }, { "input": "81 4131\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 16 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "807" }, { "input": "81 6315\n1 1 67 100 1 99 36 1 92 5 1 96 42 12 1 57 91 1 1 66 41 30 74 95 1 37 1 39 91 69 1 52 77 47 65 1 1 93 96 74 90 35 85 76 71 92 92 1 1 67 92 74 1 1 86 76 35 1 56 16 27 57 37 95 1 40 20 100 51 1 80 60 45 79 95 1 46 1 25 100 96", "output": "490" }, { "input": "96 1688\n1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 25 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 71 1 1 1 30 1 1 1", "output": "284" }, { "input": "96 8889\n1 1 18 1 1 1 1 1 1 1 1 1 99 1 1 1 1 88 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 96 1 1 1 1 21 1 1 1 1 1 1 1 73 1 1 1 1 1 10 1 1 1 1 1 1 1 46 43 1 1 1 1 1 98 1 1 1 1 1 1 6 1 1 1 1 1 74 1 25 1 55 1 1 1 13 1 1 54 1 1 1", "output": "1589" }, { "input": "10 100\n1 1 1 1 1 1 1 1 1 1", "output": "18" }, { "input": "100 10000\n54 46 72 94 79 83 91 54 73 3 24 55 54 31 28 20 19 6 25 19 47 23 1 70 15 87 51 39 54 77 55 5 60 3 15 99 56 88 22 78 79 21 38 27 28 86 7 88 12 59 55 70 25 1 70 49 1 45 69 72 50 17 4 56 8 100 90 34 35 20 61 76 88 79 4 74 65 68 75 26 40 72 59 94 10 67 96 85 29 90 47 24 44 1 66 93 55 36 1 99", "output": "1017" }, { "input": "100 6000\n41 31 23 17 24 78 26 96 93 48 46 2 49 33 35 9 73 100 34 48 83 36 33 69 43 24 3 74 8 81 27 33 94 38 77 9 76 90 62 90 21 67 22 22 12 2 17 27 61 18 72 85 59 65 71 38 90 75 74 66 60 47 58 50 90 95 75 10 5 100 97 29 83 88 65 26 93 90 22 98 36 55 70 38 50 92 88 72 99 96 25 14 74 16 25 92 67 94 77 96", "output": "-1" }, { "input": "1 1\n1", "output": "0" }, { "input": "1 6\n1", "output": "1" }, { "input": "1 5\n1", "output": "0" }, { "input": "1 3\n4", "output": "-1" }, { "input": "3 24\n2 1 2", "output": "-1" } ]
1,640,778,164
2,147,483,647
Python 3
OK
TESTS
26
62
0
n,d=map(int,input().split()) num=list(map(int,input().split())) sum=0 for i in num: sum+=i if(sum+(n-1)*10>d): print(-1) else: print(int((d-sum)/5))
Title: Devu, the Singer and Churu, the Joker Time Limit: None seconds Memory Limit: None megabytes Problem Description: Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited. Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly. The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly. People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest. You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions: - The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible. If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event. Input Specification: The first line contains two space separated integers *n*, *d* (1<=≀<=*n*<=≀<=100;Β 1<=≀<=*d*<=≀<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≀<=*t**i*<=≀<=100). Output Specification: If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event. Demo Input: ['3 30\n2 2 1\n', '3 20\n2 1 1\n'] Demo Output: ['5\n', '-1\n'] Note: Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way: - First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes. Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes. Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.
```python n,d=map(int,input().split()) num=list(map(int,input().split())) sum=0 for i in num: sum+=i if(sum+(n-1)*10>d): print(-1) else: print(int((d-sum)/5)) ```
3
617
A
Elephant
PROGRAMMING
800
[ "math" ]
null
null
An elephant decided to visit his friend. It turned out that the elephant's house is located at point 0 and his friend's house is located at point *x*(*x*<=&gt;<=0) of the coordinate line. In one step the elephant can move 1, 2, 3, 4 or 5 positions forward. Determine, what is the minimum number of steps he need to make in order to get to his friend's house.
The first line of the input contains an integer *x* (1<=≀<=*x*<=≀<=1<=000<=000)Β β€” The coordinate of the friend's house.
Print the minimum number of steps that elephant needs to make to get from point 0 to point *x*.
[ "5\n", "12\n" ]
[ "1\n", "3\n" ]
In the first sample the elephant needs to make one step of length 5 to reach the point *x*. In the second sample the elephant can get to point *x* if he moves by 3, 5 and 4. There are other ways to get the optimal answer but the elephant cannot reach *x* in less than three moves.
500
[ { "input": "5", "output": "1" }, { "input": "12", "output": "3" }, { "input": "999999", "output": "200000" }, { "input": "41", "output": "9" }, { "input": "1000000", "output": "200000" }, { "input": "1", "output": "1" }, { "input": "2", "output": "1" }, { "input": "3", "output": "1" }, { "input": "4", "output": "1" }, { "input": "534204", "output": "106841" }, { "input": "469569", "output": "93914" }, { "input": "502877", "output": "100576" }, { "input": "942212", "output": "188443" }, { "input": "97", "output": "20" }, { "input": "53", "output": "11" }, { "input": "89", "output": "18" }, { "input": "574", "output": "115" }, { "input": "716", "output": "144" }, { "input": "729", "output": "146" }, { "input": "8901", "output": "1781" }, { "input": "3645", "output": "729" }, { "input": "4426", "output": "886" }, { "input": "46573", "output": "9315" }, { "input": "86380", "output": "17276" }, { "input": "94190", "output": "18838" }, { "input": "999990", "output": "199998" }, { "input": "999991", "output": "199999" }, { "input": "999992", "output": "199999" }, { "input": "999993", "output": "199999" }, { "input": "999994", "output": "199999" }, { "input": "999995", "output": "199999" }, { "input": "999996", "output": "200000" }, { "input": "999997", "output": "200000" }, { "input": "999998", "output": "200000" } ]
1,698,158,299
2,147,483,647
Python 3
OK
TESTS
34
46
0
x = int(input()) steps = 0 for i in range(5, 0, -1): single = x // i x -= single * i steps += single if x == 0: break print(steps)
Title: Elephant Time Limit: None seconds Memory Limit: None megabytes Problem Description: An elephant decided to visit his friend. It turned out that the elephant's house is located at point 0 and his friend's house is located at point *x*(*x*<=&gt;<=0) of the coordinate line. In one step the elephant can move 1, 2, 3, 4 or 5 positions forward. Determine, what is the minimum number of steps he need to make in order to get to his friend's house. Input Specification: The first line of the input contains an integer *x* (1<=≀<=*x*<=≀<=1<=000<=000)Β β€” The coordinate of the friend's house. Output Specification: Print the minimum number of steps that elephant needs to make to get from point 0 to point *x*. Demo Input: ['5\n', '12\n'] Demo Output: ['1\n', '3\n'] Note: In the first sample the elephant needs to make one step of length 5 to reach the point *x*. In the second sample the elephant can get to point *x* if he moves by 3, 5 and 4. There are other ways to get the optimal answer but the elephant cannot reach *x* in less than three moves.
```python x = int(input()) steps = 0 for i in range(5, 0, -1): single = x // i x -= single * i steps += single if x == 0: break print(steps) ```
3
510
A
Fox And Snake
PROGRAMMING
800
[ "implementation" ]
null
null
Fox Ciel starts to learn programming. The first task is drawing a fox! However, that turns out to be too hard for a beginner, so she decides to draw a snake instead. A snake is a pattern on a *n* by *m* table. Denote *c*-th cell of *r*-th row as (*r*,<=*c*). The tail of the snake is located at (1,<=1), then it's body extends to (1,<=*m*), then goes down 2 rows to (3,<=*m*), then goes left to (3,<=1) and so on. Your task is to draw this snake for Fox Ciel: the empty cells should be represented as dot characters ('.') and the snake cells should be filled with number signs ('#'). Consider sample tests in order to understand the snake pattern.
The only line contains two integers: *n* and *m* (3<=≀<=*n*,<=*m*<=≀<=50). *n* is an odd number.
Output *n* lines. Each line should contain a string consisting of *m* characters. Do not output spaces.
[ "3 3\n", "3 4\n", "5 3\n", "9 9\n" ]
[ "###\n..#\n###\n", "####\n...#\n####\n", "###\n..#\n###\n#..\n###\n", "#########\n........#\n#########\n#........\n#########\n........#\n#########\n#........\n#########\n" ]
none
500
[ { "input": "3 3", "output": "###\n..#\n###" }, { "input": "3 4", "output": "####\n...#\n####" }, { "input": "5 3", "output": "###\n..#\n###\n#..\n###" }, { "input": "9 9", "output": "#########\n........#\n#########\n#........\n#########\n........#\n#########\n#........\n#########" }, { "input": "3 5", "output": "#####\n....#\n#####" }, { "input": "3 6", "output": "######\n.....#\n######" }, { "input": "7 3", "output": "###\n..#\n###\n#..\n###\n..#\n###" }, { "input": "7 4", "output": "####\n...#\n####\n#...\n####\n...#\n####" }, { "input": "49 50", "output": "##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.............................................." }, { "input": "43 50", "output": "##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.............................................." }, { "input": "43 27", "output": "###########################\n..........................#\n###########################\n#..........................\n###########################\n..........................#\n###########################\n#..........................\n###########################\n..........................#\n###########################\n#..........................\n###########################\n..........................#\n###########################\n#..........................\n###########################\n....................." }, { "input": "11 15", "output": "###############\n..............#\n###############\n#..............\n###############\n..............#\n###############\n#..............\n###############\n..............#\n###############" }, { "input": "11 3", "output": "###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###" }, { "input": "19 3", "output": "###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###" }, { "input": "23 50", "output": "##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.............................................." }, { "input": "49 49", "output": "#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#..." }, { "input": "33 43", "output": "###########################################\n..........................................#\n###########################################\n#..........................................\n###########################################\n..........................................#\n###########################################\n#..........................................\n###########################################\n..........................................#\n###########################################\n#.................." }, { "input": "33 44", "output": "############################################\n...........................................#\n############################################\n#...........................................\n############################################\n...........................................#\n############################################\n#...........................................\n############################################\n...........................................#\n############################################\n#......." }, { "input": "45 45", "output": "#############################################\n............................................#\n#############################################\n#............................................\n#############################################\n............................................#\n#############################################\n#............................................\n#############################################\n............................................#\n#########################################..." }, { "input": "45 49", "output": "#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#..." }, { "input": "45 3", "output": "###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###" }, { "input": "45 4", "output": "####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####" }, { "input": "5 4", "output": "####\n...#\n####\n#...\n####" }, { "input": "5 5", "output": "#####\n....#\n#####\n#....\n#####" }, { "input": "5 6", "output": "######\n.....#\n######\n#.....\n######" }, { "input": "7 5", "output": "#####\n....#\n#####\n#....\n#####\n....#\n#####" }, { "input": "7 6", "output": "######\n.....#\n######\n#.....\n######\n.....#\n######" }, { "input": "7 7", "output": "#######\n......#\n#######\n#......\n#######\n......#\n#######" } ]
1,687,843,990
2,147,483,647
PyPy 3-64
OK
TESTS
28
62
0
n,m=map(int,input().split()) snake=[] for _ in range(1,n+1): if _%2!=0: snake.append('#'*m) elif _%4==2: snake.append('.'*(m-1)+'#') elif _%4==0: snake.append('#'+'.'*(m-1)) for row in snake: print(row)
Title: Fox And Snake Time Limit: None seconds Memory Limit: None megabytes Problem Description: Fox Ciel starts to learn programming. The first task is drawing a fox! However, that turns out to be too hard for a beginner, so she decides to draw a snake instead. A snake is a pattern on a *n* by *m* table. Denote *c*-th cell of *r*-th row as (*r*,<=*c*). The tail of the snake is located at (1,<=1), then it's body extends to (1,<=*m*), then goes down 2 rows to (3,<=*m*), then goes left to (3,<=1) and so on. Your task is to draw this snake for Fox Ciel: the empty cells should be represented as dot characters ('.') and the snake cells should be filled with number signs ('#'). Consider sample tests in order to understand the snake pattern. Input Specification: The only line contains two integers: *n* and *m* (3<=≀<=*n*,<=*m*<=≀<=50). *n* is an odd number. Output Specification: Output *n* lines. Each line should contain a string consisting of *m* characters. Do not output spaces. Demo Input: ['3 3\n', '3 4\n', '5 3\n', '9 9\n'] Demo Output: ['###\n..#\n###\n', '####\n...#\n####\n', '###\n..#\n###\n#..\n###\n', '#########\n........#\n#########\n#........\n#########\n........#\n#########\n#........\n#########\n'] Note: none
```python n,m=map(int,input().split()) snake=[] for _ in range(1,n+1): if _%2!=0: snake.append('#'*m) elif _%4==2: snake.append('.'*(m-1)+'#') elif _%4==0: snake.append('#'+'.'*(m-1)) for row in snake: print(row) ```
3
265
A
Colorful Stones (Simplified Edition)
PROGRAMMING
800
[ "implementation" ]
null
null
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively. Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times. Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move. You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction. Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
The input contains two lines. The first line contains the string *s* (1<=≀<=|*s*|<=≀<=50). The second line contains the string *t* (1<=≀<=|*t*|<=≀<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
Print the final 1-based position of Liss in a single line.
[ "RGB\nRRR\n", "RRRBGBRBBB\nBBBRR\n", "BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n" ]
[ "2\n", "3\n", "15\n" ]
none
500
[ { "input": "RGB\nRRR", "output": "2" }, { "input": "RRRBGBRBBB\nBBBRR", "output": "3" }, { "input": "BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB", "output": "15" }, { "input": "G\nRRBBRBRRBR", "output": "1" }, { "input": "RRRRRBRRBRRGRBGGRRRGRBBRBBBBBRGRBGBRRGBBBRBBGBRGBB\nB", "output": "1" }, { "input": "RRGGBRGRBG\nBRRGGBBGGR", "output": "7" }, { "input": "BBRRGBGGRGBRGBRBRBGR\nGGGRBGGGBRRRRGRBGBGRGRRBGRBGBG", "output": "15" }, { "input": "GBRRBGBGBBBBRRRGBGRRRGBGBBBRGR\nRRGBRRGRBBBBBBGRRBBR", "output": "8" }, { "input": "BRGRRGRGRRGBBGBBBRRBBRRBGBBGRGBBGGRGBRBGGGRRRBGGBB\nRGBBGRRBBBRRGRRBRBBRGBBGGGRGBGRRRRBRBGGBRBGGGRGBRR", "output": "16" }, { "input": "GGRGGBRRGRGBRRGGRBBGGRRGBBBGBBBGGRBGGBRBBRGBRRRBRG\nGGRGRRRRRRRRRGBBBBRGBRGRGRRGBBRGGBRBBRBGBRGRRRRGGR", "output": "18" }, { "input": "RBBRBGBBGGGBRRBGBRGRRGGRBBBBGRBGGBRRBGBBRBRGBBGGGG\nBRRGRBGRBGBRGBRBGGBBBGBBRGRBGRGRBGRBGGRRBGBRGRRBBG", "output": "23" }, { "input": "RRGGRRBRGRGBRGBRGBBRGGGBRBGBRGBRGGBRBRGBGRRBBGGRBR\nBRGRBBBGRBGRRGGRRRRRRRRGGGGGGGGBGGGGGGGRGRBBRGRGBR", "output": "14" }, { "input": "RBRBRRRRRGGR\nBBBBRRGGBGRBRGBBRGGGRGGBRRBRBRBGGG", "output": "12" }, { "input": "GGRGGGBRGRGRBBRGGGRBGRRR\nGBBBBGBGBGBBBRGGRGGBGRRGRRRGBGB", "output": "12" }, { "input": "RGRBGBRBBGBRRGGGBBGBRRBGRGBBBBBGRRRGGRBB\nBGR", "output": "2" }, { "input": "R\nB", "output": "1" }, { "input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR", "output": "50" }, { "input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG", "output": "1" }, { "input": "R\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG", "output": "1" } ]
1,676,471,362
2,147,483,647
Python 3
OK
TESTS
19
92
0
stones1 = list(map(str,input())) stones2 = list(map(str,input())) i = 0 j = 0 while j < len(stones2): if stones1[i] == stones2[j]: i+=1 j += 1 print (i+1)
Title: Colorful Stones (Simplified Edition) Time Limit: None seconds Memory Limit: None megabytes Problem Description: There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively. Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times. Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move. You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction. Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence. Input Specification: The input contains two lines. The first line contains the string *s* (1<=≀<=|*s*|<=≀<=50). The second line contains the string *t* (1<=≀<=|*t*|<=≀<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence. Output Specification: Print the final 1-based position of Liss in a single line. Demo Input: ['RGB\nRRR\n', 'RRRBGBRBBB\nBBBRR\n', 'BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n'] Demo Output: ['2\n', '3\n', '15\n'] Note: none
```python stones1 = list(map(str,input())) stones2 = list(map(str,input())) i = 0 j = 0 while j < len(stones2): if stones1[i] == stones2[j]: i+=1 j += 1 print (i+1) ```
3
50
A
Domino piling
PROGRAMMING
800
[ "greedy", "math" ]
A. Domino piling
2
256
You are given a rectangular board of *M*<=Γ—<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=Γ—<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions.
In a single line you are given two integers *M* and *N* β€” board sizes in squares (1<=≀<=*M*<=≀<=*N*<=≀<=16).
Output one number β€” the maximal number of dominoes, which can be placed.
[ "2 4\n", "3 3\n" ]
[ "4\n", "4\n" ]
none
500
[ { "input": "2 4", "output": "4" }, { "input": "3 3", "output": "4" }, { "input": "1 5", "output": "2" }, { "input": "1 6", "output": "3" }, { "input": "1 15", "output": "7" }, { "input": "1 16", "output": "8" }, { "input": "2 5", "output": "5" }, { "input": "2 6", "output": "6" }, { "input": "2 7", "output": "7" }, { "input": "2 14", "output": "14" }, { "input": "2 15", "output": "15" }, { "input": "1 4", "output": "2" }, { "input": "2 16", "output": "16" }, { "input": "3 5", "output": "7" }, { "input": "3 6", "output": "9" }, { "input": "3 10", "output": "15" }, { "input": "3 14", "output": "21" }, { "input": "3 15", "output": "22" }, { "input": "3 16", "output": "24" }, { "input": "5 7", "output": "17" }, { "input": "16 16", "output": "128" }, { "input": "15 16", "output": "120" }, { "input": "2 3", "output": "3" }, { "input": "15 15", "output": "112" }, { "input": "14 16", "output": "112" }, { "input": "11 13", "output": "71" }, { "input": "5 16", "output": "40" }, { "input": "8 15", "output": "60" }, { "input": "2 2", "output": "2" }, { "input": "3 4", "output": "6" }, { "input": "4 4", "output": "8" }, { "input": "1 1", "output": "0" }, { "input": "1 2", "output": "1" }, { "input": "1 3", "output": "1" }, { "input": "14 15", "output": "105" } ]
1,627,668,466
2,147,483,647
Python 3
OK
TESTS
35
154
6,758,400
l = list(map(int, input().split())) Final=0 Final =(l[0]*l[1])//2 print(Final)
Title: Domino piling Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: You are given a rectangular board of *M*<=Γ—<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=Γ—<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions. Input Specification: In a single line you are given two integers *M* and *N* β€” board sizes in squares (1<=≀<=*M*<=≀<=*N*<=≀<=16). Output Specification: Output one number β€” the maximal number of dominoes, which can be placed. Demo Input: ['2 4\n', '3 3\n'] Demo Output: ['4\n', '4\n'] Note: none
```python l = list(map(int, input().split())) Final=0 Final =(l[0]*l[1])//2 print(Final) ```
3.948911
877
A
Alex and broken contest
PROGRAMMING
1,100
[ "implementation", "strings" ]
null
null
One day Alex was creating a contest about his friends, but accidentally deleted it. Fortunately, all the problems were saved, but now he needs to find them among other problems. But there are too many problems, to do it manually. Alex asks you to write a program, which will determine if a problem is from this contest by its name. It is known, that problem is from this contest if and only if its name contains one of Alex's friends' name exactly once. His friends' names are "Danil", "Olya", "Slava", "Ann" and "Nikita". Names are case sensitive.
The only line contains string from lowercase and uppercase letters and "_" symbols of length, not more than 100 β€” the name of the problem.
Print "YES", if problem is from this contest, and "NO" otherwise.
[ "Alex_and_broken_contest\n", "NikitaAndString\n", "Danil_and_Olya\n" ]
[ "NO", "YES", "NO" ]
none
500
[ { "input": "Alex_and_broken_contest", "output": "NO" }, { "input": "NikitaAndString", "output": "YES" }, { "input": "Danil_and_Olya", "output": "NO" }, { "input": "Slava____and_the_game", "output": "YES" }, { "input": "Olya_and_energy_drinks", "output": "YES" }, { "input": "Danil_and_part_time_job", "output": "YES" }, { "input": "Ann_and_books", "output": "YES" }, { "input": "Olya", "output": "YES" }, { "input": "Nikita", "output": "YES" }, { "input": "Slava", "output": "YES" }, { "input": "Vanya", "output": "NO" }, { "input": "I_dont_know_what_to_write_here", "output": "NO" }, { "input": "danil_and_work", "output": "NO" }, { "input": "Ann", "output": "YES" }, { "input": "Batman_Nananananananan_Batman", "output": "NO" }, { "input": "Olya_Nikita_Ann_Slava_Danil", "output": "NO" }, { "input": "its_me_Mario", "output": "NO" }, { "input": "A", "output": "NO" }, { "input": "Wake_up_Neo", "output": "NO" }, { "input": "Hardest_problem_ever", "output": "NO" }, { "input": "Nikita_Nikita", "output": "NO" }, { "input": "____________________________________________________________________________________________________", "output": "NO" }, { "input": "Nikitb", "output": "NO" }, { "input": "Unn", "output": "NO" }, { "input": "oLya_adn_smth", "output": "NO" }, { "input": "FloorISLava", "output": "NO" }, { "input": "ann", "output": "NO" }, { "input": "aa", "output": "NO" }, { "input": "AAnnnnn", "output": "YES" }, { "input": "AnnAnn", "output": "NO" }, { "input": "Annn", "output": "YES" }, { "input": "Dilzhan", "output": "NO" }, { "input": "Danilaaa", "output": "YES" }, { "input": "AndAnn", "output": "YES" }, { "input": "OlyaAnnAnn", "output": "NO" }, { "input": "DanilDanilOlya", "output": "NO" }, { "input": "DDanil", "output": "YES" }, { "input": "AnnAnnDanil", "output": "NO" }, { "input": "And_Danil", "output": "YES" }, { "input": "abcddddDanil", "output": "YES" }, { "input": "DanilOlyaOlya", "output": "NO" }, { "input": "Nikitaaa", "output": "YES" }, { "input": "aaabbba", "output": "NO" }, { "input": "Ann_Ann_Danil", "output": "NO" }, { "input": "Danil_Danil_Nikita", "output": "NO" }, { "input": "AlexaaaaaaBBBBBOlyaDDDDD", "output": "YES" }, { "input": "IloveDaniland", "output": "YES" }, { "input": "AnAnn", "output": "YES" }, { "input": "Danil_Danil_Olya", "output": "NO" }, { "input": "DanilDanilSlava", "output": "NO" }, { "input": "DanilDanil", "output": "NO" }, { "input": "OlyOlya", "output": "YES" }, { "input": "NikitaNikitb", "output": "YES" }, { "input": "ababaca", "output": "NO" }, { "input": "AnnNikitaNikitaNikitaNikita__good_luck", "output": "NO" } ]
1,687,369,329
2,147,483,647
Python 3
OK
TESTS
55
46
0
s = input() c=0 fren = ["Danil", "Olya", "Slava", "Ann", "Nikita"] for name in fren: if name in s: c += s.count(name) if (c == 1): print("Yes") else: print("No")
Title: Alex and broken contest Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Alex was creating a contest about his friends, but accidentally deleted it. Fortunately, all the problems were saved, but now he needs to find them among other problems. But there are too many problems, to do it manually. Alex asks you to write a program, which will determine if a problem is from this contest by its name. It is known, that problem is from this contest if and only if its name contains one of Alex's friends' name exactly once. His friends' names are "Danil", "Olya", "Slava", "Ann" and "Nikita". Names are case sensitive. Input Specification: The only line contains string from lowercase and uppercase letters and "_" symbols of length, not more than 100 β€” the name of the problem. Output Specification: Print "YES", if problem is from this contest, and "NO" otherwise. Demo Input: ['Alex_and_broken_contest\n', 'NikitaAndString\n', 'Danil_and_Olya\n'] Demo Output: ['NO', 'YES', 'NO'] Note: none
```python s = input() c=0 fren = ["Danil", "Olya", "Slava", "Ann", "Nikita"] for name in fren: if name in s: c += s.count(name) if (c == 1): print("Yes") else: print("No") ```
3
868
A
Bark to Unlock
PROGRAMMING
900
[ "brute force", "implementation", "strings" ]
null
null
As technologies develop, manufacturers are making the process of unlocking a phone as user-friendly as possible. To unlock its new phone, Arkady's pet dog Mu-mu has to bark the password once. The phone represents a password as a string of two lowercase English letters. Mu-mu's enemy Kashtanka wants to unlock Mu-mu's phone to steal some sensible information, but it can only bark *n* distinct words, each of which can be represented as a string of two lowercase English letters. Kashtanka wants to bark several words (not necessarily distinct) one after another to pronounce a string containing the password as a substring. Tell if it's possible to unlock the phone in this way, or not.
The first line contains two lowercase English lettersΒ β€” the password on the phone. The second line contains single integer *n* (1<=≀<=*n*<=≀<=100)Β β€” the number of words Kashtanka knows. The next *n* lines contain two lowercase English letters each, representing the words Kashtanka knows. The words are guaranteed to be distinct.
Print "YES" if Kashtanka can bark several words in a line forming a string containing the password, and "NO" otherwise. You can print each letter in arbitrary case (upper or lower).
[ "ya\n4\nah\noy\nto\nha\n", "hp\n2\nht\ntp\n", "ah\n1\nha\n" ]
[ "YES\n", "NO\n", "YES\n" ]
In the first example the password is "ya", and Kashtanka can bark "oy" and then "ah", and then "ha" to form the string "oyahha" which contains the password. So, the answer is "YES". In the second example Kashtanka can't produce a string containing password as a substring. Note that it can bark "ht" and then "tp" producing "http", but it doesn't contain the password "hp" as a substring. In the third example the string "hahahaha" contains "ah" as a substring.
250
[ { "input": "ya\n4\nah\noy\nto\nha", "output": "YES" }, { "input": "hp\n2\nht\ntp", "output": "NO" }, { "input": "ah\n1\nha", "output": "YES" }, { "input": "bb\n4\nba\nab\naa\nbb", "output": "YES" }, { "input": "bc\n4\nca\nba\nbb\ncc", "output": "YES" }, { "input": "ba\n4\ncd\nad\ncc\ncb", "output": "YES" }, { "input": "pg\n4\nzl\nxs\ndi\nxn", "output": "NO" }, { "input": "bn\n100\ndf\nyb\nze\nml\nyr\nof\nnw\nfm\ndw\nlv\nzr\nhu\nzt\nlw\nld\nmo\nxz\ntp\nmr\nou\nme\npx\nvp\nes\nxi\nnr\nbx\nqc\ngm\njs\nkn\ntw\nrq\nkz\nuc\nvc\nqr\nab\nna\nro\nya\nqy\ngu\nvk\nqk\ngs\nyq\nop\nhw\nrj\neo\nlz\nbh\nkr\nkb\nma\nrd\nza\nuf\nhq\nmc\nmn\nti\nwn\nsh\nax\nsi\nnd\ntz\ndu\nfj\nkl\nws\now\nnf\nvr\nye\nzc\niw\nfv\nkv\noo\nsm\nbc\nrs\nau\nuz\nuv\ngh\nsu\njn\ndz\nrl\nwj\nbk\nzl\nas\nms\nit\nwu", "output": "YES" }, { "input": "bb\n1\naa", "output": "NO" }, { "input": "qm\n25\nqw\nwe\ner\nrt\nty\nyu\nui\nio\nop\npa\nas\nsd\ndf\nfg\ngh\nhj\njk\nkl\nlz\nzx\nxc\ncv\nvb\nbn\nnm", "output": "NO" }, { "input": "mq\n25\nqw\nwe\ner\nrt\nty\nyu\nui\nio\nop\npa\nas\nsd\ndf\nfg\ngh\nhj\njk\nkl\nlz\nzx\nxc\ncv\nvb\nbn\nnm", "output": "YES" }, { "input": "aa\n1\naa", "output": "YES" }, { "input": "bb\n1\nbb", "output": "YES" }, { "input": "ba\n1\ncc", "output": "NO" }, { "input": "ha\n1\nha", "output": "YES" }, { "input": "aa\n1\naa", "output": "YES" }, { "input": "ez\n1\njl", "output": "NO" }, { "input": "aa\n2\nab\nba", "output": "YES" }, { "input": "aa\n2\nca\ncc", "output": "NO" }, { "input": "dd\n2\nac\ndc", "output": "NO" }, { "input": "qc\n2\nyc\nkr", "output": "NO" }, { "input": "aa\n3\nba\nbb\nab", "output": "YES" }, { "input": "ca\n3\naa\nbb\nab", "output": "NO" }, { "input": "ca\n3\nbc\nbd\nca", "output": "YES" }, { "input": "dd\n3\nmt\nrg\nxl", "output": "NO" }, { "input": "be\n20\nad\ncd\ncb\ndb\ndd\naa\nab\nca\nae\ned\ndc\nbb\nba\nda\nee\nea\ncc\nac\nec\neb", "output": "YES" }, { "input": "fc\n20\nca\nbb\nce\nfd\nde\nfa\ncc\nec\nfb\nfc\nff\nbe\ncf\nba\ndb\ned\naf\nae\nda\nef", "output": "YES" }, { "input": "ca\n20\ndc\naf\ndf\neg\naa\nbc\nea\nbd\nab\ndb\ngc\nfb\nba\nbe\nee\ngf\ncf\nag\nga\nca", "output": "YES" }, { "input": "ke\n20\nzk\nra\nbq\nqz\nwt\nzg\nmz\nuk\nge\nuv\nud\nfd\neh\ndm\nsk\nki\nfv\ntp\nat\nfb", "output": "YES" }, { "input": "hh\n50\nag\nhg\ndg\nfh\neg\ngh\ngd\nda\nbh\nab\nhf\ndc\nhb\nfe\nad\nec\nac\nfd\nca\naf\ncg\nhd\neb\nce\nhe\nha\ngb\nea\nae\nfb\nff\nbe\nch\nhh\nee\nde\nge\ngf\naa\ngg\neh\ned\nbf\nfc\nah\nga\nbd\ncb\nbg\nbc", "output": "YES" }, { "input": "id\n50\nhi\ndc\nfg\nee\ngi\nhc\nac\nih\ndg\nfc\nde\ned\nie\neb\nic\ncf\nib\nfa\ngc\nba\nbe\nga\nha\nhg\nia\ndf\nab\nei\neh\nad\nii\nci\ndh\nec\nif\ndi\nbg\nag\nhe\neg\nca\nae\ndb\naa\nid\nfh\nhh\ncc\nfb\ngb", "output": "YES" }, { "input": "fe\n50\nje\nbi\nbg\ngc\nfb\nig\ndf\nji\ndg\nfe\nfc\ncf\ngf\nai\nhe\nac\nch\nja\ngh\njf\nge\ncb\nij\ngb\ncg\naf\neh\nee\nhd\njd\njb\nii\nca\nci\nga\nab\nhi\nag\nfj\nej\nfi\nie\ndj\nfg\nef\njc\njg\njh\nhf\nha", "output": "YES" }, { "input": "rn\n50\nba\nec\nwg\nao\nlk\nmz\njj\ncf\nfa\njk\ndy\nsz\njs\nzr\nqv\ntx\nwv\nrd\nqw\nls\nrr\nvt\nrx\nkc\neh\nnj\niq\nyi\nkh\nue\nnv\nkz\nrn\nes\nua\nzf\nvu\nll\neg\nmj\ncz\nzj\nxz\net\neb\nci\nih\nig\nam\nvd", "output": "YES" }, { "input": "ee\n100\nah\nfb\ncd\nbi\nii\nai\nid\nag\nie\nha\ndi\nec\nae\nce\njb\ndg\njg\ngd\ngf\nda\nih\nbd\nhj\ngg\nhb\ndf\ned\nfh\naf\nja\nci\nfc\nic\nji\nac\nhi\nfj\nch\nbc\njd\naa\nff\nad\ngj\nej\nde\nee\nhe\ncf\nga\nia\ncg\nbb\nhc\nbe\ngi\njf\nbg\naj\njj\nbh\nfe\ndj\nef\ngb\nge\ndb\nig\ncj\ndc\nij\njh\nei\ndd\nib\nhf\neg\nbf\nfg\nab\ngc\nfd\nhd\ngh\neh\njc\neb\nhh\nca\nje\nbj\nif\nea\nhg\nfa\ncc\nba\ndh\ncb\nfi", "output": "YES" }, { "input": "if\n100\njd\nbc\nje\nhi\nga\nde\nkb\nfc\ncd\ngd\naj\ncb\nei\nbf\ncf\ndk\ndb\ncg\nki\ngg\nkg\nfa\nkj\nii\njf\njg\ngb\nbh\nbg\neh\nhj\nhb\ndg\ndj\njc\njb\nce\ndi\nig\nci\ndf\nji\nhc\nfk\naf\nac\ngk\nhd\nae\nkd\nec\nkc\neb\nfh\nij\nie\nca\nhh\nkf\nha\ndd\nif\nef\nih\nhg\nej\nfe\njk\nea\nib\nck\nhf\nak\ngi\nch\ndc\nba\nke\nad\nka\neg\njh\nja\ngc\nfd\ncc\nab\ngj\nik\nfg\nbj\nhe\nfj\nge\ngh\nhk\nbk\ned\nid\nfi", "output": "YES" }, { "input": "kd\n100\nek\nea\nha\nkf\nkj\ngh\ndl\nfj\nal\nga\nlj\nik\ngd\nid\ncb\nfh\ndk\nif\nbh\nkb\nhc\nej\nhk\ngc\ngb\nef\nkk\nll\nlf\nkh\ncl\nlh\njj\nil\nhh\nci\ndb\ndf\ngk\njg\nch\nbd\ncg\nfg\nda\neb\nlg\ndg\nbk\nje\nbg\nbl\njl\ncj\nhb\nei\naa\ngl\nka\nfa\nfi\naf\nkc\nla\ngi\nij\nib\nle\ndi\nck\nag\nlc\nca\nge\nie\nlb\nke\nii\nae\nig\nic\nhe\ncf\nhd\nak\nfb\nhi\ngf\nad\nba\nhg\nbi\nkl\nac\ngg\ngj\nbe\nlk\nld\naj", "output": "YES" }, { "input": "ab\n1\nab", "output": "YES" }, { "input": "ya\n1\nya", "output": "YES" }, { "input": "ay\n1\nyb", "output": "NO" }, { "input": "ax\n2\nii\nxa", "output": "YES" }, { "input": "hi\n1\nhi", "output": "YES" }, { "input": "ag\n1\nag", "output": "YES" }, { "input": "th\n1\nth", "output": "YES" }, { "input": "sb\n1\nsb", "output": "YES" }, { "input": "hp\n1\nhp", "output": "YES" }, { "input": "ah\n1\nah", "output": "YES" }, { "input": "ta\n1\nta", "output": "YES" }, { "input": "tb\n1\ntb", "output": "YES" }, { "input": "ab\n5\nca\nda\nea\nfa\nka", "output": "NO" }, { "input": "ac\n1\nac", "output": "YES" }, { "input": "ha\n2\nha\nzz", "output": "YES" }, { "input": "ok\n1\nok", "output": "YES" }, { "input": "bc\n1\nbc", "output": "YES" }, { "input": "az\n1\nzz", "output": "NO" }, { "input": "ab\n2\nba\ntt", "output": "YES" }, { "input": "ah\n2\nap\nhp", "output": "NO" }, { "input": "sh\n1\nsh", "output": "YES" }, { "input": "az\n1\nby", "output": "NO" }, { "input": "as\n1\nas", "output": "YES" }, { "input": "ab\n2\nab\ncd", "output": "YES" }, { "input": "ab\n2\nxa\nza", "output": "NO" }, { "input": "ab\n2\net\nab", "output": "YES" }, { "input": "ab\n1\naa", "output": "NO" }, { "input": "ab\n2\nab\nde", "output": "YES" }, { "input": "ah\n2\nba\nha", "output": "YES" }, { "input": "ha\n3\ndd\ncc\nha", "output": "YES" }, { "input": "oo\n1\nox", "output": "NO" }, { "input": "ab\n2\nax\nbx", "output": "NO" }, { "input": "ww\n4\nuw\now\npo\nko", "output": "NO" }, { "input": "ay\n1\nay", "output": "YES" }, { "input": "yo\n1\nyo", "output": "YES" }, { "input": "ba\n1\nba", "output": "YES" }, { "input": "qw\n1\nqw", "output": "YES" }, { "input": "la\n1\nla", "output": "YES" }, { "input": "ab\n2\nbb\nbc", "output": "NO" }, { "input": "aa\n2\nab\nac", "output": "NO" }, { "input": "ah\n2\nbb\nha", "output": "YES" }, { "input": "ya\n42\nab\nac\nad\nae\naf\nag\nah\nai\nak\naj\nba\nbc\nbd\nbe\nbf\nbg\nbh\nbi\nbk\nbj\ncb\nca\ncd\nce\ncf\ncg\nch\nci\nck\ncj\ndb\ndc\nda\nde\ndf\ndg\ndh\ndi\ndk\ndj\nef\nek", "output": "NO" }, { "input": "ab\n3\nab\nxx\nyy", "output": "YES" }, { "input": "ab\n2\nab\ncc", "output": "YES" }, { "input": "sa\n2\nxx\nas", "output": "YES" }, { "input": "ma\n1\nma", "output": "YES" }, { "input": "ba\n1\nbb", "output": "NO" }, { "input": "bc\n1\nab", "output": "NO" }, { "input": "fa\n1\nfa", "output": "YES" }, { "input": "ap\n1\nap", "output": "YES" }, { "input": "ab\n1\nbb", "output": "NO" }, { "input": "bk\n1\nbk", "output": "YES" }, { "input": "xy\n2\nxy\naa", "output": "YES" }, { "input": "ab\n2\nza\nbz", "output": "YES" } ]
1,509,408,786
2,147,483,647
Python 3
OK
TESTS
90
62
0
#!/usr/bin/env first, last = input() num_words = int(input()) ending_first = False starting_last = False found = False for _ in range(num_words): wfirst, wlast = input() if wfirst == first and wlast == last: print('YES') found = True break if wlast == first: ending_first = True if wfirst == last: starting_last = True if ending_first and starting_last: print('YES') found = True break if not found: print('NO')
Title: Bark to Unlock Time Limit: None seconds Memory Limit: None megabytes Problem Description: As technologies develop, manufacturers are making the process of unlocking a phone as user-friendly as possible. To unlock its new phone, Arkady's pet dog Mu-mu has to bark the password once. The phone represents a password as a string of two lowercase English letters. Mu-mu's enemy Kashtanka wants to unlock Mu-mu's phone to steal some sensible information, but it can only bark *n* distinct words, each of which can be represented as a string of two lowercase English letters. Kashtanka wants to bark several words (not necessarily distinct) one after another to pronounce a string containing the password as a substring. Tell if it's possible to unlock the phone in this way, or not. Input Specification: The first line contains two lowercase English lettersΒ β€” the password on the phone. The second line contains single integer *n* (1<=≀<=*n*<=≀<=100)Β β€” the number of words Kashtanka knows. The next *n* lines contain two lowercase English letters each, representing the words Kashtanka knows. The words are guaranteed to be distinct. Output Specification: Print "YES" if Kashtanka can bark several words in a line forming a string containing the password, and "NO" otherwise. You can print each letter in arbitrary case (upper or lower). Demo Input: ['ya\n4\nah\noy\nto\nha\n', 'hp\n2\nht\ntp\n', 'ah\n1\nha\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n'] Note: In the first example the password is "ya", and Kashtanka can bark "oy" and then "ah", and then "ha" to form the string "oyahha" which contains the password. So, the answer is "YES". In the second example Kashtanka can't produce a string containing password as a substring. Note that it can bark "ht" and then "tp" producing "http", but it doesn't contain the password "hp" as a substring. In the third example the string "hahahaha" contains "ah" as a substring.
```python #!/usr/bin/env first, last = input() num_words = int(input()) ending_first = False starting_last = False found = False for _ in range(num_words): wfirst, wlast = input() if wfirst == first and wlast == last: print('YES') found = True break if wlast == first: ending_first = True if wfirst == last: starting_last = True if ending_first and starting_last: print('YES') found = True break if not found: print('NO') ```
3
581
A
Vasya the Hipster
PROGRAMMING
800
[ "implementation", "math" ]
null
null
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks. According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot. Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them. Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Can you help him?
The single line of the input contains two positive integers *a* and *b* (1<=≀<=*a*,<=*b*<=≀<=100) β€” the number of red and blue socks that Vasya's got.
Print two space-separated integers β€” the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
[ "3 1\n", "2 3\n", "7 3\n" ]
[ "1 1\n", "2 0\n", "3 2\n" ]
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
500
[ { "input": "3 1", "output": "1 1" }, { "input": "2 3", "output": "2 0" }, { "input": "7 3", "output": "3 2" }, { "input": "100 100", "output": "100 0" }, { "input": "4 10", "output": "4 3" }, { "input": "6 10", "output": "6 2" }, { "input": "6 11", "output": "6 2" }, { "input": "10 40", "output": "10 15" }, { "input": "11 56", "output": "11 22" }, { "input": "34 30", "output": "30 2" }, { "input": "33 33", "output": "33 0" }, { "input": "100 45", "output": "45 27" }, { "input": "100 23", "output": "23 38" }, { "input": "45 12", "output": "12 16" }, { "input": "1 1", "output": "1 0" }, { "input": "1 100", "output": "1 49" }, { "input": "100 1", "output": "1 49" }, { "input": "68 59", "output": "59 4" }, { "input": "45 99", "output": "45 27" }, { "input": "99 100", "output": "99 0" }, { "input": "100 98", "output": "98 1" }, { "input": "59 12", "output": "12 23" }, { "input": "86 4", "output": "4 41" }, { "input": "68 21", "output": "21 23" }, { "input": "100 11", "output": "11 44" }, { "input": "100 10", "output": "10 45" }, { "input": "15 45", "output": "15 15" }, { "input": "11 32", "output": "11 10" }, { "input": "34 96", "output": "34 31" }, { "input": "89 89", "output": "89 0" } ]
1,700,131,325
2,147,483,647
Python 3
OK
TESTS
30
46
0
a,b = map(int,input().split()) c = min(a,b) d = max(a,b) print(c,(d-c) // 2)
Title: Vasya the Hipster Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks. According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot. Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them. Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Can you help him? Input Specification: The single line of the input contains two positive integers *a* and *b* (1<=≀<=*a*,<=*b*<=≀<=100) β€” the number of red and blue socks that Vasya's got. Output Specification: Print two space-separated integers β€” the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got. Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day. Demo Input: ['3 1\n', '2 3\n', '7 3\n'] Demo Output: ['1 1\n', '2 0\n', '3 2\n'] Note: In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
```python a,b = map(int,input().split()) c = min(a,b) d = max(a,b) print(c,(d-c) // 2) ```
3
591
A
Wizards' Duel
PROGRAMMING
900
[ "implementation", "math" ]
null
null
Harry Potter and He-Who-Must-Not-Be-Named engaged in a fight to the death once again. This time they are located at opposite ends of the corridor of length *l*. Two opponents simultaneously charge a deadly spell in the enemy. We know that the impulse of Harry's magic spell flies at a speed of *p* meters per second, and the impulse of You-Know-Who's magic spell flies at a speed of *q* meters per second. The impulses are moving through the corridor toward each other, and at the time of the collision they turn round and fly back to those who cast them without changing their original speeds. Then, as soon as the impulse gets back to it's caster, the wizard reflects it and sends again towards the enemy, without changing the original speed of the impulse. Since Harry has perfectly mastered the basics of magic, he knows that after the second collision both impulses will disappear, and a powerful explosion will occur exactly in the place of their collision. However, the young wizard isn't good at math, so he asks you to calculate the distance from his position to the place of the second meeting of the spell impulses, provided that the opponents do not change positions during the whole fight.
The first line of the input contains a single integer *l* (1<=≀<=*l*<=≀<=1<=000)Β β€” the length of the corridor where the fight takes place. The second line contains integer *p*, the third line contains integer *q* (1<=≀<=*p*,<=*q*<=≀<=500)Β β€” the speeds of magical impulses for Harry Potter and He-Who-Must-Not-Be-Named, respectively.
Print a single real numberΒ β€” the distance from the end of the corridor, where Harry is located, to the place of the second meeting of the spell impulses. Your answer will be considered correct if its absolute or relative error will not exceed 10<=-<=4. Namely: let's assume that your answer equals *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if .
[ "100\n50\n50\n", "199\n60\n40\n" ]
[ "50\n", "119.4\n" ]
In the first sample the speeds of the impulses are equal, so both of their meetings occur exactly in the middle of the corridor.
500
[ { "input": "100\n50\n50", "output": "50" }, { "input": "199\n60\n40", "output": "119.4" }, { "input": "1\n1\n1", "output": "0.5" }, { "input": "1\n1\n500", "output": "0.001996007984" }, { "input": "1\n500\n1", "output": "0.998003992" }, { "input": "1\n500\n500", "output": "0.5" }, { "input": "1000\n1\n1", "output": "500" }, { "input": "1000\n1\n500", "output": "1.996007984" }, { "input": "1000\n500\n1", "output": "998.003992" }, { "input": "1000\n500\n500", "output": "500" }, { "input": "101\n11\n22", "output": "33.66666667" }, { "input": "987\n1\n3", "output": "246.75" }, { "input": "258\n25\n431", "output": "14.14473684" }, { "input": "979\n39\n60", "output": "385.6666667" }, { "input": "538\n479\n416", "output": "287.9351955" }, { "input": "583\n112\n248", "output": "181.3777778" }, { "input": "978\n467\n371", "output": "545.0190931" }, { "input": "980\n322\n193", "output": "612.7378641" }, { "input": "871\n401\n17", "output": "835.576555" }, { "input": "349\n478\n378", "output": "194.885514" }, { "input": "425\n458\n118", "output": "337.9340278" }, { "input": "919\n323\n458", "output": "380.0729834" }, { "input": "188\n59\n126", "output": "59.95675676" }, { "input": "644\n428\n484", "output": "302.2280702" }, { "input": "253\n80\n276", "output": "56.85393258" }, { "input": "745\n152\n417", "output": "199.0158172" }, { "input": "600\n221\n279", "output": "265.2" }, { "input": "690\n499\n430", "output": "370.6243272" }, { "input": "105\n68\n403", "output": "15.15923567" }, { "input": "762\n462\n371", "output": "422.6218487" }, { "input": "903\n460\n362", "output": "505.3284672" }, { "input": "886\n235\n95", "output": "630.9393939" }, { "input": "655\n203\n18", "output": "601.6515837" }, { "input": "718\n29\n375", "output": "51.53960396" }, { "input": "296\n467\n377", "output": "163.7819905" }, { "input": "539\n61\n56", "output": "281.017094" }, { "input": "133\n53\n124", "output": "39.82485876" }, { "input": "998\n224\n65", "output": "773.5363322" }, { "input": "961\n173\n47", "output": "755.6954545" }, { "input": "285\n468\n62", "output": "251.6603774" }, { "input": "496\n326\n429", "output": "214.1668874" }, { "input": "627\n150\n285", "output": "216.2068966" }, { "input": "961\n443\n50", "output": "863.535497" }, { "input": "623\n422\n217", "output": "411.4334898" }, { "input": "678\n295\n29", "output": "617.3148148" } ]
1,686,315,843
2,147,483,647
PyPy 3-64
OK
TESTS
45
62
0
import sys input = sys.stdin.readline n = int(input()) p = int(input()) q = int(input()) print(p / (p + q) * n)
Title: Wizards' Duel Time Limit: None seconds Memory Limit: None megabytes Problem Description: Harry Potter and He-Who-Must-Not-Be-Named engaged in a fight to the death once again. This time they are located at opposite ends of the corridor of length *l*. Two opponents simultaneously charge a deadly spell in the enemy. We know that the impulse of Harry's magic spell flies at a speed of *p* meters per second, and the impulse of You-Know-Who's magic spell flies at a speed of *q* meters per second. The impulses are moving through the corridor toward each other, and at the time of the collision they turn round and fly back to those who cast them without changing their original speeds. Then, as soon as the impulse gets back to it's caster, the wizard reflects it and sends again towards the enemy, without changing the original speed of the impulse. Since Harry has perfectly mastered the basics of magic, he knows that after the second collision both impulses will disappear, and a powerful explosion will occur exactly in the place of their collision. However, the young wizard isn't good at math, so he asks you to calculate the distance from his position to the place of the second meeting of the spell impulses, provided that the opponents do not change positions during the whole fight. Input Specification: The first line of the input contains a single integer *l* (1<=≀<=*l*<=≀<=1<=000)Β β€” the length of the corridor where the fight takes place. The second line contains integer *p*, the third line contains integer *q* (1<=≀<=*p*,<=*q*<=≀<=500)Β β€” the speeds of magical impulses for Harry Potter and He-Who-Must-Not-Be-Named, respectively. Output Specification: Print a single real numberΒ β€” the distance from the end of the corridor, where Harry is located, to the place of the second meeting of the spell impulses. Your answer will be considered correct if its absolute or relative error will not exceed 10<=-<=4. Namely: let's assume that your answer equals *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if . Demo Input: ['100\n50\n50\n', '199\n60\n40\n'] Demo Output: ['50\n', '119.4\n'] Note: In the first sample the speeds of the impulses are equal, so both of their meetings occur exactly in the middle of the corridor.
```python import sys input = sys.stdin.readline n = int(input()) p = int(input()) q = int(input()) print(p / (p + q) * n) ```
3
493
D
Vasya and Chess
PROGRAMMING
1,700
[ "constructive algorithms", "games", "math" ]
null
null
Vasya decided to learn to play chess. Classic chess doesn't seem interesting to him, so he plays his own sort of chess. The queen is the piece that captures all squares on its vertical, horizontal and diagonal lines. If the cell is located on the same vertical, horizontal or diagonal line with queen, and the cell contains a piece of the enemy color, the queen is able to move to this square. After that the enemy's piece is removed from the board. The queen cannot move to a cell containing an enemy piece if there is some other piece between it and the queen. There is an *n*<=Γ—<=*n* chessboard. We'll denote a cell on the intersection of the *r*-th row and *c*-th column as (*r*,<=*c*). The square (1,<=1) contains the white queen and the square (1,<=*n*) contains the black queen. All other squares contain green pawns that don't belong to anyone. The players move in turns. The player that moves first plays for the white queen, his opponent plays for the black queen. On each move the player has to capture some piece with his queen (that is, move to a square that contains either a green pawn or the enemy queen). The player loses if either he cannot capture any piece during his move or the opponent took his queen during the previous move. Help Vasya determine who wins if both players play with an optimal strategy on the board *n*<=Γ—<=*n*.
The input contains a single number *n* (2<=≀<=*n*<=≀<=109) β€” the size of the board.
On the first line print the answer to problem β€” string "white" or string "black", depending on who wins if the both players play optimally. If the answer is "white", then you should also print two integers *r* and *c* representing the cell (*r*,<=*c*), where the first player should make his first move to win. If there are multiple such cells, print the one with the minimum *r*. If there are still multiple squares, print the one with the minimum *c*.
[ "2\n", "3\n" ]
[ "white\n1 2\n", "black\n" ]
In the first sample test the white queen can capture the black queen at the first move, so the white player wins. In the second test from the statement if the white queen captures the green pawn located on the central vertical line, then it will be captured by the black queen during the next move. So the only move for the white player is to capture the green pawn located at (2, 1). Similarly, the black queen doesn't have any other options but to capture the green pawn located at (2, 3), otherwise if it goes to the middle vertical line, it will be captured by the white queen. During the next move the same thing happens β€” neither the white, nor the black queen has other options rather than to capture green pawns situated above them. Thus, the white queen ends up on square (3, 1), and the black queen ends up on square (3, 3). In this situation the white queen has to capture any of the green pawns located on the middle vertical line, after that it will be captured by the black queen. Thus, the player who plays for the black queen wins.
1,500
[ { "input": "2", "output": "white\n1 2" }, { "input": "3", "output": "black" }, { "input": "4", "output": "white\n1 2" }, { "input": "6", "output": "white\n1 2" }, { "input": "10", "output": "white\n1 2" }, { "input": "16", "output": "white\n1 2" }, { "input": "100", "output": "white\n1 2" }, { "input": "10006", "output": "white\n1 2" }, { "input": "99966246", "output": "white\n1 2" }, { "input": "1000000000", "output": "white\n1 2" }, { "input": "999999999", "output": "black" }, { "input": "999999997", "output": "black" }, { "input": "900001", "output": "black" }, { "input": "775681", "output": "black" }, { "input": "666666", "output": "white\n1 2" }, { "input": "12345", "output": "black" }, { "input": "111111", "output": "black" }, { "input": "346367", "output": "black" }, { "input": "13", "output": "black" }, { "input": "11", "output": "black" }, { "input": "9", "output": "black" }, { "input": "7", "output": "black" }, { "input": "5", "output": "black" }, { "input": "19", "output": "black" }, { "input": "939698497", "output": "black" }, { "input": "999999996", "output": "white\n1 2" } ]
1,597,889,658
2,147,483,647
Python 3
OK
TESTS
26
109
0
space_numbers = int(input()) if (space_numbers % 2 != 0): print("black") else: print("white") print("{} {}".format(1, 2))
Title: Vasya and Chess Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya decided to learn to play chess. Classic chess doesn't seem interesting to him, so he plays his own sort of chess. The queen is the piece that captures all squares on its vertical, horizontal and diagonal lines. If the cell is located on the same vertical, horizontal or diagonal line with queen, and the cell contains a piece of the enemy color, the queen is able to move to this square. After that the enemy's piece is removed from the board. The queen cannot move to a cell containing an enemy piece if there is some other piece between it and the queen. There is an *n*<=Γ—<=*n* chessboard. We'll denote a cell on the intersection of the *r*-th row and *c*-th column as (*r*,<=*c*). The square (1,<=1) contains the white queen and the square (1,<=*n*) contains the black queen. All other squares contain green pawns that don't belong to anyone. The players move in turns. The player that moves first plays for the white queen, his opponent plays for the black queen. On each move the player has to capture some piece with his queen (that is, move to a square that contains either a green pawn or the enemy queen). The player loses if either he cannot capture any piece during his move or the opponent took his queen during the previous move. Help Vasya determine who wins if both players play with an optimal strategy on the board *n*<=Γ—<=*n*. Input Specification: The input contains a single number *n* (2<=≀<=*n*<=≀<=109) β€” the size of the board. Output Specification: On the first line print the answer to problem β€” string "white" or string "black", depending on who wins if the both players play optimally. If the answer is "white", then you should also print two integers *r* and *c* representing the cell (*r*,<=*c*), where the first player should make his first move to win. If there are multiple such cells, print the one with the minimum *r*. If there are still multiple squares, print the one with the minimum *c*. Demo Input: ['2\n', '3\n'] Demo Output: ['white\n1 2\n', 'black\n'] Note: In the first sample test the white queen can capture the black queen at the first move, so the white player wins. In the second test from the statement if the white queen captures the green pawn located on the central vertical line, then it will be captured by the black queen during the next move. So the only move for the white player is to capture the green pawn located at (2, 1). Similarly, the black queen doesn't have any other options but to capture the green pawn located at (2, 3), otherwise if it goes to the middle vertical line, it will be captured by the white queen. During the next move the same thing happens β€” neither the white, nor the black queen has other options rather than to capture green pawns situated above them. Thus, the white queen ends up on square (3, 1), and the black queen ends up on square (3, 3). In this situation the white queen has to capture any of the green pawns located on the middle vertical line, after that it will be captured by the black queen. Thus, the player who plays for the black queen wins.
```python space_numbers = int(input()) if (space_numbers % 2 != 0): print("black") else: print("white") print("{} {}".format(1, 2)) ```
3
349
A
Cinema Line
PROGRAMMING
1,100
[ "greedy", "implementation" ]
null
null
The new "Die Hard" movie has just been released! There are *n* people at the cinema box office standing in a huge line. Each of them has a single 100, 50 or 25 ruble bill. A "Die Hard" ticket costs 25 rubles. Can the booking clerk sell a ticket to each person and give the change if he initially has no money and sells the tickets strictly in the order people follow in the line?
The first line contains integer *n* (1<=≀<=*n*<=≀<=105) β€” the number of people in the line. The next line contains *n* integers, each of them equals 25, 50 or 100 β€” the values of the bills the people have. The numbers are given in the order from the beginning of the line (at the box office) to the end of the line.
Print "YES" (without the quotes) if the booking clerk can sell a ticket to each person and give the change. Otherwise print "NO".
[ "4\n25 25 50 50\n", "2\n25 100\n", "4\n50 50 25 25\n" ]
[ "YES\n", "NO\n", "NO\n" ]
none
500
[ { "input": "4\n25 25 50 50", "output": "YES" }, { "input": "2\n25 100", "output": "NO" }, { "input": "4\n50 50 25 25", "output": "NO" }, { "input": "3\n25 50 100", "output": "NO" }, { "input": "10\n25 25 25 25 25 25 25 25 25 25", "output": "YES" }, { "input": "10\n50 50 50 50 50 50 50 50 50 50", "output": "NO" }, { "input": "10\n100 100 100 100 100 100 100 100 100 100", "output": "NO" }, { "input": "7\n25 25 25 25 50 100 50", "output": "YES" }, { "input": "2\n25 25", "output": "YES" }, { "input": "3\n50 100 100", "output": "NO" }, { "input": "3\n25 50 50", "output": "NO" }, { "input": "2\n50 25", "output": "NO" }, { "input": "14\n25 25 25 25 25 25 25 50 50 50 100 100 100 100", "output": "NO" }, { "input": "5\n25 25 25 100 100", "output": "NO" }, { "input": "7\n25 50 25 50 25 50 100", "output": "NO" }, { "input": "5\n25 50 25 50 100", "output": "NO" }, { "input": "5\n25 25 50 50 50", "output": "NO" }, { "input": "5\n25 25 50 100 50", "output": "NO" }, { "input": "5\n25 25 50 50 100", "output": "NO" }, { "input": "1\n50", "output": "NO" } ]
1,621,695,725
2,147,483,647
Python 3
OK
TESTS
40
280
5,324,800
n = int(input()) l = [int(i) for i in input() .split()] s1 = 0 s2 = 0 for i in range(n): k = l[i] - 25 if(k == 75 and s1 >= 1 and s2 >= 1): s1 -=1 s2-=1 elif(k == 75 and s1 >= 3): s1 -=3 elif(k == 25 and s1 >= 1): s1 -=1 elif(k == 0): s1 = s1 s2 = s2 else: print("NO") exit() if(l[i] == 50): s2+=1 elif(l[i] == 25): s1+=1 print("YES")
Title: Cinema Line Time Limit: None seconds Memory Limit: None megabytes Problem Description: The new "Die Hard" movie has just been released! There are *n* people at the cinema box office standing in a huge line. Each of them has a single 100, 50 or 25 ruble bill. A "Die Hard" ticket costs 25 rubles. Can the booking clerk sell a ticket to each person and give the change if he initially has no money and sells the tickets strictly in the order people follow in the line? Input Specification: The first line contains integer *n* (1<=≀<=*n*<=≀<=105) β€” the number of people in the line. The next line contains *n* integers, each of them equals 25, 50 or 100 β€” the values of the bills the people have. The numbers are given in the order from the beginning of the line (at the box office) to the end of the line. Output Specification: Print "YES" (without the quotes) if the booking clerk can sell a ticket to each person and give the change. Otherwise print "NO". Demo Input: ['4\n25 25 50 50\n', '2\n25 100\n', '4\n50 50 25 25\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none
```python n = int(input()) l = [int(i) for i in input() .split()] s1 = 0 s2 = 0 for i in range(n): k = l[i] - 25 if(k == 75 and s1 >= 1 and s2 >= 1): s1 -=1 s2-=1 elif(k == 75 and s1 >= 3): s1 -=3 elif(k == 25 and s1 >= 1): s1 -=1 elif(k == 0): s1 = s1 s2 = s2 else: print("NO") exit() if(l[i] == 50): s2+=1 elif(l[i] == 25): s1+=1 print("YES") ```
3
47
B
Coins
PROGRAMMING
1,200
[ "implementation" ]
B. Coins
2
256
One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal.
The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters Β«AΒ», Β«BΒ» and Β«CΒ». Each result is a line that appears as (letter)(&gt; or &lt; sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A&lt;B.
It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters Β«AΒ», Β«BΒ» and Β«CΒ» which represent the coins in the increasing order of their weights.
[ "A&gt;B\nC&lt;B\nA&gt;C\n", "A&lt;B\nB&gt;C\nC&gt;A\n" ]
[ "CBA", "ACB" ]
none
1,000
[ { "input": "A>B\nC<B\nA>C", "output": "CBA" }, { "input": "A<B\nB>C\nC>A", "output": "ACB" }, { "input": "A<C\nB<A\nB>C", "output": "Impossible" }, { "input": "A<B\nA<C\nB>C", "output": "ACB" }, { "input": "B>A\nC<B\nC>A", "output": "ACB" }, { "input": "A>B\nB>C\nC<A", "output": "CBA" }, { "input": "A>C\nA>B\nB<C", "output": "BCA" }, { "input": "C<B\nB>A\nA<C", "output": "ACB" }, { "input": "C<B\nA>B\nC<A", "output": "CBA" }, { "input": "C>B\nB>A\nA<C", "output": "ABC" }, { "input": "C<B\nB<A\nC>A", "output": "Impossible" }, { "input": "B<C\nC<A\nA>B", "output": "BCA" }, { "input": "A>B\nC<B\nC<A", "output": "CBA" }, { "input": "B>A\nC>B\nA>C", "output": "Impossible" }, { "input": "B<A\nC>B\nC>A", "output": "BAC" }, { "input": "A<B\nC>B\nA<C", "output": "ABC" }, { "input": "A<B\nC<A\nB<C", "output": "Impossible" }, { "input": "A>C\nC<B\nB>A", "output": "CAB" }, { "input": "C>A\nA<B\nB>C", "output": "ACB" }, { "input": "C>A\nC<B\nB>A", "output": "ACB" }, { "input": "B>C\nB>A\nA<C", "output": "ACB" }, { "input": "C<B\nC<A\nB<A", "output": "CBA" }, { "input": "A<C\nA<B\nB>C", "output": "ACB" }, { "input": "B>A\nA>C\nB>C", "output": "CAB" }, { "input": "B<A\nA<C\nC<B", "output": "Impossible" }, { "input": "A<C\nB>C\nA>B", "output": "Impossible" }, { "input": "B>A\nC<A\nC>B", "output": "Impossible" }, { "input": "A>C\nC>B\nB<A", "output": "BCA" }, { "input": "B<C\nB<A\nA>C", "output": "BCA" }, { "input": "A>B\nC>B\nA<C", "output": "BAC" }, { "input": "C<B\nC<A\nB<A", "output": "CBA" }, { "input": "A<C\nA>B\nB>C", "output": "Impossible" }, { "input": "B>A\nB>C\nA<C", "output": "ACB" }, { "input": "B>C\nC<A\nB<A", "output": "CBA" }, { "input": "C>A\nB>A\nB>C", "output": "ACB" }, { "input": "B<A\nB>C\nA<C", "output": "Impossible" }, { "input": "B<C\nA<B\nC>A", "output": "ABC" }, { "input": "C<B\nB>A\nA>C", "output": "CAB" }, { "input": "A>B\nC>A\nB<C", "output": "BAC" }, { "input": "A>B\nB>C\nC<A", "output": "CBA" }, { "input": "B>C\nC>A\nA>B", "output": "Impossible" }, { "input": "B<A\nB>C\nC<A", "output": "CBA" }, { "input": "C>B\nB>A\nC>A", "output": "ABC" }, { "input": "A>C\nA>B\nB>C", "output": "CBA" }, { "input": "B<C\nA>B\nA<C", "output": "BAC" }, { "input": "C>A\nC<B\nB>A", "output": "ACB" }, { "input": "C>B\nA<B\nC<A", "output": "Impossible" }, { "input": "A<C\nC<B\nA>B", "output": "Impossible" }, { "input": "B>C\nA<B\nA<C", "output": "ACB" }, { "input": "C>A\nA<B\nC>B", "output": "ABC" } ]
1,600,051,669
2,147,483,647
Python 3
OK
TESTS
50
218
307,200
order = [] for i in range(3): x = input() if(x[1] == ">"): order.append([x[2], x[0]]) else: order.append([x[0], x[2]]) ls = [] for p, row in enumerate(order): for q, col in enumerate(row): ls.append([col, q]) d = {"A": 0, "B": 0, "C": 0} for i in range(len(ls)): d[ls[i][0]] += ls[i][1] d = sorted(d.items(), key = lambda k: k[1]) if(d[2][1] == 2): print(d[0][0]+ d[1][0]+ d[2][0]) else: print("Impossible")
Title: Coins Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal. Input Specification: The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters Β«AΒ», Β«BΒ» and Β«CΒ». Each result is a line that appears as (letter)(&gt; or &lt; sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A&lt;B. Output Specification: It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters Β«AΒ», Β«BΒ» and Β«CΒ» which represent the coins in the increasing order of their weights. Demo Input: ['A&gt;B\nC&lt;B\nA&gt;C\n', 'A&lt;B\nB&gt;C\nC&gt;A\n'] Demo Output: ['CBA', 'ACB'] Note: none
```python order = [] for i in range(3): x = input() if(x[1] == ">"): order.append([x[2], x[0]]) else: order.append([x[0], x[2]]) ls = [] for p, row in enumerate(order): for q, col in enumerate(row): ls.append([col, q]) d = {"A": 0, "B": 0, "C": 0} for i in range(len(ls)): d[ls[i][0]] += ls[i][1] d = sorted(d.items(), key = lambda k: k[1]) if(d[2][1] == 2): print(d[0][0]+ d[1][0]+ d[2][0]) else: print("Impossible") ```
3.944928
441
A
Valera and Antique Items
PROGRAMMING
1,000
[ "implementation" ]
null
null
Valera is a collector. Once he wanted to expand his collection with exactly one antique item. Valera knows *n* sellers of antiques, the *i*-th of them auctioned *k**i* items. Currently the auction price of the *j*-th object of the *i*-th seller is *s**ij*. Valera gets on well with each of the *n* sellers. He is perfectly sure that if he outbids the current price of one of the items in the auction (in other words, offers the seller the money that is strictly greater than the current price of the item at the auction), the seller of the object will immediately sign a contract with him. Unfortunately, Valera has only *v* units of money. Help him to determine which of the *n* sellers he can make a deal with.
The first line contains two space-separated integers *n*,<=*v* (1<=≀<=*n*<=≀<=50;Β 104<=≀<=*v*<=≀<=106) β€” the number of sellers and the units of money the Valera has. Then *n* lines follow. The *i*-th line first contains integer *k**i* (1<=≀<=*k**i*<=≀<=50) the number of items of the *i*-th seller. Then go *k**i* space-separated integers *s**i*1,<=*s**i*2,<=...,<=*s**ik**i* (104<=≀<=*s**ij*<=≀<=106) β€” the current prices of the items of the *i*-th seller.
In the first line, print integer *p* β€” the number of sellers with who Valera can make a deal. In the second line print *p* space-separated integers *q*1,<=*q*2,<=...,<=*q**p* (1<=≀<=*q**i*<=≀<=*n*) β€” the numbers of the sellers with who Valera can make a deal. Print the numbers of the sellers in the increasing order.
[ "3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000\n", "3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000\n" ]
[ "3\n1 2 3\n", "0\n\n" ]
In the first sample Valera can bargain with each of the sellers. He can outbid the following items: a 40000 item from the first seller, a 20000 item from the second seller, and a 10000 item from the third seller. In the second sample Valera can not make a deal with any of the sellers, as the prices of all items in the auction too big for him.
500
[ { "input": "3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000", "output": "3\n1 2 3" }, { "input": "3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000", "output": "0" }, { "input": "2 100001\n1 895737\n1 541571", "output": "0" }, { "input": "1 1000000\n1 1000000", "output": "0" }, { "input": "1 1000000\n1 561774", "output": "1\n1" }, { "input": "3 1000000\n5 1000000 568832 1000000 1000000 1000000\n13 1000000 1000000 1000000 596527 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000\n20 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000", "output": "2\n1 2" }, { "input": "3 999999\n7 1000000 1000000 1000000 999999 1000000 999999 1000000\n6 999999 1000000 999999 1000000 999999 999999\n7 999999 1000000 1000000 999999 1000000 1000000 1000000", "output": "0" }, { "input": "3 999999\n22 1000000 1000000 999999 999999 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 999999 1000000 1000000 999999 1000000 1000000 1000000 352800 999999 1000000\n14 999999 999999 999999 999999 999999 1000000 999999 999999 999999 999999 702638 999999 1000000 999999\n5 999999 1000000 1000000 999999 363236", "output": "3\n1 2 3" }, { "input": "1 50001\n1 50000", "output": "1\n1" } ]
1,511,526,774
2,147,483,647
Python 3
OK
TESTS
26
92
6,144,000
# -*- coding: utf-8 -*- import math import collections import bisect import heapq import time import random import itertools import sys """ created by shhuan at 2017/11/24 20:29 """ N, K = map(int, input().split()) ans = [] for i in range(N): a = [int(x) for x in input().split()] if any(K > v for v in a[1:]): ans.append(i+1) print(len(ans)) if ans: print(" ".join(map(str, ans)))
Title: Valera and Antique Items Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera is a collector. Once he wanted to expand his collection with exactly one antique item. Valera knows *n* sellers of antiques, the *i*-th of them auctioned *k**i* items. Currently the auction price of the *j*-th object of the *i*-th seller is *s**ij*. Valera gets on well with each of the *n* sellers. He is perfectly sure that if he outbids the current price of one of the items in the auction (in other words, offers the seller the money that is strictly greater than the current price of the item at the auction), the seller of the object will immediately sign a contract with him. Unfortunately, Valera has only *v* units of money. Help him to determine which of the *n* sellers he can make a deal with. Input Specification: The first line contains two space-separated integers *n*,<=*v* (1<=≀<=*n*<=≀<=50;Β 104<=≀<=*v*<=≀<=106) β€” the number of sellers and the units of money the Valera has. Then *n* lines follow. The *i*-th line first contains integer *k**i* (1<=≀<=*k**i*<=≀<=50) the number of items of the *i*-th seller. Then go *k**i* space-separated integers *s**i*1,<=*s**i*2,<=...,<=*s**ik**i* (104<=≀<=*s**ij*<=≀<=106) β€” the current prices of the items of the *i*-th seller. Output Specification: In the first line, print integer *p* β€” the number of sellers with who Valera can make a deal. In the second line print *p* space-separated integers *q*1,<=*q*2,<=...,<=*q**p* (1<=≀<=*q**i*<=≀<=*n*) β€” the numbers of the sellers with who Valera can make a deal. Print the numbers of the sellers in the increasing order. Demo Input: ['3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000\n', '3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000\n'] Demo Output: ['3\n1 2 3\n', '0\n\n'] Note: In the first sample Valera can bargain with each of the sellers. He can outbid the following items: a 40000 item from the first seller, a 20000 item from the second seller, and a 10000 item from the third seller. In the second sample Valera can not make a deal with any of the sellers, as the prices of all items in the auction too big for him.
```python # -*- coding: utf-8 -*- import math import collections import bisect import heapq import time import random import itertools import sys """ created by shhuan at 2017/11/24 20:29 """ N, K = map(int, input().split()) ans = [] for i in range(N): a = [int(x) for x in input().split()] if any(K > v for v in a[1:]): ans.append(i+1) print(len(ans)) if ans: print(" ".join(map(str, ans))) ```
3
750
A
New Year and Hurry
PROGRAMMING
800
[ "binary search", "brute force", "implementation", "math" ]
null
null
Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5Β·*i* minutes to solve the *i*-th problem. Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first. How many problems can Limak solve if he wants to make it to the party?
The only line of the input contains two integers *n* and *k* (1<=≀<=*n*<=≀<=10, 1<=≀<=*k*<=≀<=240)Β β€” the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house.
Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier.
[ "3 222\n", "4 190\n", "7 1\n" ]
[ "2\n", "4\n", "7\n" ]
In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5 + 10 = 15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2. In the second sample, Limak can solve all 4 problems in 5 + 10 + 15 + 20 = 50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight. In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems.
500
[ { "input": "3 222", "output": "2" }, { "input": "4 190", "output": "4" }, { "input": "7 1", "output": "7" }, { "input": "10 135", "output": "6" }, { "input": "10 136", "output": "5" }, { "input": "1 1", "output": "1" }, { "input": "1 240", "output": "0" }, { "input": "10 1", "output": "9" }, { "input": "10 240", "output": "0" }, { "input": "9 240", "output": "0" }, { "input": "9 1", "output": "9" }, { "input": "9 235", "output": "1" }, { "input": "9 236", "output": "0" }, { "input": "5 225", "output": "2" }, { "input": "5 226", "output": "1" }, { "input": "4 210", "output": "3" }, { "input": "4 211", "output": "2" }, { "input": "4 191", "output": "3" }, { "input": "10 165", "output": "5" }, { "input": "10 166", "output": "4" }, { "input": "8 100", "output": "7" }, { "input": "8 101", "output": "6" }, { "input": "8 60", "output": "8" }, { "input": "8 61", "output": "7" }, { "input": "10 15", "output": "9" }, { "input": "10 16", "output": "8" }, { "input": "4 100", "output": "4" }, { "input": "4 101", "output": "4" }, { "input": "7 167", "output": "4" }, { "input": "10 164", "output": "5" }, { "input": "9 170", "output": "4" }, { "input": "8 160", "output": "5" }, { "input": "1 100", "output": "1" }, { "input": "8 123", "output": "6" }, { "input": "2 99", "output": "2" }, { "input": "10 88", "output": "7" }, { "input": "1 235", "output": "1" }, { "input": "1 1", "output": "1" }, { "input": "4 240", "output": "0" }, { "input": "1 55", "output": "1" }, { "input": "1 240", "output": "0" }, { "input": "3 240", "output": "0" }, { "input": "10 240", "output": "0" }, { "input": "2 240", "output": "0" }, { "input": "10 1", "output": "9" }, { "input": "9 1", "output": "9" }, { "input": "2 236", "output": "0" }, { "input": "10 2", "output": "9" }, { "input": "3 239", "output": "0" }, { "input": "1 237", "output": "0" }, { "input": "7 8", "output": "7" }, { "input": "10 235", "output": "1" } ]
1,679,519,771
2,147,483,647
Python 3
OK
TESTS
52
46
0
n,k=input().split() n=int(n);k=int(k) contest_period= 4*60 minutes_used=0 problems=0 sm=0 for i in range(1,n+1): minutes_used+=(i*5) sm=k + minutes_used if(sm <= contest_period): problems+=1 else: break print(problems)
Title: New Year and Hurry Time Limit: None seconds Memory Limit: None megabytes Problem Description: Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5Β·*i* minutes to solve the *i*-th problem. Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first. How many problems can Limak solve if he wants to make it to the party? Input Specification: The only line of the input contains two integers *n* and *k* (1<=≀<=*n*<=≀<=10, 1<=≀<=*k*<=≀<=240)Β β€” the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house. Output Specification: Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier. Demo Input: ['3 222\n', '4 190\n', '7 1\n'] Demo Output: ['2\n', '4\n', '7\n'] Note: In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5 + 10 = 15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2. In the second sample, Limak can solve all 4 problems in 5 + 10 + 15 + 20 = 50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight. In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems.
```python n,k=input().split() n=int(n);k=int(k) contest_period= 4*60 minutes_used=0 problems=0 sm=0 for i in range(1,n+1): minutes_used+=(i*5) sm=k + minutes_used if(sm <= contest_period): problems+=1 else: break print(problems) ```
3
677
A
Vanya and Fence
PROGRAMMING
800
[ "implementation" ]
null
null
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*. Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
The first line of the input contains two integers *n* and *h* (1<=≀<=*n*<=≀<=1000, 1<=≀<=*h*<=≀<=1000)Β β€” the number of friends and the height of the fence, respectively. The second line contains *n* integers *a**i* (1<=≀<=*a**i*<=≀<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
Print a single integerΒ β€” the minimum possible valid width of the road.
[ "3 7\n4 5 14\n", "6 1\n1 1 1 1 1 1\n", "6 5\n7 6 8 9 10 5\n" ]
[ "4\n", "6\n", "11\n" ]
In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4. In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough. In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
500
[ { "input": "3 7\n4 5 14", "output": "4" }, { "input": "6 1\n1 1 1 1 1 1", "output": "6" }, { "input": "6 5\n7 6 8 9 10 5", "output": "11" }, { "input": "10 420\n214 614 297 675 82 740 174 23 255 15", "output": "13" }, { "input": "10 561\n657 23 1096 487 785 66 481 554 1000 821", "output": "15" }, { "input": "100 342\n478 143 359 336 162 333 385 515 117 496 310 538 469 539 258 676 466 677 1 296 150 560 26 213 627 221 255 126 617 174 279 178 24 435 70 145 619 46 669 566 300 67 576 251 58 176 441 564 569 194 24 669 73 262 457 259 619 78 400 579 222 626 269 47 80 315 160 194 455 186 315 424 197 246 683 220 68 682 83 233 290 664 273 598 362 305 674 614 321 575 362 120 14 534 62 436 294 351 485 396", "output": "144" }, { "input": "100 290\n244 49 276 77 449 261 468 458 201 424 9 131 300 88 432 394 104 77 13 289 435 259 111 453 168 394 156 412 351 576 178 530 81 271 228 564 125 328 42 372 205 61 180 471 33 360 567 331 222 318 241 117 529 169 188 484 202 202 299 268 246 343 44 364 333 494 59 236 84 485 50 8 428 8 571 227 205 310 210 9 324 472 368 490 114 84 296 305 411 351 569 393 283 120 510 171 232 151 134 366", "output": "145" }, { "input": "1 1\n1", "output": "1" }, { "input": "1 1\n2", "output": "2" }, { "input": "46 71\n30 26 56 138 123 77 60 122 73 45 79 10 130 3 14 1 38 46 128 50 82 16 32 68 28 98 62 106 2 49 131 11 114 39 139 70 40 50 45 137 33 30 35 136 135 19", "output": "63" }, { "input": "20 723\n212 602 293 591 754 91 1135 640 80 495 845 928 1399 498 926 1431 1226 869 814 1386", "output": "31" }, { "input": "48 864\n843 1020 751 1694 18 1429 1395 1174 272 1158 1628 1233 1710 441 765 561 778 748 1501 1200 563 1263 1398 1687 1518 1640 1591 839 500 466 1603 1587 1201 1209 432 868 1159 639 649 628 9 91 1036 147 896 1557 941 518", "output": "75" }, { "input": "26 708\n549 241 821 734 945 1161 566 1268 216 30 1142 730 529 1014 255 168 796 1148 89 113 1328 286 743 871 1259 1397", "output": "41" }, { "input": "75 940\n1620 1745 1599 441 64 1466 1496 1239 1716 1475 778 106 1136 1212 1261 444 781 257 1071 747 626 232 609 1544 682 1326 469 1361 1460 1450 1207 1319 922 625 1737 1057 1698 592 692 80 1016 541 1254 201 682 1007 847 206 1066 809 259 109 240 1611 219 1455 1326 1377 1827 786 42 1002 1382 1592 543 1866 1198 334 1524 1760 340 1566 955 257 1118", "output": "116" } ]
1,692,743,235
2,147,483,647
Python 3
OK
TESTS
29
46
0
# https://codeforces.com/problemset/problem/677/A _, h_fence = map(int, input().split(" ")) heights = list(map(int, input().split(" "))) width = 0 for h in heights: if h <= h_fence: width += 1 else: width += 2 print(width)
Title: Vanya and Fence Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*. Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard? Input Specification: The first line of the input contains two integers *n* and *h* (1<=≀<=*n*<=≀<=1000, 1<=≀<=*h*<=≀<=1000)Β β€” the number of friends and the height of the fence, respectively. The second line contains *n* integers *a**i* (1<=≀<=*a**i*<=≀<=2*h*), the *i*-th of them is equal to the height of the *i*-th person. Output Specification: Print a single integerΒ β€” the minimum possible valid width of the road. Demo Input: ['3 7\n4 5 14\n', '6 1\n1 1 1 1 1 1\n', '6 5\n7 6 8 9 10 5\n'] Demo Output: ['4\n', '6\n', '11\n'] Note: In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4. In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough. In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
```python # https://codeforces.com/problemset/problem/677/A _, h_fence = map(int, input().split(" ")) heights = list(map(int, input().split(" "))) width = 0 for h in heights: if h <= h_fence: width += 1 else: width += 2 print(width) ```
3
785
A
Anton and Polyhedrons
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons: - Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces. All five kinds of polyhedrons are shown on the picture below: Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number!
The first line of the input contains a single integer *n* (1<=≀<=*n*<=≀<=200<=000)Β β€” the number of polyhedrons in Anton's collection. Each of the following *n* lines of the input contains a string *s**i*Β β€” the name of the *i*-th polyhedron in Anton's collection. The string can look like this: - "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron.
Output one numberΒ β€” the total number of faces in all the polyhedrons in Anton's collection.
[ "4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n", "3\nDodecahedron\nOctahedron\nOctahedron\n" ]
[ "42\n", "28\n" ]
In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces.
500
[ { "input": "4\nIcosahedron\nCube\nTetrahedron\nDodecahedron", "output": "42" }, { "input": "3\nDodecahedron\nOctahedron\nOctahedron", "output": "28" }, { "input": "25\nIcosahedron\nOctahedron\nTetrahedron\nDodecahedron\nCube\nIcosahedron\nOctahedron\nCube\nTetrahedron\nIcosahedron\nIcosahedron\nTetrahedron\nOctahedron\nDodecahedron\nIcosahedron\nOctahedron\nIcosahedron\nTetrahedron\nDodecahedron\nTetrahedron\nOctahedron\nCube\nCube\nDodecahedron\nTetrahedron", "output": "256" }, { "input": "1\nTetrahedron", "output": "4" }, { "input": "1\nCube", "output": "6" }, { "input": "1\nOctahedron", "output": "8" }, { "input": "1\nDodecahedron", "output": "12" }, { "input": "1\nIcosahedron", "output": "20" }, { "input": "28\nOctahedron\nDodecahedron\nOctahedron\nOctahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nDodecahedron\nDodecahedron\nCube\nDodecahedron\nCube\nTetrahedron\nCube\nCube\nTetrahedron\nDodecahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nIcosahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron", "output": "340" } ]
1,679,399,191
2,147,483,647
PyPy 3
OK
TESTS
30
1,513
14,028,800
a = int(input()) cnt = 0 l = [] for i in range(a): b = input() l.append(b) p = l.count("Tetrahedron") q = l.count("Cube") r = l.count("Octahedron") s = l.count("Dodecahedron") t = l.count("Icosahedron") cnt = p*4 + q*6 + r*8 + s*12 + t*20 print(cnt) # "Tetrahedron" (without quotes), if the i-th polyhedron in Anton's collection is a tetrahedron. # "Cube" (without quotes), if the i-th polyhedron in Anton's collection is a cube. # "Octahedron" (without quotes), if the i-th polyhedron in Anton's collection is an octahedron. # "Dodecahedron" (without quotes), if the i-th polyhedron in Anton's collection is a dodecahedron. # "Icosahedron" (without quotes), if the i-th polyhedron in Anton's collection is an icosahedron.
Title: Anton and Polyhedrons Time Limit: None seconds Memory Limit: None megabytes Problem Description: Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons: - Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces. All five kinds of polyhedrons are shown on the picture below: Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number! Input Specification: The first line of the input contains a single integer *n* (1<=≀<=*n*<=≀<=200<=000)Β β€” the number of polyhedrons in Anton's collection. Each of the following *n* lines of the input contains a string *s**i*Β β€” the name of the *i*-th polyhedron in Anton's collection. The string can look like this: - "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron. Output Specification: Output one numberΒ β€” the total number of faces in all the polyhedrons in Anton's collection. Demo Input: ['4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n', '3\nDodecahedron\nOctahedron\nOctahedron\n'] Demo Output: ['42\n', '28\n'] Note: In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces.
```python a = int(input()) cnt = 0 l = [] for i in range(a): b = input() l.append(b) p = l.count("Tetrahedron") q = l.count("Cube") r = l.count("Octahedron") s = l.count("Dodecahedron") t = l.count("Icosahedron") cnt = p*4 + q*6 + r*8 + s*12 + t*20 print(cnt) # "Tetrahedron" (without quotes), if the i-th polyhedron in Anton's collection is a tetrahedron. # "Cube" (without quotes), if the i-th polyhedron in Anton's collection is a cube. # "Octahedron" (without quotes), if the i-th polyhedron in Anton's collection is an octahedron. # "Dodecahedron" (without quotes), if the i-th polyhedron in Anton's collection is a dodecahedron. # "Icosahedron" (without quotes), if the i-th polyhedron in Anton's collection is an icosahedron. ```
3
259
A
Little Elephant and Chess
PROGRAMMING
1,000
[ "brute force", "strings" ]
null
null
The Little Elephant loves chess very much. One day the Little Elephant and his friend decided to play chess. They've got the chess pieces but the board is a problem. They've got an 8<=Γ—<=8 checkered board, each square is painted either black or white. The Little Elephant and his friend know that a proper chessboard doesn't have any side-adjacent cells with the same color and the upper left cell is white. To play chess, they want to make the board they have a proper chessboard. For that the friends can choose any row of the board and cyclically shift the cells of the chosen row, that is, put the last (rightmost) square on the first place in the row and shift the others one position to the right. You can run the described operation multiple times (or not run it at all). For example, if the first line of the board looks like that "BBBBBBWW" (the white cells of the line are marked with character "W", the black cells are marked with character "B"), then after one cyclic shift it will look like that "WBBBBBBW". Help the Little Elephant and his friend to find out whether they can use any number of the described operations to turn the board they have into a proper chessboard.
The input consists of exactly eight lines. Each line contains exactly eight characters "W" or "B" without any spaces: the *j*-th character in the *i*-th line stands for the color of the *j*-th cell of the *i*-th row of the elephants' board. Character "W" stands for the white color, character "B" stands for the black color. Consider the rows of the board numbered from 1 to 8 from top to bottom, and the columns β€” from 1 to 8 from left to right. The given board can initially be a proper chessboard.
In a single line print "YES" (without the quotes), if we can make the board a proper chessboard and "NO" (without the quotes) otherwise.
[ "WBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\n", "WBWBWBWB\nWBWBWBWB\nBBWBWWWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWWW\nBWBWBWBW\nBWBWBWBW\n" ]
[ "YES\n", "NO\n" ]
In the first sample you should shift the following lines one position to the right: the 3-rd, the 6-th, the 7-th and the 8-th. In the second sample there is no way you can achieve the goal.
500
[ { "input": "WBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB", "output": "YES" }, { "input": "WBWBWBWB\nWBWBWBWB\nBBWBWWWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWWW\nBWBWBWBW\nBWBWBWBW", "output": "NO" }, { "input": "BWBWBWBW\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB", "output": "YES" }, { "input": "BWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB", "output": "YES" }, { "input": "WBWBWBWB\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW", "output": "YES" }, { "input": "WBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB\nBWWWBWBW", "output": "NO" }, { "input": "BBBBBWWW\nWBBWBWWB\nWWWWWBWW\nBWBWWBWW\nBBBWWBWW\nBBBBBWBW\nWBBBWBWB\nWBWBWWWB", "output": "NO" }, { "input": "BWBWBWBW\nBWBWBWBW\nBWWWWWBB\nBBWBWBWB\nWBWBWBWB\nWWBWWBWW\nBWBWBWBW\nWBWWBBBB", "output": "NO" }, { "input": "WBWBWBWB\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nWBWWBWBB", "output": "NO" }, { "input": "WBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW", "output": "YES" }, { "input": "WBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW", "output": "YES" }, { "input": "WWWWBWWB\nBWBWBWBW\nBWBWBWBW\nWWBWBBBB\nBBWWBBBB\nBBBWWBBW\nBWWWWWWB\nBWWBBBWW", "output": "NO" }, { "input": "WBBWWBWB\nBBWBWBWB\nBWBWBWBW\nBWBWBWBW\nWBWBWBBW\nWBWBBBBW\nBWWWWBWB\nBBBBBBBW", "output": "NO" }, { "input": "BWBWBWBW\nBWBWBWBW\nBBWWWBBB\nWBBBBBWW\nWBBBBWBB\nWBWBWBWB\nWBWWBWWB\nWBBWBBWW", "output": "NO" }, { "input": "WBBBBBWB\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBBBBBWBB\nWBBWWBWB\nBWBWBWBW", "output": "NO" }, { "input": "BWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nWBBWWBWB", "output": "NO" }, { "input": "BWBWBWBW\nWBWBWBWB\nBWBWBWBW\nBWWWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBBW", "output": "NO" }, { "input": "WBWBWBWB\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW", "output": "YES" }, { "input": "BWBWBWBW\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW", "output": "YES" }, { "input": "BWBWBWBW\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW", "output": "YES" }, { "input": "WWBBWWBB\nBWWBBWWB\nBWBWBWBW\nWWBBWWWB\nWBWWWWBB\nWBWWBBWB\nBWBBWBWW\nBWBWWWWW", "output": "NO" }, { "input": "WBWBWBWB\nWBWBWBWB\nWWBBWBBB\nWBWBWBWB\nWWWWBWWB\nWBBBBWWW\nBWBWWWBW\nWWWBWBBB", "output": "NO" }, { "input": "WBWBWBWB\nBWWBWWWW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nWWBBBBBW\nWWWBWWBW\nWWBBBBWW", "output": "NO" }, { "input": "BWBWBWBW\nBWBBBWWB\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW", "output": "NO" }, { "input": "BWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW", "output": "YES" }, { "input": "BBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB\nWWWWWWWW\nWWWWWWWW\nWWWWWWWW\nWWWWWWWW", "output": "NO" }, { "input": "BBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB", "output": "NO" }, { "input": "BWBWBWBB\nBWBWBWBB\nBWBWBWBB\nBWBWBWBB\nBWBWBWBB\nBWBWBWBB\nBWBWBWBB\nBWBWBWBB", "output": "NO" }, { "input": "WWBWWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW", "output": "NO" }, { "input": "WWWWWWWW\nBBBBBBBB\nWWWWWWWW\nBBBBBBBB\nWWWWWWWW\nBBBBBBBB\nWWWWWWWW\nBBBBBBBB", "output": "NO" }, { "input": "BBBBBBBB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB", "output": "NO" }, { "input": "BBBBBBBW\nBBBBBBBW\nBBBBBBBW\nBBBBBBBW\nBBBBBBBW\nBBBBBBBW\nBBBBBBBW\nBBBBBBBW", "output": "NO" }, { "input": "BBBWWWWW\nWWWBBBBB\nBBBWWWWW\nWWWBBBBB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB", "output": "NO" } ]
1,500,577,267
2,147,483,647
Python 3
OK
TESTS
33
122
4,608,000
def proper(line): current = line[0] for j in range(1, len(line)): if line[j] == current: return False else: current = line[j] return True answer = "YES" for i in range(8): if not proper(input()): answer = "NO" print(answer)
Title: Little Elephant and Chess Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Little Elephant loves chess very much. One day the Little Elephant and his friend decided to play chess. They've got the chess pieces but the board is a problem. They've got an 8<=Γ—<=8 checkered board, each square is painted either black or white. The Little Elephant and his friend know that a proper chessboard doesn't have any side-adjacent cells with the same color and the upper left cell is white. To play chess, they want to make the board they have a proper chessboard. For that the friends can choose any row of the board and cyclically shift the cells of the chosen row, that is, put the last (rightmost) square on the first place in the row and shift the others one position to the right. You can run the described operation multiple times (or not run it at all). For example, if the first line of the board looks like that "BBBBBBWW" (the white cells of the line are marked with character "W", the black cells are marked with character "B"), then after one cyclic shift it will look like that "WBBBBBBW". Help the Little Elephant and his friend to find out whether they can use any number of the described operations to turn the board they have into a proper chessboard. Input Specification: The input consists of exactly eight lines. Each line contains exactly eight characters "W" or "B" without any spaces: the *j*-th character in the *i*-th line stands for the color of the *j*-th cell of the *i*-th row of the elephants' board. Character "W" stands for the white color, character "B" stands for the black color. Consider the rows of the board numbered from 1 to 8 from top to bottom, and the columns β€” from 1 to 8 from left to right. The given board can initially be a proper chessboard. Output Specification: In a single line print "YES" (without the quotes), if we can make the board a proper chessboard and "NO" (without the quotes) otherwise. Demo Input: ['WBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\n', 'WBWBWBWB\nWBWBWBWB\nBBWBWWWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWWW\nBWBWBWBW\nBWBWBWBW\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample you should shift the following lines one position to the right: the 3-rd, the 6-th, the 7-th and the 8-th. In the second sample there is no way you can achieve the goal.
```python def proper(line): current = line[0] for j in range(1, len(line)): if line[j] == current: return False else: current = line[j] return True answer = "YES" for i in range(8): if not proper(input()): answer = "NO" print(answer) ```
3
6
A
Triangle
PROGRAMMING
900
[ "brute force", "geometry" ]
A. Triangle
2
64
Johnny has a younger sister Anne, who is very clever and smart. As she came home from the kindergarten, she told his brother about the task that her kindergartener asked her to solve. The task was just to construct a triangle out of four sticks of different colours. Naturally, one of the sticks is extra. It is not allowed to break the sticks or use their partial length. Anne has perfectly solved this task, now she is asking Johnny to do the same. The boy answered that he would cope with it without any difficulty. However, after a while he found out that different tricky things can occur. It can happen that it is impossible to construct a triangle of a positive area, but it is possible to construct a degenerate triangle. It can be so, that it is impossible to construct a degenerate triangle even. As Johnny is very lazy, he does not want to consider such a big amount of cases, he asks you to help him.
The first line of the input contains four space-separated positive integer numbers not exceeding 100 β€” lengthes of the sticks.
Output TRIANGLE if it is possible to construct a non-degenerate triangle. Output SEGMENT if the first case cannot take place and it is possible to construct a degenerate triangle. Output IMPOSSIBLE if it is impossible to construct any triangle. Remember that you are to use three sticks. It is not allowed to break the sticks or use their partial length.
[ "4 2 1 3\n", "7 2 2 4\n", "3 5 9 1\n" ]
[ "TRIANGLE\n", "SEGMENT\n", "IMPOSSIBLE\n" ]
none
0
[ { "input": "4 2 1 3", "output": "TRIANGLE" }, { "input": "7 2 2 4", "output": "SEGMENT" }, { "input": "3 5 9 1", "output": "IMPOSSIBLE" }, { "input": "3 1 5 1", "output": "IMPOSSIBLE" }, { "input": "10 10 10 10", "output": "TRIANGLE" }, { "input": "11 5 6 11", "output": "TRIANGLE" }, { "input": "1 1 1 1", "output": "TRIANGLE" }, { "input": "10 20 30 40", "output": "TRIANGLE" }, { "input": "45 25 5 15", "output": "IMPOSSIBLE" }, { "input": "20 5 8 13", "output": "TRIANGLE" }, { "input": "10 30 7 20", "output": "SEGMENT" }, { "input": "3 2 3 2", "output": "TRIANGLE" }, { "input": "70 10 100 30", "output": "SEGMENT" }, { "input": "4 8 16 2", "output": "IMPOSSIBLE" }, { "input": "3 3 3 10", "output": "TRIANGLE" }, { "input": "1 5 5 5", "output": "TRIANGLE" }, { "input": "13 25 12 1", "output": "SEGMENT" }, { "input": "10 100 7 3", "output": "SEGMENT" }, { "input": "50 1 50 100", "output": "TRIANGLE" }, { "input": "50 1 100 49", "output": "SEGMENT" }, { "input": "49 51 100 1", "output": "SEGMENT" }, { "input": "5 11 2 25", "output": "IMPOSSIBLE" }, { "input": "91 50 9 40", "output": "IMPOSSIBLE" }, { "input": "27 53 7 97", "output": "IMPOSSIBLE" }, { "input": "51 90 24 8", "output": "IMPOSSIBLE" }, { "input": "3 5 1 1", "output": "IMPOSSIBLE" }, { "input": "13 49 69 15", "output": "IMPOSSIBLE" }, { "input": "16 99 9 35", "output": "IMPOSSIBLE" }, { "input": "27 6 18 53", "output": "IMPOSSIBLE" }, { "input": "57 88 17 8", "output": "IMPOSSIBLE" }, { "input": "95 20 21 43", "output": "IMPOSSIBLE" }, { "input": "6 19 32 61", "output": "IMPOSSIBLE" }, { "input": "100 21 30 65", "output": "IMPOSSIBLE" }, { "input": "85 16 61 9", "output": "IMPOSSIBLE" }, { "input": "5 6 19 82", "output": "IMPOSSIBLE" }, { "input": "1 5 1 3", "output": "IMPOSSIBLE" }, { "input": "65 10 36 17", "output": "IMPOSSIBLE" }, { "input": "81 64 9 7", "output": "IMPOSSIBLE" }, { "input": "11 30 79 43", "output": "IMPOSSIBLE" }, { "input": "1 1 5 3", "output": "IMPOSSIBLE" }, { "input": "21 94 61 31", "output": "IMPOSSIBLE" }, { "input": "49 24 9 74", "output": "IMPOSSIBLE" }, { "input": "11 19 5 77", "output": "IMPOSSIBLE" }, { "input": "52 10 19 71", "output": "SEGMENT" }, { "input": "2 3 7 10", "output": "SEGMENT" }, { "input": "1 2 6 3", "output": "SEGMENT" }, { "input": "2 6 1 8", "output": "SEGMENT" }, { "input": "1 2 4 1", "output": "SEGMENT" }, { "input": "4 10 6 2", "output": "SEGMENT" }, { "input": "2 10 7 3", "output": "SEGMENT" }, { "input": "5 2 3 9", "output": "SEGMENT" }, { "input": "6 1 4 10", "output": "SEGMENT" }, { "input": "10 6 4 1", "output": "SEGMENT" }, { "input": "3 2 9 1", "output": "SEGMENT" }, { "input": "22 80 29 7", "output": "SEGMENT" }, { "input": "2 6 3 9", "output": "SEGMENT" }, { "input": "3 1 2 1", "output": "SEGMENT" }, { "input": "3 4 7 1", "output": "SEGMENT" }, { "input": "8 4 3 1", "output": "SEGMENT" }, { "input": "2 8 3 5", "output": "SEGMENT" }, { "input": "4 1 2 1", "output": "SEGMENT" }, { "input": "8 1 3 2", "output": "SEGMENT" }, { "input": "6 2 1 8", "output": "SEGMENT" }, { "input": "3 3 3 6", "output": "TRIANGLE" }, { "input": "3 6 3 3", "output": "TRIANGLE" }, { "input": "4 10 4 4", "output": "TRIANGLE" }, { "input": "1 1 2 1", "output": "TRIANGLE" }, { "input": "3 3 3 6", "output": "TRIANGLE" }, { "input": "5 4 5 5", "output": "TRIANGLE" }, { "input": "8 7 8 8", "output": "TRIANGLE" }, { "input": "3 3 3 1", "output": "TRIANGLE" }, { "input": "1 1 6 6", "output": "TRIANGLE" }, { "input": "1 9 1 9", "output": "TRIANGLE" }, { "input": "7 2 2 7", "output": "TRIANGLE" }, { "input": "7 2 3 2", "output": "TRIANGLE" }, { "input": "4 4 10 10", "output": "TRIANGLE" }, { "input": "7 7 10 7", "output": "TRIANGLE" }, { "input": "4 4 4 5", "output": "TRIANGLE" }, { "input": "1 10 9 2", "output": "TRIANGLE" }, { "input": "1 8 2 7", "output": "TRIANGLE" }, { "input": "4 3 2 8", "output": "TRIANGLE" }, { "input": "5 9 5 3", "output": "TRIANGLE" }, { "input": "4 10 3 5", "output": "TRIANGLE" } ]
1,622,023,762
2,147,483,647
Python 3
OK
TESTS
83
154
0
a,b,c,d=map(int,input().split()) def T(p,q,r): if p+q>r and q+r>p and p+r>q : return True else: return False def S(p,q,r): if p+q==r or q+r==p or p+r==q : return True else: return False if T(a,b,c) or T(b,c,d) or T(c,d,a) or T(a,b,d) : print("TRIANGLE") elif S(a,b,c) or S(b,c,d) or S(c,d,a) or S(a,b,d) : print("SEGMENT") else: print("IMPOSSIBLE")
Title: Triangle Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: Johnny has a younger sister Anne, who is very clever and smart. As she came home from the kindergarten, she told his brother about the task that her kindergartener asked her to solve. The task was just to construct a triangle out of four sticks of different colours. Naturally, one of the sticks is extra. It is not allowed to break the sticks or use their partial length. Anne has perfectly solved this task, now she is asking Johnny to do the same. The boy answered that he would cope with it without any difficulty. However, after a while he found out that different tricky things can occur. It can happen that it is impossible to construct a triangle of a positive area, but it is possible to construct a degenerate triangle. It can be so, that it is impossible to construct a degenerate triangle even. As Johnny is very lazy, he does not want to consider such a big amount of cases, he asks you to help him. Input Specification: The first line of the input contains four space-separated positive integer numbers not exceeding 100 β€” lengthes of the sticks. Output Specification: Output TRIANGLE if it is possible to construct a non-degenerate triangle. Output SEGMENT if the first case cannot take place and it is possible to construct a degenerate triangle. Output IMPOSSIBLE if it is impossible to construct any triangle. Remember that you are to use three sticks. It is not allowed to break the sticks or use their partial length. Demo Input: ['4 2 1 3\n', '7 2 2 4\n', '3 5 9 1\n'] Demo Output: ['TRIANGLE\n', 'SEGMENT\n', 'IMPOSSIBLE\n'] Note: none
```python a,b,c,d=map(int,input().split()) def T(p,q,r): if p+q>r and q+r>p and p+r>q : return True else: return False def S(p,q,r): if p+q==r or q+r==p or p+r==q : return True else: return False if T(a,b,c) or T(b,c,d) or T(c,d,a) or T(a,b,d) : print("TRIANGLE") elif S(a,b,c) or S(b,c,d) or S(c,d,a) or S(a,b,d) : print("SEGMENT") else: print("IMPOSSIBLE") ```
3.9615
538
B
Quasi Binary
PROGRAMMING
1,400
[ "constructive algorithms", "dp", "greedy", "implementation" ]
null
null
A number is called quasibinary if its decimal representation contains only digits 0 or 1. For example, numbers 0, 1, 101, 110011Β β€” are quasibinary and numbers 2, 12, 900 are not. You are given a positive integer *n*. Represent it as a sum of minimum number of quasibinary numbers.
The first line contains a single integer *n* (1<=≀<=*n*<=≀<=106).
In the first line print a single integer *k*Β β€” the minimum number of numbers in the representation of number *n* as a sum of quasibinary numbers. In the second line print *k* numbers β€” the elements of the sum. All these numbers should be quasibinary according to the definition above, their sum should equal *n*. Do not have to print the leading zeroes in the numbers. The order of numbers doesn't matter. If there are multiple possible representations, you are allowed to print any of them.
[ "9\n", "32\n" ]
[ "9\n1 1 1 1 1 1 1 1 1 \n", "3\n10 11 11 \n" ]
none
1,000
[ { "input": "9", "output": "9\n1 1 1 1 1 1 1 1 1 " }, { "input": "32", "output": "3\n10 11 11 " }, { "input": "1", "output": "1\n1 " }, { "input": "415", "output": "5\n1 101 101 101 111 " }, { "input": "10011", "output": "1\n10011 " }, { "input": "10201", "output": "2\n100 10101 " }, { "input": "314159", "output": "9\n1 1 1 1 11 1011 101011 101011 111111 " }, { "input": "999999", "output": "9\n111111 111111 111111 111111 111111 111111 111111 111111 111111 " }, { "input": "2", "output": "2\n1 1 " }, { "input": "10", "output": "1\n10 " }, { "input": "21", "output": "2\n10 11 " }, { "input": "98", "output": "9\n10 11 11 11 11 11 11 11 11 " }, { "input": "102030", "output": "3\n10 1010 101010 " }, { "input": "909090", "output": "9\n101010 101010 101010 101010 101010 101010 101010 101010 101010 " }, { "input": "909823", "output": "9\n101000 101100 101100 101100 101100 101100 101101 101111 101111 " }, { "input": "1000000", "output": "1\n1000000 " }, { "input": "111111", "output": "1\n111111 " }, { "input": "123456", "output": "6\n1 11 111 1111 11111 111111 " }, { "input": "987654", "output": "9\n100000 110000 111000 111100 111110 111111 111111 111111 111111 " }, { "input": "908172", "output": "9\n100000 101000 101010 101010 101010 101010 101010 101011 101111 " }, { "input": "8", "output": "8\n1 1 1 1 1 1 1 1 " }, { "input": "100009", "output": "9\n1 1 1 1 1 1 1 1 100001 " }, { "input": "900000", "output": "9\n100000 100000 100000 100000 100000 100000 100000 100000 100000 " }, { "input": "1435", "output": "5\n1 101 111 111 1111 " }, { "input": "1453", "output": "5\n10 110 111 111 1111 " } ]
1,630,235,191
2,147,483,647
PyPy 3
OK
TESTS
25
109
20,172,800
def min_pos(arr): min_number = 10 min_index = 0 for i in range(len(arr)): if arr[i] != 0 and arr[i] < min_number: min_number = arr[i] min_index = i return min_number, min_index n = list(map(int, input())) max_number = max(n) res = [] ptr = 0 for _ in range(len(n)): min_number = min_pos(n)[0] min_index = min_pos(n)[1] for i in range(min_number): new_string = '' for j in range(len(n)): if n[j] != 0: new_string += '1' n[j] -= 1 else: new_string += '0' res.append(new_string) res = list(map(int, res)) new_res = [x for x in res if x != 0] print(max_number) print(*new_res)
Title: Quasi Binary Time Limit: None seconds Memory Limit: None megabytes Problem Description: A number is called quasibinary if its decimal representation contains only digits 0 or 1. For example, numbers 0, 1, 101, 110011Β β€” are quasibinary and numbers 2, 12, 900 are not. You are given a positive integer *n*. Represent it as a sum of minimum number of quasibinary numbers. Input Specification: The first line contains a single integer *n* (1<=≀<=*n*<=≀<=106). Output Specification: In the first line print a single integer *k*Β β€” the minimum number of numbers in the representation of number *n* as a sum of quasibinary numbers. In the second line print *k* numbers β€” the elements of the sum. All these numbers should be quasibinary according to the definition above, their sum should equal *n*. Do not have to print the leading zeroes in the numbers. The order of numbers doesn't matter. If there are multiple possible representations, you are allowed to print any of them. Demo Input: ['9\n', '32\n'] Demo Output: ['9\n1 1 1 1 1 1 1 1 1 \n', '3\n10 11 11 \n'] Note: none
```python def min_pos(arr): min_number = 10 min_index = 0 for i in range(len(arr)): if arr[i] != 0 and arr[i] < min_number: min_number = arr[i] min_index = i return min_number, min_index n = list(map(int, input())) max_number = max(n) res = [] ptr = 0 for _ in range(len(n)): min_number = min_pos(n)[0] min_index = min_pos(n)[1] for i in range(min_number): new_string = '' for j in range(len(n)): if n[j] != 0: new_string += '1' n[j] -= 1 else: new_string += '0' res.append(new_string) res = list(map(int, res)) new_res = [x for x in res if x != 0] print(max_number) print(*new_res) ```
3
285
C
Building Permutation
PROGRAMMING
1,200
[ "greedy", "implementation", "sortings" ]
null
null
Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*. You have a sequence of integers *a*1,<=*a*2,<=...,<=*a**n*. In one move, you are allowed to decrease or increase any number by one. Count the minimum number of moves, needed to build a permutation from this sequence.
The first line contains integer *n* (1<=≀<=*n*<=≀<=3Β·105) β€” the size of the sought permutation. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=109<=≀<=*a**i*<=≀<=109).
Print a single number β€” the minimum number of moves. Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
[ "2\n3 0\n", "3\n-1 -1 2\n" ]
[ "2\n", "6\n" ]
In the first sample you should decrease the first number by one and then increase the second number by one. The resulting permutation is (2, 1). In the second sample you need 6 moves to build permutation (1, 3, 2).
1,500
[ { "input": "2\n3 0", "output": "2" }, { "input": "3\n-1 -1 2", "output": "6" }, { "input": "5\n-3 5 -3 3 3", "output": "10" }, { "input": "10\n9 6 -2 4 1 1 1 9 6 2", "output": "18" }, { "input": "9\n2 0 0 6 5 4 1 9 3", "output": "15" }, { "input": "100\n-77 57 -95 -23 53 -28 82 -83 38 -73 85 28 25 6 -43 4 -10 -30 -9 -92 14 34 -93 61 36 -100 90 -68 28 16 100 -3 97 30 36 -55 62 -62 53 74 -50 -23 67 11 22 -30 -19 83 7 84 43 90 -65 -75 -15 97 90 15 66 2 13 -91 91 -44 46 51 51 -58 95 77 20 30 76 79 91 60 76 2 82 42 -93 94 -57 88 65 -95 -66 100 -9 33 -67 54 -99 97 53 13 54 66 60 -48", "output": "3459" } ]
1,588,464,544
2,147,483,647
PyPy 3
OK
TESTS
33
483
25,395,200
n = int(input()) arr = list(map(int, input().split())) arr.sort() print(sum(abs(x - i - 1) for i, x in enumerate(arr)))
Title: Building Permutation Time Limit: None seconds Memory Limit: None megabytes Problem Description: Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*. You have a sequence of integers *a*1,<=*a*2,<=...,<=*a**n*. In one move, you are allowed to decrease or increase any number by one. Count the minimum number of moves, needed to build a permutation from this sequence. Input Specification: The first line contains integer *n* (1<=≀<=*n*<=≀<=3Β·105) β€” the size of the sought permutation. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=109<=≀<=*a**i*<=≀<=109). Output Specification: Print a single number β€” the minimum number of moves. Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier. Demo Input: ['2\n3 0\n', '3\n-1 -1 2\n'] Demo Output: ['2\n', '6\n'] Note: In the first sample you should decrease the first number by one and then increase the second number by one. The resulting permutation is (2, 1). In the second sample you need 6 moves to build permutation (1, 3, 2).
```python n = int(input()) arr = list(map(int, input().split())) arr.sort() print(sum(abs(x - i - 1) for i, x in enumerate(arr))) ```
3