contestId
int64 0
1.01k
| index
stringclasses 40
values | name
stringlengths 2
54
| type
stringclasses 2
values | rating
int64 0
3.4k
| tags
listlengths 0
7
| title
stringclasses 393
values | time-limit
stringclasses 7
values | memory-limit
stringclasses 6
values | problem-description
stringlengths 0
2.97k
| input-specification
stringlengths 4
1.87k
| output-specification
stringlengths 4
1.12k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
3.5k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 1
value | testset
stringclasses 9
values | passedTestCount
int64 1
402
| timeConsumedMillis
int64 15
8.06k
| memoryConsumedBytes
int64 0
514M
| code
stringlengths 11
61.4k
| prompt
stringlengths 297
7.35k
| response
stringlengths 25
61.4k
| score
float64 2.82
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
898
|
B
|
Proper Nutrition
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation",
"number theory"
] | null | null |
Vasya has *n* burles. One bottle of Ber-Cola costs *a* burles and one Bars bar costs *b* burles. He can buy any non-negative integer number of bottles of Ber-Cola and any non-negative integer number of Bars bars.
Find out if it's possible to buy some amount of bottles of Ber-Cola and Bars bars and spend exactly *n* burles.
In other words, you should find two non-negative integers *x* and *y* such that Vasya can buy *x* bottles of Ber-Cola and *y* Bars bars and *x*·*a*<=+<=*y*·*b*<==<=*n* or tell that it's impossible.
|
First line contains single integer *n* (1<=≤<=*n*<=≤<=10<=000<=000) — amount of money, that Vasya has.
Second line contains single integer *a* (1<=≤<=*a*<=≤<=10<=000<=000) — cost of one bottle of Ber-Cola.
Third line contains single integer *b* (1<=≤<=*b*<=≤<=10<=000<=000) — cost of one Bars bar.
|
If Vasya can't buy Bars and Ber-Cola in such a way to spend exactly *n* burles print «NO» (without quotes).
Otherwise in first line print «YES» (without quotes). In second line print two non-negative integers *x* and *y* — number of bottles of Ber-Cola and number of Bars bars Vasya should buy in order to spend exactly *n* burles, i.e. *x*·*a*<=+<=*y*·*b*<==<=*n*. If there are multiple answers print any of them.
Any of numbers *x* and *y* can be equal 0.
|
[
"7\n2\n3\n",
"100\n25\n10\n",
"15\n4\n8\n",
"9960594\n2551\n2557\n"
] |
[
"YES\n2 1\n",
"YES\n0 10\n",
"NO\n",
"YES\n1951 1949\n"
] |
In first example Vasya can buy two bottles of Ber-Cola and one Bars bar. He will spend exactly 2·2 + 1·3 = 7 burles.
In second example Vasya can spend exactly *n* burles multiple ways:
- buy two bottles of Ber-Cola and five Bars bars; - buy four bottles of Ber-Cola and don't buy Bars bars; - don't buy Ber-Cola and buy 10 Bars bars.
In third example it's impossible to but Ber-Cola and Bars bars in order to spend exactly *n* burles.
| 750
|
[
{
"input": "7\n2\n3",
"output": "YES\n2 1"
},
{
"input": "100\n25\n10",
"output": "YES\n0 10"
},
{
"input": "15\n4\n8",
"output": "NO"
},
{
"input": "9960594\n2551\n2557",
"output": "YES\n1951 1949"
},
{
"input": "10000000\n1\n1",
"output": "YES\n0 10000000"
},
{
"input": "9999999\n9999\n9999",
"output": "NO"
},
{
"input": "9963629\n2591\n2593",
"output": "YES\n635 3208"
},
{
"input": "1\n7\n8",
"output": "NO"
},
{
"input": "9963630\n2591\n2593",
"output": "YES\n1931 1913"
},
{
"input": "7516066\n1601\n4793",
"output": "YES\n4027 223"
},
{
"input": "6509546\n1607\n6221",
"output": "YES\n617 887"
},
{
"input": "2756250\n8783\n29",
"output": "YES\n21 88683"
},
{
"input": "7817510\n2377\n743",
"output": "YES\n560 8730"
},
{
"input": "6087210\n1583\n1997",
"output": "YES\n1070 2200"
},
{
"input": "4\n2\n2",
"output": "YES\n0 2"
},
{
"input": "7996960\n4457\n5387",
"output": "YES\n727 883"
},
{
"input": "7988988\n4021\n3169",
"output": "YES\n1789 251"
},
{
"input": "4608528\n9059\n977",
"output": "YES\n349 1481"
},
{
"input": "8069102\n2789\n47",
"output": "YES\n3 171505"
},
{
"input": "3936174\n4783\n13",
"output": "YES\n5 300943"
},
{
"input": "10000000\n9999999\n1",
"output": "YES\n0 10000000"
},
{
"input": "10000000\n1\n9999999",
"output": "YES\n1 1"
},
{
"input": "4\n1\n3",
"output": "YES\n1 1"
},
{
"input": "4\n1\n2",
"output": "YES\n0 2"
},
{
"input": "4\n3\n1",
"output": "YES\n0 4"
},
{
"input": "4\n2\n1",
"output": "YES\n0 4"
},
{
"input": "100\n10\n20",
"output": "YES\n0 5"
},
{
"input": "101\n11\n11",
"output": "NO"
},
{
"input": "121\n11\n11",
"output": "YES\n0 11"
},
{
"input": "25\n5\n6",
"output": "YES\n5 0"
},
{
"input": "1\n1\n1",
"output": "YES\n0 1"
},
{
"input": "10000000\n2\n1",
"output": "YES\n0 10000000"
},
{
"input": "10000000\n1234523\n1",
"output": "YES\n0 10000000"
},
{
"input": "10000000\n5000000\n5000000",
"output": "YES\n0 2"
},
{
"input": "10000000\n5000001\n5000000",
"output": "YES\n0 2"
},
{
"input": "10000000\n5000000\n5000001",
"output": "YES\n2 0"
},
{
"input": "9999999\n9999999\n9999999",
"output": "YES\n0 1"
},
{
"input": "10000000\n10000000\n10000000",
"output": "YES\n0 1"
},
{
"input": "10\n1\n3",
"output": "YES\n1 3"
},
{
"input": "97374\n689\n893",
"output": "NO"
},
{
"input": "100096\n791\n524",
"output": "NO"
},
{
"input": "75916\n651\n880",
"output": "NO"
},
{
"input": "110587\n623\n806",
"output": "NO"
},
{
"input": "5600\n670\n778",
"output": "NO"
},
{
"input": "81090\n527\n614",
"output": "NO"
},
{
"input": "227718\n961\n865",
"output": "NO"
},
{
"input": "10000000\n3\n999999",
"output": "NO"
},
{
"input": "3\n4\n5",
"output": "NO"
},
{
"input": "9999999\n2\n2",
"output": "NO"
},
{
"input": "9999999\n2\n4",
"output": "NO"
},
{
"input": "9999997\n2\n5",
"output": "YES\n1 1999999"
},
{
"input": "9366189\n4326262\n8994187",
"output": "NO"
},
{
"input": "1000000\n1\n10000000",
"output": "YES\n1000000 0"
},
{
"input": "9999991\n2\n2",
"output": "NO"
},
{
"input": "10000000\n7\n7",
"output": "NO"
},
{
"input": "9999991\n2\n4",
"output": "NO"
},
{
"input": "10000000\n3\n6",
"output": "NO"
},
{
"input": "10000000\n11\n11",
"output": "NO"
},
{
"input": "4\n7\n3",
"output": "NO"
},
{
"input": "1000003\n2\n2",
"output": "NO"
},
{
"input": "1000000\n7\n7",
"output": "NO"
},
{
"input": "999999\n2\n2",
"output": "NO"
},
{
"input": "8\n13\n5",
"output": "NO"
},
{
"input": "1000003\n15\n3",
"output": "NO"
},
{
"input": "7\n7\n2",
"output": "YES\n1 0"
},
{
"input": "9999999\n2\n8",
"output": "NO"
},
{
"input": "1000000\n3\n7",
"output": "YES\n5 142855"
},
{
"input": "9999999\n1\n10000000",
"output": "YES\n9999999 0"
},
{
"input": "100\n1\n1000000",
"output": "YES\n100 0"
},
{
"input": "10000000\n9999999\n9999997",
"output": "NO"
},
{
"input": "2\n1\n3",
"output": "YES\n2 0"
},
{
"input": "3\n5\n2",
"output": "NO"
},
{
"input": "5\n2\n3",
"output": "YES\n1 1"
},
{
"input": "10000000\n7\n14",
"output": "NO"
},
{
"input": "10000000\n2\n9999999",
"output": "YES\n5000000 0"
},
{
"input": "10000000\n3\n3",
"output": "NO"
},
{
"input": "1\n3\n2",
"output": "NO"
},
{
"input": "25\n27\n2",
"output": "NO"
},
{
"input": "3\n2\n17",
"output": "NO"
},
{
"input": "999997\n4\n8",
"output": "NO"
},
{
"input": "2000000\n1\n2000001",
"output": "YES\n2000000 0"
},
{
"input": "8\n7\n3",
"output": "NO"
},
{
"input": "7005920\n5705\n28145",
"output": "NO"
},
{
"input": "2\n6\n4",
"output": "NO"
},
{
"input": "10000000\n9999999\n3",
"output": "NO"
},
{
"input": "10000000\n77\n99",
"output": "NO"
},
{
"input": "100\n8\n70",
"output": "NO"
},
{
"input": "99999\n2\n2",
"output": "NO"
},
{
"input": "5\n7\n2",
"output": "NO"
},
{
"input": "999999\n12\n14",
"output": "NO"
},
{
"input": "100\n1\n1000",
"output": "YES\n100 0"
},
{
"input": "10000000\n123\n321",
"output": "NO"
},
{
"input": "9369319\n4\n2",
"output": "NO"
},
{
"input": "9999998\n3\n3",
"output": "NO"
},
{
"input": "85\n5\n85",
"output": "YES\n0 1"
},
{
"input": "64549\n9999999\n2",
"output": "NO"
},
{
"input": "10000000\n3\n7",
"output": "YES\n1 1428571"
},
{
"input": "9999889\n2\n2",
"output": "NO"
},
{
"input": "10000000\n9999999\n123",
"output": "NO"
},
{
"input": "64549\n2\n9999999",
"output": "NO"
}
] | 1,686,074,046
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 100
| 108
| 1,331,200
|
n = int(input())
a = int(input())
b = int(input())
y = 0
while n%a != 0 and n>= 0:
n -= b
y += 1
if n < 0:
print("NO")
else:
print("YES")
print(n//a,y)
|
Title: Proper Nutrition
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has *n* burles. One bottle of Ber-Cola costs *a* burles and one Bars bar costs *b* burles. He can buy any non-negative integer number of bottles of Ber-Cola and any non-negative integer number of Bars bars.
Find out if it's possible to buy some amount of bottles of Ber-Cola and Bars bars and spend exactly *n* burles.
In other words, you should find two non-negative integers *x* and *y* such that Vasya can buy *x* bottles of Ber-Cola and *y* Bars bars and *x*·*a*<=+<=*y*·*b*<==<=*n* or tell that it's impossible.
Input Specification:
First line contains single integer *n* (1<=≤<=*n*<=≤<=10<=000<=000) — amount of money, that Vasya has.
Second line contains single integer *a* (1<=≤<=*a*<=≤<=10<=000<=000) — cost of one bottle of Ber-Cola.
Third line contains single integer *b* (1<=≤<=*b*<=≤<=10<=000<=000) — cost of one Bars bar.
Output Specification:
If Vasya can't buy Bars and Ber-Cola in such a way to spend exactly *n* burles print «NO» (without quotes).
Otherwise in first line print «YES» (without quotes). In second line print two non-negative integers *x* and *y* — number of bottles of Ber-Cola and number of Bars bars Vasya should buy in order to spend exactly *n* burles, i.e. *x*·*a*<=+<=*y*·*b*<==<=*n*. If there are multiple answers print any of them.
Any of numbers *x* and *y* can be equal 0.
Demo Input:
['7\n2\n3\n', '100\n25\n10\n', '15\n4\n8\n', '9960594\n2551\n2557\n']
Demo Output:
['YES\n2 1\n', 'YES\n0 10\n', 'NO\n', 'YES\n1951 1949\n']
Note:
In first example Vasya can buy two bottles of Ber-Cola and one Bars bar. He will spend exactly 2·2 + 1·3 = 7 burles.
In second example Vasya can spend exactly *n* burles multiple ways:
- buy two bottles of Ber-Cola and five Bars bars; - buy four bottles of Ber-Cola and don't buy Bars bars; - don't buy Ber-Cola and buy 10 Bars bars.
In third example it's impossible to but Ber-Cola and Bars bars in order to spend exactly *n* burles.
|
```python
n = int(input())
a = int(input())
b = int(input())
y = 0
while n%a != 0 and n>= 0:
n -= b
y += 1
if n < 0:
print("NO")
else:
print("YES")
print(n//a,y)
```
| 3
|
|
734
|
A
|
Anton and Danik
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Anton likes to play chess, and so does his friend Danik.
Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie.
Now Anton wonders, who won more games, he or Danik? Help him determine this.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played.
The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game.
|
If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output.
If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output.
If Anton and Danik won the same number of games, print "Friendship" (without quotes).
|
[
"6\nADAAAA\n",
"7\nDDDAADA\n",
"6\nDADADA\n"
] |
[
"Anton\n",
"Danik\n",
"Friendship\n"
] |
In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton".
In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik".
In the third sample, both Anton and Danik won 3 games and the answer is "Friendship".
| 500
|
[
{
"input": "6\nADAAAA",
"output": "Anton"
},
{
"input": "7\nDDDAADA",
"output": "Danik"
},
{
"input": "6\nDADADA",
"output": "Friendship"
},
{
"input": "10\nDDDDADDADD",
"output": "Danik"
},
{
"input": "40\nAAAAAAAAADDAAAAAAAAAAADADDAAAAAAAAAAADAA",
"output": "Anton"
},
{
"input": "200\nDDDDDDDADDDDDDAADADAADAAADAADADAAADDDADDDDDDADDDAADDDAADADDDDDADDDAAAADAAADDDDDAAADAADDDAAAADDADADDDAADDAADAAADAADAAAADDAADDADAAAADADDDAAAAAADDAADAADAADADDDAAADAAAADADDADAAAAAADADADDDADDDAADDADDDAAAAD",
"output": "Friendship"
},
{
"input": "1\nA",
"output": "Anton"
},
{
"input": "1\nD",
"output": "Danik"
},
{
"input": "2\nDA",
"output": "Friendship"
},
{
"input": "4\nDADA",
"output": "Friendship"
},
{
"input": "4\nDAAD",
"output": "Friendship"
},
{
"input": "3\nADD",
"output": "Danik"
},
{
"input": "3\nDAD",
"output": "Danik"
},
{
"input": "2\nDA",
"output": "Friendship"
},
{
"input": "379\nAADAAAAAADDAAAAAADAADADADDAAAAADADDAADAAAADDDADAAAAAAADAADAAAAAAADAAAAAAAAADAAAAAAADAAAAAAAAAAADDDADAAAAAAAADAADADAAAADAAAAAAAAAAAAAAAAADAAAADDDAADAAAAAAADAAADAAADAADDDADDAAADAAAAAADDDADDDAAADAAAADAAAAAAAAADAAADAAAAAAAAADAAAAAAAAAAAAAAAAAADADAAAAAAAAAAADAAAAADAAAADAAAAAAAAAAAAADADAADAAAAAAAADAADAAAAAAAADAAAAAAAADDDAAAAAADAAADAAAAAADAADAAAAAADAAAADADAADAAAAAADAAAADAADDAADAADAAA",
"output": "Anton"
}
] | 1,694,154,912
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 62
| 204,800
|
n = input()
g = input()
n = int(n)
anton = 0
danik = 0
for i in range(n):
if g[i] == "A":
anton = anton +1
elif g[i] == "D":
danik = danik +1
if anton>danik:
print("Anton")
if anton < danik :
print("Danik")
if anton == danik :
print("Friendship")
|
Title: Anton and Danik
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anton likes to play chess, and so does his friend Danik.
Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie.
Now Anton wonders, who won more games, he or Danik? Help him determine this.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played.
The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game.
Output Specification:
If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output.
If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output.
If Anton and Danik won the same number of games, print "Friendship" (without quotes).
Demo Input:
['6\nADAAAA\n', '7\nDDDAADA\n', '6\nDADADA\n']
Demo Output:
['Anton\n', 'Danik\n', 'Friendship\n']
Note:
In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton".
In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik".
In the third sample, both Anton and Danik won 3 games and the answer is "Friendship".
|
```python
n = input()
g = input()
n = int(n)
anton = 0
danik = 0
for i in range(n):
if g[i] == "A":
anton = anton +1
elif g[i] == "D":
danik = danik +1
if anton>danik:
print("Anton")
if anton < danik :
print("Danik")
if anton == danik :
print("Friendship")
```
| 3
|
|
112
|
A
|
Petya and Strings
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Petya and Strings
|
2
|
256
|
Little Petya loves presents. His mum bought him two strings of the same size for his birthday. The strings consist of uppercase and lowercase Latin letters. Now Petya wants to compare those two strings lexicographically. The letters' case does not matter, that is an uppercase letter is considered equivalent to the corresponding lowercase letter. Help Petya perform the comparison.
|
Each of the first two lines contains a bought string. The strings' lengths range from 1 to 100 inclusive. It is guaranteed that the strings are of the same length and also consist of uppercase and lowercase Latin letters.
|
If the first string is less than the second one, print "-1". If the second string is less than the first one, print "1". If the strings are equal, print "0". Note that the letters' case is not taken into consideration when the strings are compared.
|
[
"aaaa\naaaA\n",
"abs\nAbz\n",
"abcdefg\nAbCdEfF\n"
] |
[
"0\n",
"-1\n",
"1\n"
] |
If you want more formal information about the lexicographical order (also known as the "dictionary order" or "alphabetical order"), you can visit the following site:
- http://en.wikipedia.org/wiki/Lexicographical_order
| 500
|
[
{
"input": "aaaa\naaaA",
"output": "0"
},
{
"input": "abs\nAbz",
"output": "-1"
},
{
"input": "abcdefg\nAbCdEfF",
"output": "1"
},
{
"input": "asadasdasd\nasdwasdawd",
"output": "-1"
},
{
"input": "aslkjlkasdd\nasdlkjdajwi",
"output": "1"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "aAaaaAAaAaaAzZsssSsdDfeEaeqZlpP\nAaaaAaaAaaAaZzSSSSsDdFeeAeQZLpp",
"output": "0"
},
{
"input": "bwuEhEveouaTECagLZiqmUdxEmhRSOzMauJRWLQMppZOumxhAmwuGeDIkvkBLvMXwUoFmpAfDprBcFtEwOULcZWRQhcTbTbX\nHhoDWbcxwiMnCNexOsKsujLiSGcLllXOkRSbnOzThAjnnliLYFFmsYkOfpTxRNEfBsoUHfoLTiqAINRPxWRqrTJhgfkKcDOH",
"output": "-1"
},
{
"input": "kGWUuguKzcvxqKTNpxeDWXpXkrXDvGMFGoXKDfPBZvWSDUyIYBynbKOUonHvmZaKeirUhfmVRKtGhAdBfKMWXDUoqvbfpfHYcg\ncvOULleuIIiYVVxcLZmHVpNGXuEpzcWZZWyMOwIwbpkKPwCfkVbKkUuosvxYCKjqfVmHfJKbdrsAcatPYgrCABaFcoBuOmMfFt",
"output": "1"
},
{
"input": "nCeNVIzHqPceNhjHeHvJvgBsNFiXBATRrjSTXJzhLMDMxiJztphxBRlDlqwDFImWeEPkggZCXSRwelOdpNrYnTepiOqpvkr\nHJbjJFtlvNxIbkKlxQUwmZHJFVNMwPAPDRslIoXISBYHHfymyIaQHLgECPxAmqnOCizwXnIUBRmpYUBVPenoUKhCobKdOjL",
"output": "1"
},
{
"input": "ttXjenUAlfixytHEOrPkgXmkKTSGYuyVXGIHYmWWYGlBYpHkujueqBSgjLguSgiMGJWATIGEUjjAjKXdMiVbHozZUmqQtFrT\nJziDBFBDmDJCcGqFsQwDFBYdOidLxxhBCtScznnDgnsiStlWFnEXQrJxqTXKPxZyIGfLIToETKWZBPUIBmLeImrlSBWCkTNo",
"output": "1"
},
{
"input": "AjQhPqSVhwQQjcgCycjKorWBgFCRuQBwgdVuAPSMJAvTyxGVuFHjfJzkKfsmfhFbKqFrFIohSZBbpjgEHebezmVlGLTPSCTMf\nXhxWuSnMmKFrCUOwkTUmvKAfbTbHWzzOTzxJatLLCdlGnHVaBUnxDlsqpvjLHMThOPAFBggVKDyKBrZAmjnjrhHlrnSkyzBja",
"output": "-1"
},
{
"input": "HCIgYtnqcMyjVngziNflxKHtdTmcRJhzMAjFAsNdWXFJYEhiTzsQUtFNkAbdrFBRmvLirkuirqTDvIpEfyiIqkrwsjvpPWTEdI\nErqiiWKsmIjyZuzgTlTqxYZwlrpvRyaVhRTOYUqtPMVGGtWOkDCOOQRKrkkRzPftyQCkYkzKkzTPqqXmeZhvvEEiEhkdOmoMvy",
"output": "1"
},
{
"input": "mtBeJYILXcECGyEVSyzLFdQJbiVnnfkbsYYsdUJSIRmyzLfTTtFwIBmRLVnwcewIqcuydkcLpflHAFyDaToLiFMgeHvQorTVbI\nClLvyejznjbRfCDcrCzkLvqQaGzTjwmWONBdCctJAPJBcQrcYvHaSLQgPIJbmkFBhFzuQLBiRzAdNHulCjIAkBvZxxlkdzUWLR",
"output": "1"
},
{
"input": "tjucSbGESVmVridTBjTmpVBCwwdWKBPeBvmgdxgIVLwQxveETnSdxkTVJpXoperWSgdpPMKNmwDiGeHfxnuqaDissgXPlMuNZIr\nHfjOOJhomqNIKHvqSgfySjlsWJQBuWYwhLQhlZYlpZwboMpoLoluGsBmhhlYgeIouwdkPfiaAIrkYRlxtiFazOPOllPsNZHcIZd",
"output": "1"
},
{
"input": "AanbDfbZNlUodtBQlvPMyomStKNhgvSGhSbTdabxGFGGXCdpsJDimsAykKjfBDPMulkhBMsqLmVKLDoesHZsRAEEdEzqigueXInY\ncwfyjoppiJNrjrOLNZkqcGimrpTsiyFBVgMWEPXsMrxLJDDbtYzerXiFGuLBcQYitLdqhGHBpdjRnkUegmnwhGHAKXGyFtscWDSI",
"output": "-1"
},
{
"input": "HRfxniwuJCaHOcaOVgjOGHXKrwxrDQxJpppeGDXnTAowyKbCsCQPbchCKeTWOcKbySSYnoaTJDnmRcyGPbfXJyZoPcARHBu\nxkLXvwkvGIWSQaFTznLOctUXNuzzBBOlqvzmVfTSejekTAlwidRrsxkbZTsGGeEWxCXHzqWVuLGoCyrGjKkQoHqduXwYQKC",
"output": "-1"
},
{
"input": "OjYwwNuPESIazoyLFREpObIaMKhCaKAMWMfRGgucEuyNYRantwdwQkmflzfqbcFRaXBnZoIUGsFqXZHGKwlaBUXABBcQEWWPvkjW\nRxLqGcTTpBwHrHltCOllnTpRKLDofBUqqHxnOtVWPgvGaeHIevgUSOeeDOJubfqonFpVNGVbHFcAhjnyFvrrqnRgKhkYqQZmRfUl",
"output": "-1"
},
{
"input": "tatuhQPIzjptlzzJpCAPXSRTKZRlwgfoCIsFjJquRoIDyZZYRSPdFUTjjUPhLBBfeEIfLQpygKXRcyQFiQsEtRtLnZErBqW\ntkHUjllbafLUWhVCnvblKjgYIEoHhsjVmrDBmAWbvtkHxDbRFvsXAjHIrujaDbYwOZmacknhZPeCcorbRgHjjgAgoJdjvLo",
"output": "-1"
},
{
"input": "cymCPGqdXKUdADEWDdUaLEEMHiXHsdAZuDnJDMUvxvrLRBrPSDpXPAgMRoGplLtniFRTomDTAHXWAdgUveTxaqKVSvnOyhOwiRN\nuhmyEWzapiRNPFDisvHTbenXMfeZaHqOFlKjrfQjUBwdFktNpeiRoDWuBftZLcCZZAVfioOihZVNqiNCNDIsUdIhvbcaxpTRWoV",
"output": "-1"
},
{
"input": "sSvpcITJAwghVfJaLKBmyjOkhltTGjYJVLWCYMFUomiJaKQYhXTajvZVHIMHbyckYROGQZzjWyWCcnmDmrkvTKfHSSzCIhsXgEZa\nvhCXkCwAmErGVBPBAnkSYEYvseFKbWSktoqaHYXUmYkHfOkRwuEyBRoGoBrOXBKVxXycjZGStuvDarnXMbZLWrbjrisDoJBdSvWJ",
"output": "-1"
},
{
"input": "hJDANKUNBisOOINDsTixJmYgHNogtpwswwcvVMptfGwIjvqgwTYFcqTdyAqaqlnhOCMtsnWXQqtjFwQlEcBtMFAtSqnqthVb\nrNquIcjNWESjpPVWmzUJFrelpUZeGDmSvCurCqVmKHKVAAPkaHksniOlzjiKYIJtvbuQWZRufMebpTFPqyxIWWjfPaWYiNlK",
"output": "-1"
},
{
"input": "ycLoapxsfsDTHMSfAAPIUpiEhQKUIXUcXEiopMBuuZLHtfPpLmCHwNMNQUwsEXxCEmKHTBSnKhtQhGWUvppUFZUgSpbeChX\ndCZhgVXofkGousCzObxZSJwXcHIaqUDSCPKzXntcVmPxtNcXmVcjsetZYxedmgQzXTZHMvzjoaXCMKsncGciSDqQWIIRlys",
"output": "1"
},
{
"input": "nvUbnrywIePXcoukIhwTfUVcHUEgXcsMyNQhmMlTltZiCooyZiIKRIGVHMCnTKgzXXIuvoNDEZswKoACOBGSyVNqTNQqMhAG\nplxuGSsyyJjdvpddrSebOARSAYcZKEaKjqbCwvjhNykuaECoQVHTVFMKXwvrQXRaqXsHsBaGVhCxGRxNyGUbMlxOarMZNXxy",
"output": "-1"
},
{
"input": "EncmXtAblQzcVRzMQqdDqXfAhXbtJKQwZVWyHoWUckohnZqfoCmNJDzexFgFJYrwNHGgzCJTzQQFnxGlhmvQTpicTkEeVICKac\nNIUNZoMLFMyAjVgQLITELJSodIXcGSDWfhFypRoGYuogJpnqGTotWxVqpvBHjFOWcDRDtARsaHarHaOkeNWEHGTaGOFCOFEwvK",
"output": "-1"
},
{
"input": "UG\nak",
"output": "1"
},
{
"input": "JZR\nVae",
"output": "-1"
},
{
"input": "a\nZ",
"output": "-1"
},
{
"input": "rk\nkv",
"output": "1"
},
{
"input": "RvuT\nbJzE",
"output": "1"
},
{
"input": "PPS\nydq",
"output": "-1"
},
{
"input": "q\nq",
"output": "0"
},
{
"input": "peOw\nIgSJ",
"output": "1"
},
{
"input": "PyK\noKN",
"output": "1"
},
{
"input": "O\ni",
"output": "1"
},
{
"input": "NmGY\npDlP",
"output": "-1"
},
{
"input": "nG\nZf",
"output": "-1"
},
{
"input": "m\na",
"output": "1"
},
{
"input": "MWyB\nWZEV",
"output": "-1"
},
{
"input": "Gre\nfxc",
"output": "1"
},
{
"input": "Ooq\nwap",
"output": "-1"
},
{
"input": "XId\nlbB",
"output": "1"
},
{
"input": "lfFpECEqUMEOJhipvkZjDPcpDNJedOVXiSMgBvBZbtfzIKekcvpWPCazKAhJyHircRtgcBIJwwstpHaLAgxFOngAWUZRgCef\nLfFPEcequmeojHIpVkzjDPcpdNJEDOVXiSmGBVBZBtfZikEKcvPwpCAzKAHJyHIrCRTgCbIJWwSTphALagXfOnGAwUzRGcEF",
"output": "0"
},
{
"input": "DQBdtSEDtFGiNRUeJNbOIfDZnsryUlzJHGTXGFXnwsVyxNtLgmklmFvRCzYETBVdmkpJJIvIOkMDgCFHZOTODiYrkwXd\nDQbDtsEdTFginRUEJNBOIfdZnsryulZJHGtxGFxnwSvYxnTLgmKlmFVRCzyEtBVdmKpJjiVioKMDgCFhzoTODiYrKwXD",
"output": "0"
},
{
"input": "tYWRijFQSzHBpCjUzqBtNvBKyzZRnIdWEuyqnORBQTLyOQglIGfYJIRjuxnbLvkqZakNqPiGDvgpWYkfxYNXsdoKXZtRkSasfa\nTYwRiJfqsZHBPcJuZQBTnVbkyZZRnidwEuYQnorbQTLYOqGligFyjirJUxnblVKqZaknQpigDVGPwyKfxyNXSDoKxztRKSaSFA",
"output": "0"
},
{
"input": "KhScXYiErQIUtmVhNTCXSLAviefIeHIIdiGhsYnPkSBaDTvMkyanfMLBOvDWgRybLtDqvXVdVjccNunDyijhhZEAKBrdz\nkHsCXyiErqIuTMVHNTCxSLaViEFIEhIIDiGHsYNpKsBAdTvMKyANFMLBovdwGRYbLtdQVxvDVJCcNUndYiJHhzeakBrdZ",
"output": "0"
},
{
"input": "cpPQMpjRQJKQVXjWDYECXbagSmNcVfOuBWNZxihdERraVuiOpSVDCPgTGuSQALNoVjySceHcKXwOEpSzXrEqWwwrYeppNiWhDVg\nCPPqmPjRqJkQvxJwdyECXBAGsMNcVfOuBWNzxIhderRavUiOpSvDCpGTgusqAlNovjyScEhCKXwoePSZxrEQwWwryEPPniWHDvG",
"output": "0"
},
{
"input": "SajcCGMepaLjZIWLRBGFcrZRCRvvoCsIyKsQerbrwsIamxxpRmQSZSalasJLVFbCHCuXJlubciQAvLxXYBazLsMKLHLdDQ\nsaJcCgmEpaLJziWlrBgFcRzrCrVVOcSIykSQerBrwSIamxxPrMqSzSalASjLVFbChCUxjLUbCIQAVlxxybAZLsmkLhLDdQ",
"output": "0"
},
{
"input": "kigPrWNTOUNDBskAfefjhHYZNYdnfZWuXWzHiBxFQryBbAkPtenFwWvCSTYGpzOntUNzNUhxRWjKmicTwLwJAnbAxj\nkigpRWntOUNdBsKaFEFjhhYZnYDNfzWuXwZhibxFQRybbakPteNfwwvcStyGPzoNTunznuHXrWjKMIctWLWJANBAxJ",
"output": "0"
},
{
"input": "nTomZZuTTRTAAPoUsySVFGElrpQRNLjqvFmcYytiheQnjUhPLnqNBiYtQkljbcvmjuNAVKbvQOWpqqFlQhAhULIhquoCnjUI\nntOmzZuttrtAAPOUSySVFgeLRPQrNLjQvfmCyYTiHEQnjuHPlNQNbIYtqKLJBCVmjunavkbvQOWPQQFlqHaHULIHQuOcnJUi",
"output": "0"
},
{
"input": "abac\nadaa",
"output": "-1"
},
{
"input": "Bbc\nabc",
"output": "1"
},
{
"input": "aaaba\naaaab",
"output": "1"
}
] | 1,695,217,496
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 53
| 62
| 0
|
A=input().lower()
B=input().lower()
if A<B:
k=-1
elif A==B:
k=0
elif A>B:
k=1
print(k)
|
Title: Petya and Strings
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Petya loves presents. His mum bought him two strings of the same size for his birthday. The strings consist of uppercase and lowercase Latin letters. Now Petya wants to compare those two strings lexicographically. The letters' case does not matter, that is an uppercase letter is considered equivalent to the corresponding lowercase letter. Help Petya perform the comparison.
Input Specification:
Each of the first two lines contains a bought string. The strings' lengths range from 1 to 100 inclusive. It is guaranteed that the strings are of the same length and also consist of uppercase and lowercase Latin letters.
Output Specification:
If the first string is less than the second one, print "-1". If the second string is less than the first one, print "1". If the strings are equal, print "0". Note that the letters' case is not taken into consideration when the strings are compared.
Demo Input:
['aaaa\naaaA\n', 'abs\nAbz\n', 'abcdefg\nAbCdEfF\n']
Demo Output:
['0\n', '-1\n', '1\n']
Note:
If you want more formal information about the lexicographical order (also known as the "dictionary order" or "alphabetical order"), you can visit the following site:
- http://en.wikipedia.org/wiki/Lexicographical_order
|
```python
A=input().lower()
B=input().lower()
if A<B:
k=-1
elif A==B:
k=0
elif A>B:
k=1
print(k)
```
| 3.9845
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,662,389,315
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 92
| 0
|
s = input()
upper_counter = 0
lower_counter = 0
for i in range(len(s)):
if s[i].isupper():
upper_counter +=1
elif s[i].islower():
lower_counter +=1
if upper_counter > lower_counter:
print(s.upper())
else:
print(s.lower())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
s = input()
upper_counter = 0
lower_counter = 0
for i in range(len(s)):
if s[i].isupper():
upper_counter +=1
elif s[i].islower():
lower_counter +=1
if upper_counter > lower_counter:
print(s.upper())
else:
print(s.lower())
```
| 3.977
|
822
|
A
|
I'm bored with life
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"number theory"
] | null | null |
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
|
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
|
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
|
[
"4 3\n"
] |
[
"6\n"
] |
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6.
| 500
|
[
{
"input": "4 3",
"output": "6"
},
{
"input": "10 399603090",
"output": "3628800"
},
{
"input": "6 973151934",
"output": "720"
},
{
"input": "2 841668075",
"output": "2"
},
{
"input": "7 415216919",
"output": "5040"
},
{
"input": "3 283733059",
"output": "6"
},
{
"input": "11 562314608",
"output": "39916800"
},
{
"input": "3 990639260",
"output": "6"
},
{
"input": "11 859155400",
"output": "39916800"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "5 3",
"output": "6"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "5 4",
"output": "24"
},
{
"input": "1 12",
"output": "1"
},
{
"input": "9 7",
"output": "5040"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "6 11",
"output": "720"
},
{
"input": "6 7",
"output": "720"
},
{
"input": "11 11",
"output": "39916800"
},
{
"input": "4 999832660",
"output": "24"
},
{
"input": "7 999228288",
"output": "5040"
},
{
"input": "11 999257105",
"output": "39916800"
},
{
"input": "11 999286606",
"output": "39916800"
},
{
"input": "3 999279109",
"output": "6"
},
{
"input": "999632727 11",
"output": "39916800"
},
{
"input": "999625230 7",
"output": "5040"
},
{
"input": "999617047 3",
"output": "6"
},
{
"input": "999646548 7",
"output": "5040"
},
{
"input": "999639051 3",
"output": "6"
},
{
"input": "12 12",
"output": "479001600"
},
{
"input": "12 1",
"output": "1"
},
{
"input": "1213 5",
"output": "120"
},
{
"input": "8 9",
"output": "40320"
},
{
"input": "12 9",
"output": "362880"
},
{
"input": "12 1000000000",
"output": "479001600"
},
{
"input": "1000000000 1",
"output": "1"
},
{
"input": "12 13",
"output": "479001600"
},
{
"input": "2 29845",
"output": "2"
},
{
"input": "10 21",
"output": "3628800"
},
{
"input": "12 20",
"output": "479001600"
},
{
"input": "15 12",
"output": "479001600"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000 12",
"output": "479001600"
},
{
"input": "11 30",
"output": "39916800"
},
{
"input": "17 12",
"output": "479001600"
},
{
"input": "4 19",
"output": "24"
},
{
"input": "12 15",
"output": "479001600"
},
{
"input": "20 6",
"output": "720"
},
{
"input": "10 20",
"output": "3628800"
},
{
"input": "10 10",
"output": "3628800"
},
{
"input": "22 12",
"output": "479001600"
},
{
"input": "20 12",
"output": "479001600"
},
{
"input": "12 23",
"output": "479001600"
},
{
"input": "12 22",
"output": "479001600"
},
{
"input": "18 3",
"output": "6"
},
{
"input": "14 10",
"output": "3628800"
},
{
"input": "14 12",
"output": "479001600"
},
{
"input": "8 3",
"output": "6"
},
{
"input": "5 5",
"output": "120"
}
] | 1,664,082,507
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 59
| 77
| 0
|
def factorial(n):
result = 1
while (n != 0):
result = result * n
n -= 1
return result
numbers = input().split()
A, B = int(numbers[0]), int(numbers[1])
if(A <= B):
print(factorial(A))
else:
print(factorial(B))
|
Title: I'm bored with life
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
Input Specification:
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
Output Specification:
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
Demo Input:
['4 3\n']
Demo Output:
['6\n']
Note:
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6.
|
```python
def factorial(n):
result = 1
while (n != 0):
result = result * n
n -= 1
return result
numbers = input().split()
A, B = int(numbers[0]), int(numbers[1])
if(A <= B):
print(factorial(A))
else:
print(factorial(B))
```
| 3
|
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,628,703,226
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 32
| 218
| 20,172,800
|
'''input
4
1 2 1 1
'''
n = int(input())
nl = list(map(int, input().split()))
odd = []
even = []
for it in nl:
if it%2 == 0:
even.append(it)
else:
odd.append(it)
if len(odd) == 1:
print(nl.index(odd[0])+1)
elif len(even) == 1:
print(nl.index(even[0])+1)
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
'''input
4
1 2 1 1
'''
n = int(input())
nl = list(map(int, input().split()))
odd = []
even = []
for it in nl:
if it%2 == 0:
even.append(it)
else:
odd.append(it)
if len(odd) == 1:
print(nl.index(odd[0])+1)
elif len(even) == 1:
print(nl.index(even[0])+1)
```
| 3.907925
|
618
|
B
|
Guess the Permutation
|
PROGRAMMING
| 1,100
|
[
"constructive algorithms"
] | null | null |
Bob has a permutation of integers from 1 to *n*. Denote this permutation as *p*. The *i*-th element of *p* will be denoted as *p**i*. For all pairs of distinct integers *i*,<=*j* between 1 and *n*, he wrote the number *a**i*,<=*j*<==<=*min*(*p**i*,<=*p**j*). He writes *a**i*,<=*i*<==<=0 for all integer *i* from 1 to *n*.
Bob gave you all the values of *a**i*,<=*j* that he wrote down. Your job is to reconstruct any permutation that could have generated these values. The input will be formed so that it is guaranteed that there is at least one solution that is consistent with the information given.
|
The first line of the input will contain a single integer *n* (2<=≤<=*n*<=≤<=50).
The next *n* lines will contain the values of *a**i*,<=*j*. The *j*-th number on the *i*-th line will represent *a**i*,<=*j*. The *i*-th number on the *i*-th line will be 0. It's guaranteed that *a**i*,<=*j*<==<=*a**j*,<=*i* and there is at least one solution consistent with the information given.
|
Print *n* space separated integers, which represents a permutation that could have generated these values. If there are multiple possible solutions, print any of them.
|
[
"2\n0 1\n1 0\n",
"5\n0 2 2 1 2\n2 0 4 1 3\n2 4 0 1 3\n1 1 1 0 1\n2 3 3 1 0\n"
] |
[
"2 1\n",
"2 5 4 1 3\n"
] |
In the first case, the answer can be {1, 2} or {2, 1}.
In the second case, another possible answer is {2, 4, 5, 1, 3}.
| 1,000
|
[
{
"input": "2\n0 1\n1 0",
"output": "2 1"
},
{
"input": "5\n0 2 2 1 2\n2 0 4 1 3\n2 4 0 1 3\n1 1 1 0 1\n2 3 3 1 0",
"output": "2 5 4 1 3"
},
{
"input": "10\n0 1 5 2 5 3 4 5 5 5\n1 0 1 1 1 1 1 1 1 1\n5 1 0 2 6 3 4 6 6 6\n2 1 2 0 2 2 2 2 2 2\n5 1 6 2 0 3 4 8 8 7\n3 1 3 2 3 0 3 3 3 3\n4 1 4 2 4 3 0 4 4 4\n5 1 6 2 8 3 4 0 9 7\n5 1 6 2 8 3 4 9 0 7\n5 1 6 2 7 3 4 7 7 0",
"output": "5 1 6 2 8 3 4 10 9 7"
},
{
"input": "4\n0 1 3 2\n1 0 1 1\n3 1 0 2\n2 1 2 0",
"output": "4 1 3 2"
},
{
"input": "7\n0 3 2 4 1 4 4\n3 0 2 3 1 3 3\n2 2 0 2 1 2 2\n4 3 2 0 1 5 5\n1 1 1 1 0 1 1\n4 3 2 5 1 0 6\n4 3 2 5 1 6 0",
"output": "4 3 2 5 1 7 6"
},
{
"input": "10\n0 4 4 1 4 4 4 2 3 4\n4 0 5 1 6 8 9 2 3 7\n4 5 0 1 5 5 5 2 3 5\n1 1 1 0 1 1 1 1 1 1\n4 6 5 1 0 6 6 2 3 6\n4 8 5 1 6 0 8 2 3 7\n4 9 5 1 6 8 0 2 3 7\n2 2 2 1 2 2 2 0 2 2\n3 3 3 1 3 3 3 2 0 3\n4 7 5 1 6 7 7 2 3 0",
"output": "4 10 5 1 6 8 9 2 3 7"
},
{
"input": "13\n0 5 5 2 5 4 5 5 3 5 5 5 1\n5 0 6 2 6 4 6 6 3 6 6 6 1\n5 6 0 2 10 4 7 10 3 8 10 9 1\n2 2 2 0 2 2 2 2 2 2 2 2 1\n5 6 10 2 0 4 7 12 3 8 11 9 1\n4 4 4 2 4 0 4 4 3 4 4 4 1\n5 6 7 2 7 4 0 7 3 7 7 7 1\n5 6 10 2 12 4 7 0 3 8 11 9 1\n3 3 3 2 3 3 3 3 0 3 3 3 1\n5 6 8 2 8 4 7 8 3 0 8 8 1\n5 6 10 2 11 4 7 11 3 8 0 9 1\n5 6 9 2 9 4 7 9 3 8 9 0 1\n1 1 1 1 1 1 1 1 1 1 1 1 0",
"output": "5 6 10 2 13 4 7 12 3 8 11 9 1"
}
] | 1,454,090,241
| 2,841
|
Python 3
|
OK
|
TESTS
| 23
| 77
| 512,000
|
from collections import defaultdict
def get_max_key( number_counts ):
res = 0
max_count = 1
for k,v in number_counts.items():
if v > max_count:
res = k
max_count = v
return res
if __name__ == "__main__":
n = int( input() )
res = [0]*n
thenum = n-1
for i in range(n):
ap = [int(x) for x in input().split()]
number_counts = defaultdict(int)
for j in range(n):
if ap[j]:
number_counts[ap[j]] += 1
#print(number_counts)
maxkey = get_max_key(number_counts)
if maxkey == 0:
res[i] = thenum
thenum += 1
else:
res[i] = maxkey
print(" ".join([str(x) for x in res]))
|
Title: Guess the Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bob has a permutation of integers from 1 to *n*. Denote this permutation as *p*. The *i*-th element of *p* will be denoted as *p**i*. For all pairs of distinct integers *i*,<=*j* between 1 and *n*, he wrote the number *a**i*,<=*j*<==<=*min*(*p**i*,<=*p**j*). He writes *a**i*,<=*i*<==<=0 for all integer *i* from 1 to *n*.
Bob gave you all the values of *a**i*,<=*j* that he wrote down. Your job is to reconstruct any permutation that could have generated these values. The input will be formed so that it is guaranteed that there is at least one solution that is consistent with the information given.
Input Specification:
The first line of the input will contain a single integer *n* (2<=≤<=*n*<=≤<=50).
The next *n* lines will contain the values of *a**i*,<=*j*. The *j*-th number on the *i*-th line will represent *a**i*,<=*j*. The *i*-th number on the *i*-th line will be 0. It's guaranteed that *a**i*,<=*j*<==<=*a**j*,<=*i* and there is at least one solution consistent with the information given.
Output Specification:
Print *n* space separated integers, which represents a permutation that could have generated these values. If there are multiple possible solutions, print any of them.
Demo Input:
['2\n0 1\n1 0\n', '5\n0 2 2 1 2\n2 0 4 1 3\n2 4 0 1 3\n1 1 1 0 1\n2 3 3 1 0\n']
Demo Output:
['2 1\n', '2 5 4 1 3\n']
Note:
In the first case, the answer can be {1, 2} or {2, 1}.
In the second case, another possible answer is {2, 4, 5, 1, 3}.
|
```python
from collections import defaultdict
def get_max_key( number_counts ):
res = 0
max_count = 1
for k,v in number_counts.items():
if v > max_count:
res = k
max_count = v
return res
if __name__ == "__main__":
n = int( input() )
res = [0]*n
thenum = n-1
for i in range(n):
ap = [int(x) for x in input().split()]
number_counts = defaultdict(int)
for j in range(n):
if ap[j]:
number_counts[ap[j]] += 1
#print(number_counts)
maxkey = get_max_key(number_counts)
if maxkey == 0:
res[i] = thenum
thenum += 1
else:
res[i] = maxkey
print(" ".join([str(x) for x in res]))
```
| 3
|
|
721
|
A
|
One-dimensional Japanese Crossword
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=×<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)).
Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=×<=*n*), which he wants to encrypt in the same way as in japanese crossword.
Help Adaltik find the numbers encrypting the row he drew.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W' — to white square in the row that Adaltik drew).
|
The first line should contain a single integer *k* — the number of integers encrypting the row, e.g. the number of groups of black squares in the row.
The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right.
|
[
"3\nBBW\n",
"5\nBWBWB\n",
"4\nWWWW\n",
"4\nBBBB\n",
"13\nWBBBBWWBWBBBW\n"
] |
[
"1\n2 ",
"3\n1 1 1 ",
"0\n",
"1\n4 ",
"3\n4 1 3 "
] |
The last sample case correspond to the picture in the statement.
| 500
|
[
{
"input": "3\nBBW",
"output": "1\n2 "
},
{
"input": "5\nBWBWB",
"output": "3\n1 1 1 "
},
{
"input": "4\nWWWW",
"output": "0"
},
{
"input": "4\nBBBB",
"output": "1\n4 "
},
{
"input": "13\nWBBBBWWBWBBBW",
"output": "3\n4 1 3 "
},
{
"input": "1\nB",
"output": "1\n1 "
},
{
"input": "2\nBB",
"output": "1\n2 "
},
{
"input": "100\nWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWB",
"output": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "1\nW",
"output": "0"
},
{
"input": "2\nWW",
"output": "0"
},
{
"input": "2\nWB",
"output": "1\n1 "
},
{
"input": "2\nBW",
"output": "1\n1 "
},
{
"input": "3\nBBB",
"output": "1\n3 "
},
{
"input": "3\nBWB",
"output": "2\n1 1 "
},
{
"input": "3\nWBB",
"output": "1\n2 "
},
{
"input": "3\nWWB",
"output": "1\n1 "
},
{
"input": "3\nWBW",
"output": "1\n1 "
},
{
"input": "3\nBWW",
"output": "1\n1 "
},
{
"input": "3\nWWW",
"output": "0"
},
{
"input": "100\nBBBWWWWWWBBWWBBWWWBBWBBBBBBBBBBBWBBBWBBWWWBBWWBBBWBWWBBBWWBBBWBBBBBWWWBWWBBWWWWWWBWBBWWBWWWBWBWWWWWB",
"output": "21\n3 2 2 2 11 3 2 2 3 1 3 3 5 1 2 1 2 1 1 1 1 "
},
{
"input": "5\nBBBWB",
"output": "2\n3 1 "
},
{
"input": "5\nBWWWB",
"output": "2\n1 1 "
},
{
"input": "5\nWWWWB",
"output": "1\n1 "
},
{
"input": "5\nBWWWW",
"output": "1\n1 "
},
{
"input": "5\nBBBWW",
"output": "1\n3 "
},
{
"input": "5\nWWBBB",
"output": "1\n3 "
},
{
"input": "10\nBBBBBWWBBB",
"output": "2\n5 3 "
},
{
"input": "10\nBBBBWBBWBB",
"output": "3\n4 2 2 "
},
{
"input": "20\nBBBBBWWBWBBWBWWBWBBB",
"output": "6\n5 1 2 1 1 3 "
},
{
"input": "20\nBBBWWWWBBWWWBWBWWBBB",
"output": "5\n3 2 1 1 3 "
},
{
"input": "20\nBBBBBBBBWBBBWBWBWBBB",
"output": "5\n8 3 1 1 3 "
},
{
"input": "20\nBBBWBWBWWWBBWWWWBWBB",
"output": "6\n3 1 1 2 1 2 "
},
{
"input": "40\nBBBBBBWWWWBWBWWWBWWWWWWWWWWWBBBBBBBBBBBB",
"output": "5\n6 1 1 1 12 "
},
{
"input": "40\nBBBBBWBWWWBBWWWBWBWWBBBBWWWWBWBWBBBBBBBB",
"output": "9\n5 1 2 1 1 4 1 1 8 "
},
{
"input": "50\nBBBBBBBBBBBWWWWBWBWWWWBBBBBBBBWWWWWWWBWWWWBWBBBBBB",
"output": "7\n11 1 1 8 1 1 6 "
},
{
"input": "50\nWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW",
"output": "0"
},
{
"input": "50\nBBBBBWWWWWBWWWBWWWWWBWWWBWWWWWWBBWBBWWWWBWWWWWWWBW",
"output": "9\n5 1 1 1 1 2 2 1 1 "
},
{
"input": "50\nWWWWBWWBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWBWWWWWWWBBBBB",
"output": "6\n1 1 1 1 1 5 "
},
{
"input": "50\nBBBBBWBWBWWBWBWWWWWWBWBWBWWWWWWWWWWWWWBWBWWWWBWWWB",
"output": "12\n5 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n50 "
},
{
"input": "100\nBBBBBBBBBBBWBWWWWBWWBBWBBWWWWWWWWWWBWBWWBWWWWWWWWWWWBBBWWBBWWWWWBWBWWWWBWWWWWWWWWWWBWWWWWBBBBBBBBBBB",
"output": "15\n11 1 1 2 2 1 1 1 3 2 1 1 1 1 11 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n100 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBWBWBWWWWWBWWWWWWWWWWWWWWBBWWWBWWWWBWWBWWWWWWBWWWWWWWWWWWWWBWBBBBBBBBBBBBBBBBBBBB",
"output": "11\n20 1 1 1 2 1 1 1 1 1 20 "
},
{
"input": "100\nBBBBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWWWWWBWBWWWWWWBBWWWWWWWWWWWWBWWWWBWWWWWWWWWWWWBWWWWWWWBWWWWWWWBBBBBB",
"output": "11\n4 1 1 1 1 2 1 1 1 1 6 "
},
{
"input": "5\nBWBWB",
"output": "3\n1 1 1 "
},
{
"input": "10\nWWBWWWBWBB",
"output": "3\n1 1 2 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n50 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "2\n17 31 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "2\n24 42 "
},
{
"input": "90\nWWBWWBWBBWBBWWBWBWBBBWBWBBBWBWBWBWBWBWBWBWBBBBBWBBWWWWBWBBWBWWBBBWBWBWWBWBWBWBWWWWWWBWBBBB",
"output": "30\n1 1 2 2 1 1 3 1 3 1 1 1 1 1 1 1 5 2 1 2 1 3 1 1 1 1 1 1 1 4 "
},
{
"input": "100\nBWWWBWBWBBBBBWBWWBWBWWWBWBWBWWBBWWBBBWBBBWWBWBWWBBBBWBWBBBWBWBBWWWWWWBWWBBBBWBWBWWBWBWWWBWBWWBWBWWWB",
"output": "31\n1 1 1 5 1 1 1 1 1 1 2 3 3 1 1 4 1 3 1 2 1 4 1 1 1 1 1 1 1 1 1 "
},
{
"input": "90\nWBWBBBBBBWWWBBWWBWWWBBWWBWWWBWBBWBWBBWWWWBWBWBBWBBWBWWWBBWBBWWWWBWBBWWWBBBWBBWBWBBBBWWBWWB",
"output": "25\n1 6 2 1 2 1 1 2 1 2 1 1 2 2 1 2 2 1 2 3 2 1 4 1 1 "
},
{
"input": "80\nBBWWBBBWBBWWWWBBWBWBBWWWWWBWBBWWBWBWBWBWBWWBWWBWWWBWBBWBBWBBWBBBWWBBBBBBBWBBBWBB",
"output": "23\n2 3 2 2 1 2 1 2 1 1 1 1 1 1 1 1 2 2 2 3 7 3 2 "
},
{
"input": "65\nWWWWBWWWBBBBBWWWWWWBBBWWBBBBWWWWWWWWBBBWWWWBWBWWBBWWWWBWWWBBWBBBB",
"output": "11\n1 5 3 4 3 1 1 2 1 2 4 "
}
] | 1,618,890,895
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 54
| 62
| 0
|
n = int(input())
s = input()
x = 0
z = ""
i = 0
while i < n:
if s[i] == "B":
x += 1
y = 1
while i+1 != n and s[i+1] == "B":
y += 1
i += 1
z += str(y)
z += " "
i += 1
print(x)
print(z)
|
Title: One-dimensional Japanese Crossword
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=×<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)).
Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=×<=*n*), which he wants to encrypt in the same way as in japanese crossword.
Help Adaltik find the numbers encrypting the row he drew.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W' — to white square in the row that Adaltik drew).
Output Specification:
The first line should contain a single integer *k* — the number of integers encrypting the row, e.g. the number of groups of black squares in the row.
The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right.
Demo Input:
['3\nBBW\n', '5\nBWBWB\n', '4\nWWWW\n', '4\nBBBB\n', '13\nWBBBBWWBWBBBW\n']
Demo Output:
['1\n2 ', '3\n1 1 1 ', '0\n', '1\n4 ', '3\n4 1 3 ']
Note:
The last sample case correspond to the picture in the statement.
|
```python
n = int(input())
s = input()
x = 0
z = ""
i = 0
while i < n:
if s[i] == "B":
x += 1
y = 1
while i+1 != n and s[i+1] == "B":
y += 1
i += 1
z += str(y)
z += " "
i += 1
print(x)
print(z)
```
| 3
|
|
9
|
A
|
Die Roll
|
PROGRAMMING
| 800
|
[
"math",
"probabilities"
] |
A. Die Roll
|
1
|
64
|
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
|
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
|
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
|
[
"4 2\n"
] |
[
"1/2\n"
] |
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
| 0
|
[
{
"input": "4 2",
"output": "1/2"
},
{
"input": "1 1",
"output": "1/1"
},
{
"input": "1 2",
"output": "5/6"
},
{
"input": "1 3",
"output": "2/3"
},
{
"input": "1 4",
"output": "1/2"
},
{
"input": "1 5",
"output": "1/3"
},
{
"input": "1 6",
"output": "1/6"
},
{
"input": "2 1",
"output": "5/6"
},
{
"input": "2 2",
"output": "5/6"
},
{
"input": "2 3",
"output": "2/3"
},
{
"input": "2 4",
"output": "1/2"
},
{
"input": "2 5",
"output": "1/3"
},
{
"input": "2 6",
"output": "1/6"
},
{
"input": "3 1",
"output": "2/3"
},
{
"input": "3 2",
"output": "2/3"
},
{
"input": "3 3",
"output": "2/3"
},
{
"input": "3 4",
"output": "1/2"
},
{
"input": "3 5",
"output": "1/3"
},
{
"input": "3 6",
"output": "1/6"
},
{
"input": "4 1",
"output": "1/2"
},
{
"input": "4 3",
"output": "1/2"
},
{
"input": "4 4",
"output": "1/2"
},
{
"input": "4 5",
"output": "1/3"
},
{
"input": "4 6",
"output": "1/6"
},
{
"input": "5 1",
"output": "1/3"
},
{
"input": "5 2",
"output": "1/3"
},
{
"input": "5 3",
"output": "1/3"
},
{
"input": "5 4",
"output": "1/3"
},
{
"input": "5 5",
"output": "1/3"
},
{
"input": "5 6",
"output": "1/6"
},
{
"input": "6 1",
"output": "1/6"
},
{
"input": "6 2",
"output": "1/6"
},
{
"input": "6 3",
"output": "1/6"
},
{
"input": "6 4",
"output": "1/6"
},
{
"input": "6 5",
"output": "1/6"
},
{
"input": "6 6",
"output": "1/6"
}
] | 1,658,858,115
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 92
| 0
|
from posixpath import split
lst=map(int,input().split())
max=max(lst)-1
num=6-max
if 6%num==0:
den=int(6/num)
num=1
elif 6%num==2:
den=3
num=2
else:
den=6
num=5
print("{}/{}".format(num,den))
|
Title: Die Roll
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
Input Specification:
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output Specification:
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
Demo Input:
['4 2\n']
Demo Output:
['1/2\n']
Note:
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
|
```python
from posixpath import split
lst=map(int,input().split())
max=max(lst)-1
num=6-max
if 6%num==0:
den=int(6/num)
num=1
elif 6%num==2:
den=3
num=2
else:
den=6
num=5
print("{}/{}".format(num,den))
```
| 3.954
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
A flower shop has got *n* bouquets, and the *i*-th bouquet consists of *a**i* flowers. Vasya, the manager of the shop, decided to make large bouquets from these bouquets.
Vasya thinks that a bouquet is large if it is made of two or more initial bouquets, and there is a constraint: the total number of flowers in a large bouquet should be odd. Each of the initial bouquets can be a part of at most one large bouquet. If an initial bouquet becomes a part of a large bouquet, all its flowers are included in the large bouquet.
Determine the maximum possible number of large bouquets Vasya can make.
|
The first line contains a single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of initial bouquets.
The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=106) — the number of flowers in each of the initial bouquets.
|
Print the maximum number of large bouquets Vasya can make.
|
[
"5\n2 3 4 2 7\n",
"6\n2 2 6 8 6 12\n",
"3\n11 4 10\n"
] |
[
"2\n",
"0\n",
"1\n"
] |
In the first example Vasya can make 2 large bouquets. For example, the first bouquet can contain the first and the fifth initial bouquets (the total number of flowers is then equal to 9), and the second bouquet can consist of the second and the third initial bouquets (the total number of flowers is then equal to 7). The fourth initial bouquet is unused in this scheme.
In the second example it is not possible to form a single bouquet with odd number of flowers.
In the third example Vasya can make one large bouquet. For example, he can make it using all three initial bouquets. The size of the large bouquet is then equal to 11 + 4 + 10 = 25.
| 0
|
[
{
"input": "5\n2 3 4 2 7",
"output": "2"
},
{
"input": "6\n2 2 6 8 6 12",
"output": "0"
},
{
"input": "3\n11 4 10",
"output": "1"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "1\n999999",
"output": "0"
},
{
"input": "1\n1000000",
"output": "0"
},
{
"input": "4\n943543 151729 379602 589828",
"output": "2"
},
{
"input": "2\n468463 62253",
"output": "0"
},
{
"input": "3\n352987 849349 967007",
"output": "1"
},
{
"input": "20\n274039 899325 798709 157662 963297 276599 529230 80095 252956 980560 358150 82383 29856 901568 123794 275349 512273 508369 120076 170206",
"output": "10"
},
{
"input": "25\n742168 377547 485672 437223 96307 902863 759104 747933 512899 410317 588598 666688 823202 257684 520631 910066 168864 71499 899972 565350 764848 754913 929040 864132 289976",
"output": "10"
}
] | 1,521,303,687
| 2,787
|
Python 3
|
OK
|
TESTS
| 49
| 140
| 14,848,000
|
n = int(input())
even = 0
odd = 0
arr = input()
l = list(map(int, arr.split(' ')))
for x in l:
if (x % 2 == 0):
even += 1
else:
odd += 1
rs = min(even, odd)
even -= rs
odd -= rs
rs += int(odd / 3)
print(rs)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A flower shop has got *n* bouquets, and the *i*-th bouquet consists of *a**i* flowers. Vasya, the manager of the shop, decided to make large bouquets from these bouquets.
Vasya thinks that a bouquet is large if it is made of two or more initial bouquets, and there is a constraint: the total number of flowers in a large bouquet should be odd. Each of the initial bouquets can be a part of at most one large bouquet. If an initial bouquet becomes a part of a large bouquet, all its flowers are included in the large bouquet.
Determine the maximum possible number of large bouquets Vasya can make.
Input Specification:
The first line contains a single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of initial bouquets.
The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=106) — the number of flowers in each of the initial bouquets.
Output Specification:
Print the maximum number of large bouquets Vasya can make.
Demo Input:
['5\n2 3 4 2 7\n', '6\n2 2 6 8 6 12\n', '3\n11 4 10\n']
Demo Output:
['2\n', '0\n', '1\n']
Note:
In the first example Vasya can make 2 large bouquets. For example, the first bouquet can contain the first and the fifth initial bouquets (the total number of flowers is then equal to 9), and the second bouquet can consist of the second and the third initial bouquets (the total number of flowers is then equal to 7). The fourth initial bouquet is unused in this scheme.
In the second example it is not possible to form a single bouquet with odd number of flowers.
In the third example Vasya can make one large bouquet. For example, he can make it using all three initial bouquets. The size of the large bouquet is then equal to 11 + 4 + 10 = 25.
|
```python
n = int(input())
even = 0
odd = 0
arr = input()
l = list(map(int, arr.split(' ')))
for x in l:
if (x % 2 == 0):
even += 1
else:
odd += 1
rs = min(even, odd)
even -= rs
odd -= rs
rs += int(odd / 3)
print(rs)
```
| 3
|
|
616
|
B
|
Dinner with Emma
|
PROGRAMMING
| 1,000
|
[
"games",
"greedy"
] | null | null |
Jack decides to invite Emma out for a dinner. Jack is a modest student, he doesn't want to go to an expensive restaurant. Emma is a girl with high taste, she prefers elite places.
Munhattan consists of *n* streets and *m* avenues. There is exactly one restaurant on the intersection of each street and avenue. The streets are numbered with integers from 1 to *n* and the avenues are numbered with integers from 1 to *m*. The cost of dinner in the restaurant at the intersection of the *i*-th street and the *j*-th avenue is *c**ij*.
Jack and Emma decide to choose the restaurant in the following way. Firstly Emma chooses the street to dinner and then Jack chooses the avenue. Emma and Jack makes their choice optimally: Emma wants to maximize the cost of the dinner, Jack wants to minimize it. Emma takes into account that Jack wants to minimize the cost of the dinner. Find the cost of the dinner for the couple in love.
|
The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of streets and avenues in Munhattan.
Each of the next *n* lines contains *m* integers *c**ij* (1<=≤<=*c**ij*<=≤<=109) — the cost of the dinner in the restaurant on the intersection of the *i*-th street and the *j*-th avenue.
|
Print the only integer *a* — the cost of the dinner for Jack and Emma.
|
[
"3 4\n4 1 3 5\n2 2 2 2\n5 4 5 1\n",
"3 3\n1 2 3\n2 3 1\n3 1 2\n"
] |
[
"2\n",
"1\n"
] |
In the first example if Emma chooses the first or the third streets Jack can choose an avenue with the cost of the dinner 1. So she chooses the second street and Jack chooses any avenue. The cost of the dinner is 2.
In the second example regardless of Emma's choice Jack can choose a restaurant with the cost of the dinner 1.
| 0
|
[
{
"input": "3 4\n4 1 3 5\n2 2 2 2\n5 4 5 1",
"output": "2"
},
{
"input": "3 3\n1 2 3\n2 3 1\n3 1 2",
"output": "1"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 10\n74 35 82 39 1 84 29 41 70 12",
"output": "1"
},
{
"input": "10 1\n44\n23\n65\n17\n48\n29\n49\n88\n91\n85",
"output": "91"
},
{
"input": "10 10\n256 72 455 45 912 506 235 68 951 92\n246 305 45 212 788 621 449 876 459 899\n732 107 230 357 370 610 997 669 61 192\n131 93 481 527 983 920 825 540 435 54\n777 682 984 20 337 480 264 137 249 502\n51 467 479 228 923 752 714 436 199 973\n3 91 612 571 631 212 751 84 886 948\n252 130 583 23 194 985 234 978 709 16\n636 991 203 469 719 540 184 902 503 652\n826 680 150 284 37 987 360 183 447 51",
"output": "184"
},
{
"input": "1 1\n1000000000",
"output": "1000000000"
},
{
"input": "2 1\n999999999\n1000000000",
"output": "1000000000"
}
] | 1,599,474,967
| 667
|
PyPy 3
|
OK
|
TESTS
| 16
| 155
| 1,638,400
|
import sys
n, m = map(int, input().split())
ans = 0
for _ in range(n):
ans = max(ans, min(map(int, input().split())))
print(ans)
|
Title: Dinner with Emma
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Jack decides to invite Emma out for a dinner. Jack is a modest student, he doesn't want to go to an expensive restaurant. Emma is a girl with high taste, she prefers elite places.
Munhattan consists of *n* streets and *m* avenues. There is exactly one restaurant on the intersection of each street and avenue. The streets are numbered with integers from 1 to *n* and the avenues are numbered with integers from 1 to *m*. The cost of dinner in the restaurant at the intersection of the *i*-th street and the *j*-th avenue is *c**ij*.
Jack and Emma decide to choose the restaurant in the following way. Firstly Emma chooses the street to dinner and then Jack chooses the avenue. Emma and Jack makes their choice optimally: Emma wants to maximize the cost of the dinner, Jack wants to minimize it. Emma takes into account that Jack wants to minimize the cost of the dinner. Find the cost of the dinner for the couple in love.
Input Specification:
The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of streets and avenues in Munhattan.
Each of the next *n* lines contains *m* integers *c**ij* (1<=≤<=*c**ij*<=≤<=109) — the cost of the dinner in the restaurant on the intersection of the *i*-th street and the *j*-th avenue.
Output Specification:
Print the only integer *a* — the cost of the dinner for Jack and Emma.
Demo Input:
['3 4\n4 1 3 5\n2 2 2 2\n5 4 5 1\n', '3 3\n1 2 3\n2 3 1\n3 1 2\n']
Demo Output:
['2\n', '1\n']
Note:
In the first example if Emma chooses the first or the third streets Jack can choose an avenue with the cost of the dinner 1. So she chooses the second street and Jack chooses any avenue. The cost of the dinner is 2.
In the second example regardless of Emma's choice Jack can choose a restaurant with the cost of the dinner 1.
|
```python
import sys
n, m = map(int, input().split())
ans = 0
for _ in range(n):
ans = max(ans, min(map(int, input().split())))
print(ans)
```
| 3
|
|
667
|
B
|
Coat of Anticubism
|
PROGRAMMING
| 1,100
|
[
"constructive algorithms",
"geometry"
] | null | null |
As some of you know, cubism is a trend in art, where the problem of constructing volumetrical shape on a plane with a combination of three-dimensional geometric shapes comes to the fore.
A famous sculptor Cicasso, whose self-portrait you can contemplate, hates cubism. He is more impressed by the idea to transmit two-dimensional objects through three-dimensional objects by using his magnificent sculptures. And his new project is connected with this. Cicasso wants to make a coat for the haters of anticubism. To do this, he wants to create a sculpture depicting a well-known geometric primitive — convex polygon.
Cicasso prepared for this a few blanks, which are rods with integer lengths, and now he wants to bring them together. The *i*-th rod is a segment of length *l**i*.
The sculptor plans to make a convex polygon with a nonzero area, using all rods he has as its sides. Each rod should be used as a side to its full length. It is forbidden to cut, break or bend rods. However, two sides may form a straight angle .
Cicasso knows that it is impossible to make a convex polygon with a nonzero area out of the rods with the lengths which he had chosen. Cicasso does not want to leave the unused rods, so the sculptor decides to make another rod-blank with an integer length so that his problem is solvable. Of course, he wants to make it as short as possible, because the materials are expensive, and it is improper deed to spend money for nothing.
Help sculptor!
|
The first line contains an integer *n* (3<=≤<=*n*<=≤<=105) — a number of rod-blanks.
The second line contains *n* integers *l**i* (1<=≤<=*l**i*<=≤<=109) — lengths of rods, which Cicasso already has. It is guaranteed that it is impossible to make a polygon with *n* vertices and nonzero area using the rods Cicasso already has.
|
Print the only integer *z* — the minimum length of the rod, so that after adding it it can be possible to construct convex polygon with (*n*<=+<=1) vertices and nonzero area from all of the rods.
|
[
"3\n1 2 1\n",
"5\n20 4 3 2 1\n"
] |
[
"1\n",
"11\n"
] |
In the first example triangle with sides {1 + 1 = 2, 2, 1} can be formed from a set of lengths {1, 1, 1, 2}.
In the second example you can make a triangle with lengths {20, 11, 4 + 3 + 2 + 1 = 10}.
| 1,000
|
[
{
"input": "3\n1 2 1",
"output": "1"
},
{
"input": "5\n20 4 3 2 1",
"output": "11"
},
{
"input": "7\n77486105 317474713 89523018 332007362 7897847 949616701 54820086",
"output": "70407571"
},
{
"input": "14\n245638694 2941428 4673577 12468 991349408 44735727 14046308 60637707 81525 104620306 88059371 53742651 8489205 3528194",
"output": "360142248"
},
{
"input": "19\n479740 7703374 196076708 180202968 579604 17429 16916 11989886 30832424 6384983 8937497 431 62955 48167457 898566333 29534955 1485775 848444 372839845",
"output": "2404943"
},
{
"input": "35\n306260 278 43508628 54350745 222255 842526 39010821 10627 14916465 3059978 61449 503809 2820 1609513 196062 65695 270869 15079297 2885093 189306 4682268 422616382 1642346 82340 6 2 975464673 1388191 70110665 272855 253160079 1849635 7837751 274070 10394",
"output": "34445194"
},
{
"input": "53\n1014364 40727 75774 243769 314 406417 5272684 14138 10640282 64955 2763 5667043 2121887 204672692 567643 60183 5183 11361359 2792918 199155 174809 16182540 21 392221 19434423 9140891 159733 15438 67903 3816799 616 429181 30392293 413992581 10847741 20771 16366654 1163 414283 156163 55907108 310278 95949614 185865 976650886 197610 87 61264 4586815 107764 26390852 331828 541",
"output": "25390787"
},
{
"input": "3\n1 1 1000000000",
"output": "999999999"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 1000000000",
"output": "999999956"
},
{
"input": "5\n100000000 100000000 100000000 100000000 500000000",
"output": "100000001"
},
{
"input": "3\n300000000 300000000 600000000",
"output": "1"
},
{
"input": "5\n10 4 3 2 1",
"output": "1"
},
{
"input": "3\n800000000 1 1",
"output": "799999999"
},
{
"input": "3\n1000000000 1 1",
"output": "999999999"
}
] | 1,681,561,359
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 51
| 124
| 8,499,200
|
n = int(input())
q = [int(x) for x in input().split()]
s = 0
m = 0
for i in range(n):
s += q[i]
m = max(m, q[i])
answer = 2*m - s + 1
print(answer)
|
Title: Coat of Anticubism
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As some of you know, cubism is a trend in art, where the problem of constructing volumetrical shape on a plane with a combination of three-dimensional geometric shapes comes to the fore.
A famous sculptor Cicasso, whose self-portrait you can contemplate, hates cubism. He is more impressed by the idea to transmit two-dimensional objects through three-dimensional objects by using his magnificent sculptures. And his new project is connected with this. Cicasso wants to make a coat for the haters of anticubism. To do this, he wants to create a sculpture depicting a well-known geometric primitive — convex polygon.
Cicasso prepared for this a few blanks, which are rods with integer lengths, and now he wants to bring them together. The *i*-th rod is a segment of length *l**i*.
The sculptor plans to make a convex polygon with a nonzero area, using all rods he has as its sides. Each rod should be used as a side to its full length. It is forbidden to cut, break or bend rods. However, two sides may form a straight angle .
Cicasso knows that it is impossible to make a convex polygon with a nonzero area out of the rods with the lengths which he had chosen. Cicasso does not want to leave the unused rods, so the sculptor decides to make another rod-blank with an integer length so that his problem is solvable. Of course, he wants to make it as short as possible, because the materials are expensive, and it is improper deed to spend money for nothing.
Help sculptor!
Input Specification:
The first line contains an integer *n* (3<=≤<=*n*<=≤<=105) — a number of rod-blanks.
The second line contains *n* integers *l**i* (1<=≤<=*l**i*<=≤<=109) — lengths of rods, which Cicasso already has. It is guaranteed that it is impossible to make a polygon with *n* vertices and nonzero area using the rods Cicasso already has.
Output Specification:
Print the only integer *z* — the minimum length of the rod, so that after adding it it can be possible to construct convex polygon with (*n*<=+<=1) vertices and nonzero area from all of the rods.
Demo Input:
['3\n1 2 1\n', '5\n20 4 3 2 1\n']
Demo Output:
['1\n', '11\n']
Note:
In the first example triangle with sides {1 + 1 = 2, 2, 1} can be formed from a set of lengths {1, 1, 1, 2}.
In the second example you can make a triangle with lengths {20, 11, 4 + 3 + 2 + 1 = 10}.
|
```python
n = int(input())
q = [int(x) for x in input().split()]
s = 0
m = 0
for i in range(n):
s += q[i]
m = max(m, q[i])
answer = 2*m - s + 1
print(answer)
```
| 3
|
|
992
|
B
|
Nastya Studies Informatics
|
PROGRAMMING
| 1,600
|
[
"math",
"number theory"
] | null | null |
Today on Informatics class Nastya learned about GCD and LCM (see links below). Nastya is very intelligent, so she solved all the tasks momentarily and now suggests you to solve one of them as well.
We define a pair of integers (*a*,<=*b*) good, if *GCD*(*a*,<=*b*)<==<=*x* and *LCM*(*a*,<=*b*)<==<=*y*, where *GCD*(*a*,<=*b*) denotes the [greatest common divisor](https://en.wikipedia.org/wiki/Greatest_common_divisor) of *a* and *b*, and *LCM*(*a*,<=*b*) denotes the [least common multiple](https://en.wikipedia.org/wiki/Least_common_multiple) of *a* and *b*.
You are given two integers *x* and *y*. You are to find the number of good pairs of integers (*a*,<=*b*) such that *l*<=≤<=*a*,<=*b*<=≤<=*r*. Note that pairs (*a*,<=*b*) and (*b*,<=*a*) are considered different if *a*<=≠<=*b*.
|
The only line contains four integers *l*,<=*r*,<=*x*,<=*y* (1<=≤<=*l*<=≤<=*r*<=≤<=109, 1<=≤<=*x*<=≤<=*y*<=≤<=109).
|
In the only line print the only integer — the answer for the problem.
|
[
"1 2 1 2\n",
"1 12 1 12\n",
"50 100 3 30\n"
] |
[
"2\n",
"4\n",
"0\n"
] |
In the first example there are two suitable good pairs of integers (*a*, *b*): (1, 2) and (2, 1).
In the second example there are four suitable good pairs of integers (*a*, *b*): (1, 12), (12, 1), (3, 4) and (4, 3).
In the third example there are good pairs of integers, for example, (3, 30), but none of them fits the condition *l* ≤ *a*, *b* ≤ *r*.
| 1,000
|
[
{
"input": "1 2 1 2",
"output": "2"
},
{
"input": "1 12 1 12",
"output": "4"
},
{
"input": "50 100 3 30",
"output": "0"
},
{
"input": "1 1000000000 1 1000000000",
"output": "4"
},
{
"input": "1 1000000000 158260522 200224287",
"output": "0"
},
{
"input": "1 1000000000 2 755829150",
"output": "8"
},
{
"input": "1 1000000000 158260522 158260522",
"output": "1"
},
{
"input": "1 1000000000 877914575 877914575",
"output": "1"
},
{
"input": "232 380232688 116 760465376",
"output": "30"
},
{
"input": "47259 3393570 267 600661890",
"output": "30"
},
{
"input": "1 1000000000 1 672672000",
"output": "64"
},
{
"input": "1000000000 1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1 1000000000 1 649209600",
"output": "32"
},
{
"input": "1 1000000000 1 682290000",
"output": "32"
},
{
"input": "1 1000000000 1 228614400",
"output": "16"
},
{
"input": "1 1000000000 1 800280000",
"output": "32"
},
{
"input": "1 1000000000 1 919987200",
"output": "16"
},
{
"input": "1 1000000000 1 456537870",
"output": "64"
},
{
"input": "1 1000000000 1 7198102",
"output": "8"
},
{
"input": "1 1000000000 1 58986263",
"output": "16"
},
{
"input": "1 1000000000 1 316465536",
"output": "16"
},
{
"input": "1 1000000000 1 9558312",
"output": "16"
},
{
"input": "1 1000000000 1 5461344",
"output": "16"
},
{
"input": "58 308939059 29 617878118",
"output": "62"
},
{
"input": "837 16262937 27 504151047",
"output": "28"
},
{
"input": "47275 402550 25 761222050",
"output": "12"
},
{
"input": "22 944623394 22 944623394",
"output": "32"
},
{
"input": "1032 8756124 12 753026664",
"output": "18"
},
{
"input": "7238 939389 11 618117962",
"output": "10"
},
{
"input": "58351 322621 23 818489477",
"output": "6"
},
{
"input": "3450 7068875 25 975504750",
"output": "86"
},
{
"input": "13266 1606792 22 968895576",
"output": "14"
},
{
"input": "21930 632925 15 925336350",
"output": "42"
},
{
"input": "2193 4224517 17 544962693",
"output": "42"
},
{
"input": "526792 39807152 22904 915564496",
"output": "8"
},
{
"input": "67728 122875524 16932 491502096",
"output": "12"
},
{
"input": "319813 63298373 24601 822878849",
"output": "6"
},
{
"input": "572464 23409136 15472 866138032",
"output": "4"
},
{
"input": "39443 809059020 19716 777638472",
"output": "12"
},
{
"input": "2544768 8906688 27072 837228672",
"output": "0"
},
{
"input": "413592 46975344 21768 892531536",
"output": "10"
},
{
"input": "11349 816231429 11349 816231429",
"output": "8"
},
{
"input": "16578 939956022 16578 939956022",
"output": "4"
},
{
"input": "2783175 6882425 21575 887832825",
"output": "2"
},
{
"input": "2862252 7077972 22188 913058388",
"output": "2"
},
{
"input": "1856828 13124976 25436 958123248",
"output": "6"
},
{
"input": "100 1000000000 158260522 158260522",
"output": "1"
},
{
"input": "100 1000000000 877914575 877914575",
"output": "1"
},
{
"input": "100 1000000000 602436426 602436426",
"output": "1"
},
{
"input": "100 1000000000 24979445 24979445",
"output": "1"
},
{
"input": "1 1000000000 18470 112519240",
"output": "4"
},
{
"input": "1 1000000000 22692 2201124",
"output": "2"
},
{
"input": "1 1000000000 24190 400949250",
"output": "16"
},
{
"input": "1 1000000000 33409 694005157",
"output": "2"
},
{
"input": "1 1000000000 24967 470827686",
"output": "16"
},
{
"input": "1 1000000000 35461 152517761",
"output": "8"
},
{
"input": "2 1000000000 158260522 200224287",
"output": "0"
},
{
"input": "2 1000000000 602436426 611751520",
"output": "0"
},
{
"input": "2 1000000000 861648772 942726551",
"output": "0"
},
{
"input": "2 1000000000 433933447 485982495",
"output": "0"
},
{
"input": "2 1000000000 262703497 480832794",
"output": "0"
},
{
"input": "2672374 422235092 1336187 844470184",
"output": "2"
},
{
"input": "1321815 935845020 1321815 935845020",
"output": "8"
},
{
"input": "29259607 69772909 2250739 907047817",
"output": "2"
},
{
"input": "11678540 172842392 2335708 864211960",
"output": "4"
},
{
"input": "297 173688298 2876112 851329152",
"output": "2"
},
{
"input": "7249 55497026 659 610467286",
"output": "28"
},
{
"input": "398520 1481490 810 728893080",
"output": "4"
},
{
"input": "2354 369467362 1177 738934724",
"output": "14"
},
{
"input": "407264 2497352 1144 889057312",
"output": "2"
},
{
"input": "321399 1651014 603 879990462",
"output": "4"
},
{
"input": "475640 486640 440 526057840",
"output": "2"
},
{
"input": "631714 179724831 1136 717625968",
"output": "0"
},
{
"input": "280476 1595832 588 761211864",
"output": "8"
},
{
"input": "10455 39598005 615 673166085",
"output": "6"
},
{
"input": "24725 19759875 575 849674625",
"output": "22"
},
{
"input": "22 158 2 1738",
"output": "2"
},
{
"input": "1 2623 1 2623",
"output": "4"
},
{
"input": "7 163677675 3 18",
"output": "0"
},
{
"input": "159 20749927 1 158",
"output": "0"
},
{
"input": "5252 477594071 1 5251",
"output": "0"
},
{
"input": "2202 449433679 3 6603",
"output": "0"
},
{
"input": "6 111 3 222",
"output": "2"
},
{
"input": "26 46 2 598",
"output": "2"
},
{
"input": "26 82 2 1066",
"output": "2"
},
{
"input": "1 2993 1 2993",
"output": "4"
},
{
"input": "17 17 1 289",
"output": "0"
},
{
"input": "177 267 3 15753",
"output": "2"
},
{
"input": "7388 22705183 1 7387",
"output": "0"
},
{
"input": "1 100 3 100",
"output": "0"
},
{
"input": "1 1000 6 1024",
"output": "0"
},
{
"input": "1 100 2 4",
"output": "2"
},
{
"input": "1 10000 2 455",
"output": "0"
},
{
"input": "1 1000000000 250000000 1000000000",
"output": "2"
},
{
"input": "3 3 1 1",
"output": "0"
},
{
"input": "1 1000000000 100000000 1000000000",
"output": "4"
},
{
"input": "5 10 3 3",
"output": "0"
},
{
"input": "1 1000 5 13",
"output": "0"
},
{
"input": "2 2 3 3",
"output": "0"
},
{
"input": "1 1000000000 499999993 999999986",
"output": "2"
},
{
"input": "1 1 1 10",
"output": "0"
},
{
"input": "1 10 10 100",
"output": "0"
},
{
"input": "1 1000 4 36",
"output": "2"
},
{
"input": "1 1000000000 10000000 20000000",
"output": "2"
},
{
"input": "100 100 5 5",
"output": "0"
},
{
"input": "3 3 3 9",
"output": "0"
},
{
"input": "36 200 24 144",
"output": "2"
},
{
"input": "1 100 3 10",
"output": "0"
}
] | 1,589,734,905
| 2,145
|
PyPy 3
|
OK
|
TESTS
| 108
| 155
| 21,401,600
|
l,r,x,y=map(int,input().split())
import math
def it(a):
if a<l or a>r:return(False)
return(True)
ans=0
div=set()
for i in range(1,int(y**0.5)+1):
if y%i==0 and (y//i)%x==0 and it(i*x) and it(y//i) and math.gcd(i,(y//i)//x)==1:
c=1 if i==(y//i)//x else 0
ans+=2-c
div.add(y//i)
div.add(i*x)
print(len(div))
|
Title: Nastya Studies Informatics
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today on Informatics class Nastya learned about GCD and LCM (see links below). Nastya is very intelligent, so she solved all the tasks momentarily and now suggests you to solve one of them as well.
We define a pair of integers (*a*,<=*b*) good, if *GCD*(*a*,<=*b*)<==<=*x* and *LCM*(*a*,<=*b*)<==<=*y*, where *GCD*(*a*,<=*b*) denotes the [greatest common divisor](https://en.wikipedia.org/wiki/Greatest_common_divisor) of *a* and *b*, and *LCM*(*a*,<=*b*) denotes the [least common multiple](https://en.wikipedia.org/wiki/Least_common_multiple) of *a* and *b*.
You are given two integers *x* and *y*. You are to find the number of good pairs of integers (*a*,<=*b*) such that *l*<=≤<=*a*,<=*b*<=≤<=*r*. Note that pairs (*a*,<=*b*) and (*b*,<=*a*) are considered different if *a*<=≠<=*b*.
Input Specification:
The only line contains four integers *l*,<=*r*,<=*x*,<=*y* (1<=≤<=*l*<=≤<=*r*<=≤<=109, 1<=≤<=*x*<=≤<=*y*<=≤<=109).
Output Specification:
In the only line print the only integer — the answer for the problem.
Demo Input:
['1 2 1 2\n', '1 12 1 12\n', '50 100 3 30\n']
Demo Output:
['2\n', '4\n', '0\n']
Note:
In the first example there are two suitable good pairs of integers (*a*, *b*): (1, 2) and (2, 1).
In the second example there are four suitable good pairs of integers (*a*, *b*): (1, 12), (12, 1), (3, 4) and (4, 3).
In the third example there are good pairs of integers, for example, (3, 30), but none of them fits the condition *l* ≤ *a*, *b* ≤ *r*.
|
```python
l,r,x,y=map(int,input().split())
import math
def it(a):
if a<l or a>r:return(False)
return(True)
ans=0
div=set()
for i in range(1,int(y**0.5)+1):
if y%i==0 and (y//i)%x==0 and it(i*x) and it(y//i) and math.gcd(i,(y//i)//x)==1:
c=1 if i==(y//i)//x else 0
ans+=2-c
div.add(y//i)
div.add(i*x)
print(len(div))
```
| 3
|
|
507
|
B
|
Amr and Pins
|
PROGRAMMING
| 1,400
|
[
"geometry",
"math"
] | null | null |
Amr loves Geometry. One day he came up with a very interesting problem.
Amr has a circle of radius *r* and center in point (*x*,<=*y*). He wants the circle center to be in new position (*x*',<=*y*').
In one step Amr can put a pin to the border of the circle in a certain point, then rotate the circle around that pin by any angle and finally remove the pin.
Help Amr to achieve his goal in minimum number of steps.
|
Input consists of 5 space-separated integers *r*, *x*, *y*, *x*' *y*' (1<=≤<=*r*<=≤<=105, <=-<=105<=≤<=*x*,<=*y*,<=*x*',<=*y*'<=≤<=105), circle radius, coordinates of original center of the circle and coordinates of destination center of the circle respectively.
|
Output a single integer — minimum number of steps required to move the center of the circle to the destination point.
|
[
"2 0 0 0 4\n",
"1 1 1 4 4\n",
"4 5 6 5 6\n"
] |
[
"1\n",
"3\n",
"0\n"
] |
In the first sample test the optimal way is to put a pin at point (0, 2) and rotate the circle by 180 degrees counter-clockwise (or clockwise, no matter).
<img class="tex-graphics" src="https://espresso.codeforces.com/4e40fd4cc24a2050a0488aa131e6244369328039.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 1,000
|
[
{
"input": "2 0 0 0 4",
"output": "1"
},
{
"input": "1 1 1 4 4",
"output": "3"
},
{
"input": "4 5 6 5 6",
"output": "0"
},
{
"input": "10 20 0 40 0",
"output": "1"
},
{
"input": "9 20 0 40 0",
"output": "2"
},
{
"input": "5 -1 -6 -5 1",
"output": "1"
},
{
"input": "99125 26876 -21414 14176 17443",
"output": "1"
},
{
"input": "8066 7339 19155 -90534 -60666",
"output": "8"
},
{
"input": "100000 -100000 -100000 100000 100000",
"output": "2"
},
{
"input": "10 20 0 41 0",
"output": "2"
},
{
"input": "25 -64 -6 -56 64",
"output": "2"
},
{
"input": "125 455 450 439 721",
"output": "2"
},
{
"input": "5 6 3 7 2",
"output": "1"
},
{
"input": "24 130 14786 3147 2140",
"output": "271"
},
{
"input": "125 -363 176 93 330",
"output": "2"
},
{
"input": "1 14 30 30 14",
"output": "12"
},
{
"input": "25 96 13 7 2",
"output": "2"
},
{
"input": "4 100000 -100000 100000 -100000",
"output": "0"
},
{
"input": "1 3 4 2 5",
"output": "1"
},
{
"input": "1 -3 3 2 6",
"output": "3"
},
{
"input": "2 7 20 13 -5",
"output": "7"
},
{
"input": "1 1 1 1 4",
"output": "2"
},
{
"input": "249 -54242 -30537 -45023 -89682",
"output": "121"
},
{
"input": "4 100000 -100000 100000 -99999",
"output": "1"
},
{
"input": "97741 23818 78751 97583 26933",
"output": "1"
},
{
"input": "56767 -29030 51625 79823 -56297",
"output": "2"
},
{
"input": "98260 13729 74998 23701 9253",
"output": "1"
},
{
"input": "67377 -80131 -90254 -57320 14102",
"output": "1"
},
{
"input": "1 100000 100000 100000 -100000",
"output": "100000"
},
{
"input": "19312 19470 82059 58064 62231",
"output": "2"
},
{
"input": "67398 -68747 -79056 -34193 29400",
"output": "1"
},
{
"input": "91099 37184 -71137 75650 -3655",
"output": "1"
},
{
"input": "46456 -2621 -23623 -98302 -99305",
"output": "2"
},
{
"input": "100 100000 -100000 100000 -99999",
"output": "1"
},
{
"input": "1 100000 -100000 100000 -100000",
"output": "0"
},
{
"input": "8 0 0 0 32",
"output": "2"
},
{
"input": "100000 100000 1 -100000 0",
"output": "2"
}
] | 1,580,452,118
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 124
| 307,200
|
r,x,y,a,b=map(int,input().split())
n=(((x-a)**2+(y-b)**2)**0.5)/(2*r)
if n==int(n):
print(int(n))
else:
print(int(n+1))
|
Title: Amr and Pins
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Amr loves Geometry. One day he came up with a very interesting problem.
Amr has a circle of radius *r* and center in point (*x*,<=*y*). He wants the circle center to be in new position (*x*',<=*y*').
In one step Amr can put a pin to the border of the circle in a certain point, then rotate the circle around that pin by any angle and finally remove the pin.
Help Amr to achieve his goal in minimum number of steps.
Input Specification:
Input consists of 5 space-separated integers *r*, *x*, *y*, *x*' *y*' (1<=≤<=*r*<=≤<=105, <=-<=105<=≤<=*x*,<=*y*,<=*x*',<=*y*'<=≤<=105), circle radius, coordinates of original center of the circle and coordinates of destination center of the circle respectively.
Output Specification:
Output a single integer — minimum number of steps required to move the center of the circle to the destination point.
Demo Input:
['2 0 0 0 4\n', '1 1 1 4 4\n', '4 5 6 5 6\n']
Demo Output:
['1\n', '3\n', '0\n']
Note:
In the first sample test the optimal way is to put a pin at point (0, 2) and rotate the circle by 180 degrees counter-clockwise (or clockwise, no matter).
<img class="tex-graphics" src="https://espresso.codeforces.com/4e40fd4cc24a2050a0488aa131e6244369328039.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
r,x,y,a,b=map(int,input().split())
n=(((x-a)**2+(y-b)**2)**0.5)/(2*r)
if n==int(n):
print(int(n))
else:
print(int(n+1))
```
| 3
|
|
888
|
D
|
Almost Identity Permutations
|
PROGRAMMING
| 1,600
|
[
"combinatorics",
"dp",
"math"
] | null | null |
A permutation *p* of size *n* is an array such that every integer from 1 to *n* occurs exactly once in this array.
Let's call a permutation an almost identity permutation iff there exist at least *n*<=-<=*k* indices *i* (1<=≤<=*i*<=≤<=*n*) such that *p**i*<==<=*i*.
Your task is to count the number of almost identity permutations for given numbers *n* and *k*.
|
The first line contains two integers *n* and *k* (4<=≤<=*n*<=≤<=1000, 1<=≤<=*k*<=≤<=4).
|
Print the number of almost identity permutations for given *n* and *k*.
|
[
"4 1\n",
"4 2\n",
"5 3\n",
"5 4\n"
] |
[
"1\n",
"7\n",
"31\n",
"76\n"
] |
none
| 0
|
[
{
"input": "4 1",
"output": "1"
},
{
"input": "4 2",
"output": "7"
},
{
"input": "5 3",
"output": "31"
},
{
"input": "5 4",
"output": "76"
},
{
"input": "200 1",
"output": "1"
},
{
"input": "200 2",
"output": "19901"
},
{
"input": "200 3",
"output": "2646701"
},
{
"input": "200 4",
"output": "584811251"
},
{
"input": "400 1",
"output": "1"
},
{
"input": "400 2",
"output": "79801"
},
{
"input": "400 3",
"output": "21253401"
},
{
"input": "400 4",
"output": "9477912501"
},
{
"input": "600 1",
"output": "1"
},
{
"input": "600 2",
"output": "179701"
},
{
"input": "600 3",
"output": "71820101"
},
{
"input": "600 4",
"output": "48187303751"
},
{
"input": "800 1",
"output": "1"
},
{
"input": "800 2",
"output": "319601"
},
{
"input": "800 3",
"output": "170346801"
},
{
"input": "800 4",
"output": "152620985001"
},
{
"input": "1000 1",
"output": "1"
},
{
"input": "1000 2",
"output": "499501"
},
{
"input": "1000 3",
"output": "332833501"
},
{
"input": "1000 4",
"output": "373086956251"
},
{
"input": "4 4",
"output": "24"
}
] | 1,590,146,261
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 25
| 156
| 0
|
import sys
import math
def derange(k):
ans=math.factorial(k)
z=-1
mult=1
for i in range(1,k+1):
mult += z * (1/(math.factorial(i)))
z *= -1
ans=ans*mult
#print(ans,'ans')
return int(ans)
def com(n,k):
if k==0:
return 1
if k==1:
return n
if k==2:
return n*(n-1)//2
if k==3:
return n*(n-1)*(n-2)//6
return n*(n-1)*(n-2)*(n-3)//24
n,k=map(int,sys.stdin.readline().split())
ans=0
for i in range(k+1):
x = com(n,i)*derange(i)
ans += x
print(ans)
|
Title: Almost Identity Permutations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A permutation *p* of size *n* is an array such that every integer from 1 to *n* occurs exactly once in this array.
Let's call a permutation an almost identity permutation iff there exist at least *n*<=-<=*k* indices *i* (1<=≤<=*i*<=≤<=*n*) such that *p**i*<==<=*i*.
Your task is to count the number of almost identity permutations for given numbers *n* and *k*.
Input Specification:
The first line contains two integers *n* and *k* (4<=≤<=*n*<=≤<=1000, 1<=≤<=*k*<=≤<=4).
Output Specification:
Print the number of almost identity permutations for given *n* and *k*.
Demo Input:
['4 1\n', '4 2\n', '5 3\n', '5 4\n']
Demo Output:
['1\n', '7\n', '31\n', '76\n']
Note:
none
|
```python
import sys
import math
def derange(k):
ans=math.factorial(k)
z=-1
mult=1
for i in range(1,k+1):
mult += z * (1/(math.factorial(i)))
z *= -1
ans=ans*mult
#print(ans,'ans')
return int(ans)
def com(n,k):
if k==0:
return 1
if k==1:
return n
if k==2:
return n*(n-1)//2
if k==3:
return n*(n-1)*(n-2)//6
return n*(n-1)*(n-2)*(n-3)//24
n,k=map(int,sys.stdin.readline().split())
ans=0
for i in range(k+1):
x = com(n,i)*derange(i)
ans += x
print(ans)
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,672,159,113
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 92
| 0
|
word = str(input())
length = len(word)
upper_count = 0
lower_count = 0
for letter in word:
if letter.isupper():
upper_count += 1
for letter in word:
if letter.islower():
lower_count += 1
if upper_count>lower_count:
print(word.upper())
else:
print(word.lower())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
word = str(input())
length = len(word)
upper_count = 0
lower_count = 0
for letter in word:
if letter.isupper():
upper_count += 1
for letter in word:
if letter.islower():
lower_count += 1
if upper_count>lower_count:
print(word.upper())
else:
print(word.lower())
```
| 3.977
|
75
|
A
|
Life Without Zeros
|
PROGRAMMING
| 1,000
|
[
"implementation"
] |
A. Life Without Zeros
|
2
|
256
|
Can you imagine our life if we removed all zeros from it? For sure we will have many problems.
In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros?
For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation.
But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation.
|
The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*.
|
The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise.
|
[
"101\n102\n",
"105\n106\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "101\n102",
"output": "YES"
},
{
"input": "105\n106",
"output": "NO"
},
{
"input": "544\n397",
"output": "YES"
},
{
"input": "822\n280",
"output": "NO"
},
{
"input": "101\n413",
"output": "NO"
},
{
"input": "309\n139",
"output": "NO"
},
{
"input": "693\n970",
"output": "NO"
},
{
"input": "981\n1",
"output": "YES"
},
{
"input": "352\n276",
"output": "YES"
},
{
"input": "164\n691",
"output": "YES"
},
{
"input": "110036\n43",
"output": "YES"
},
{
"input": "100\n1000",
"output": "NO"
},
{
"input": "1000000000\n1000000000",
"output": "YES"
},
{
"input": "999999999\n999999999",
"output": "YES"
},
{
"input": "6\n4",
"output": "NO"
},
{
"input": "123456\n876543",
"output": "YES"
},
{
"input": "1234567\n9876543",
"output": "NO"
},
{
"input": "1111111\n1119111",
"output": "NO"
},
{
"input": "10502405\n40403403",
"output": "YES"
},
{
"input": "1\n1",
"output": "YES"
},
{
"input": "5\n4",
"output": "YES"
},
{
"input": "1\n6",
"output": "YES"
},
{
"input": "40\n17",
"output": "NO"
},
{
"input": "35\n81",
"output": "YES"
},
{
"input": "347\n908",
"output": "NO"
},
{
"input": "2081\n7450",
"output": "NO"
},
{
"input": "84355694\n373629503",
"output": "NO"
},
{
"input": "885992048\n510468672",
"output": "NO"
},
{
"input": "540144752\n647307841",
"output": "NO"
},
{
"input": "341781108\n784147010",
"output": "NO"
},
{
"input": "960440938\n572334653",
"output": "NO"
},
{
"input": "657414510\n768771903",
"output": "NO"
},
{
"input": "501871728\n725074574",
"output": "NO"
},
{
"input": "968\n851",
"output": "YES"
},
{
"input": "943\n939",
"output": "YES"
},
{
"input": "347\n908",
"output": "NO"
},
{
"input": "611\n41",
"output": "YES"
},
{
"input": "737\n289",
"output": "NO"
},
{
"input": "168\n571",
"output": "YES"
},
{
"input": "868\n463",
"output": "YES"
},
{
"input": "815732007\n913882008",
"output": "NO"
},
{
"input": "459039901\n453033850",
"output": "NO"
},
{
"input": "975305404\n484601256",
"output": "NO"
}
] | 1,643,021,935
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 43
| 92
| 0
|
n1 = input()
n2 = input()
withoutz1 = ""
withoutz2 = ""
for cur in n1:
if cur != "0":
withoutz1 += cur
for cur in n2:
if cur != "0":
withoutz2 += cur
res = int(n1)+int(n2)
r = ""
for cur in str(res):
if cur != "0":
r += cur
print("YES" if int(withoutz1)+int(withoutz2)==int(r) else "NO")
|
Title: Life Without Zeros
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Can you imagine our life if we removed all zeros from it? For sure we will have many problems.
In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros?
For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation.
But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation.
Input Specification:
The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*.
Output Specification:
The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise.
Demo Input:
['101\n102\n', '105\n106\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
n1 = input()
n2 = input()
withoutz1 = ""
withoutz2 = ""
for cur in n1:
if cur != "0":
withoutz1 += cur
for cur in n2:
if cur != "0":
withoutz2 += cur
res = int(n1)+int(n2)
r = ""
for cur in str(res):
if cur != "0":
r += cur
print("YES" if int(withoutz1)+int(withoutz2)==int(r) else "NO")
```
| 3.977
|
581
|
A
|
Vasya the Hipster
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him?
|
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
|
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
|
[
"3 1\n",
"2 3\n",
"7 3\n"
] |
[
"1 1\n",
"2 0\n",
"3 2\n"
] |
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
| 500
|
[
{
"input": "3 1",
"output": "1 1"
},
{
"input": "2 3",
"output": "2 0"
},
{
"input": "7 3",
"output": "3 2"
},
{
"input": "100 100",
"output": "100 0"
},
{
"input": "4 10",
"output": "4 3"
},
{
"input": "6 10",
"output": "6 2"
},
{
"input": "6 11",
"output": "6 2"
},
{
"input": "10 40",
"output": "10 15"
},
{
"input": "11 56",
"output": "11 22"
},
{
"input": "34 30",
"output": "30 2"
},
{
"input": "33 33",
"output": "33 0"
},
{
"input": "100 45",
"output": "45 27"
},
{
"input": "100 23",
"output": "23 38"
},
{
"input": "45 12",
"output": "12 16"
},
{
"input": "1 1",
"output": "1 0"
},
{
"input": "1 100",
"output": "1 49"
},
{
"input": "100 1",
"output": "1 49"
},
{
"input": "68 59",
"output": "59 4"
},
{
"input": "45 99",
"output": "45 27"
},
{
"input": "99 100",
"output": "99 0"
},
{
"input": "100 98",
"output": "98 1"
},
{
"input": "59 12",
"output": "12 23"
},
{
"input": "86 4",
"output": "4 41"
},
{
"input": "68 21",
"output": "21 23"
},
{
"input": "100 11",
"output": "11 44"
},
{
"input": "100 10",
"output": "10 45"
},
{
"input": "15 45",
"output": "15 15"
},
{
"input": "11 32",
"output": "11 10"
},
{
"input": "34 96",
"output": "34 31"
},
{
"input": "89 89",
"output": "89 0"
}
] | 1,681,461,803
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 77
| 0
|
a,b = map(int,input().split())
l = min(a,b)
p = (max(a,b)-l)//2
print(l,p)
|
Title: Vasya the Hipster
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him?
Input Specification:
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
Output Specification:
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
Demo Input:
['3 1\n', '2 3\n', '7 3\n']
Demo Output:
['1 1\n', '2 0\n', '3 2\n']
Note:
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day.
|
```python
a,b = map(int,input().split())
l = min(a,b)
p = (max(a,b)-l)//2
print(l,p)
```
| 3
|
|
918
|
A
|
Eleven
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
Eleven wants to choose a new name for herself. As a bunch of geeks, her friends suggested an algorithm to choose a name for her. Eleven wants her name to have exactly *n* characters.
Her friend suggested that her name should only consist of uppercase and lowercase letters 'O'. More precisely, they suggested that the *i*-th letter of her name should be 'O' (uppercase) if *i* is a member of Fibonacci sequence, and 'o' (lowercase) otherwise. The letters in the name are numbered from 1 to *n*. Fibonacci sequence is the sequence *f* where
- *f*1<==<=1, - *f*2<==<=1, - *f**n*<==<=*f**n*<=-<=2<=+<=*f**n*<=-<=1 (*n*<=><=2).
As her friends are too young to know what Fibonacci sequence is, they asked you to help Eleven determine her new name.
|
The first and only line of input contains an integer *n* (1<=≤<=*n*<=≤<=1000).
|
Print Eleven's new name on the first and only line of output.
|
[
"8\n",
"15\n"
] |
[
"OOOoOooO\n",
"OOOoOooOooooOoo\n"
] |
none
| 500
|
[
{
"input": "8",
"output": "OOOoOooO"
},
{
"input": "15",
"output": "OOOoOooOooooOoo"
},
{
"input": "85",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooo"
},
{
"input": "381",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooo"
},
{
"input": "805",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "1000",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "1",
"output": "O"
},
{
"input": "2",
"output": "OO"
},
{
"input": "3",
"output": "OOO"
},
{
"input": "5",
"output": "OOOoO"
},
{
"input": "17",
"output": "OOOoOooOooooOoooo"
},
{
"input": "49",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooo"
},
{
"input": "256",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooo"
},
{
"input": "512",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "933",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "61",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooo"
},
{
"input": "781",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "999",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
}
] | 1,665,831,368
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 18
| 46
| 0
|
# Το σίδερο όσο το χτυπάς τόσο γίνεται ατσάλι
"""
1. Read carefully, understand the problem & its output.
2. Think about the solution using pen & paper.
3. Code the solution.
4. Test with edge cases: 0 len, empty str, identical elements.
5. Debug if needed and iterate process.
"""
n = int(input())
_set = set()
a, b = 1, 1
while a <= n:
_set.add(a)
a, b = b, a+b
name = ''
for i in range(n):
if i+1 in _set:
name += 'O'
else:
name += 'o'
print(name)
|
Title: Eleven
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Eleven wants to choose a new name for herself. As a bunch of geeks, her friends suggested an algorithm to choose a name for her. Eleven wants her name to have exactly *n* characters.
Her friend suggested that her name should only consist of uppercase and lowercase letters 'O'. More precisely, they suggested that the *i*-th letter of her name should be 'O' (uppercase) if *i* is a member of Fibonacci sequence, and 'o' (lowercase) otherwise. The letters in the name are numbered from 1 to *n*. Fibonacci sequence is the sequence *f* where
- *f*1<==<=1, - *f*2<==<=1, - *f**n*<==<=*f**n*<=-<=2<=+<=*f**n*<=-<=1 (*n*<=><=2).
As her friends are too young to know what Fibonacci sequence is, they asked you to help Eleven determine her new name.
Input Specification:
The first and only line of input contains an integer *n* (1<=≤<=*n*<=≤<=1000).
Output Specification:
Print Eleven's new name on the first and only line of output.
Demo Input:
['8\n', '15\n']
Demo Output:
['OOOoOooO\n', 'OOOoOooOooooOoo\n']
Note:
none
|
```python
# Το σίδερο όσο το χτυπάς τόσο γίνεται ατσάλι
"""
1. Read carefully, understand the problem & its output.
2. Think about the solution using pen & paper.
3. Code the solution.
4. Test with edge cases: 0 len, empty str, identical elements.
5. Debug if needed and iterate process.
"""
n = int(input())
_set = set()
a, b = 1, 1
while a <= n:
_set.add(a)
a, b = b, a+b
name = ''
for i in range(n):
if i+1 in _set:
name += 'O'
else:
name += 'o'
print(name)
```
| 3
|
|
71
|
A
|
Way Too Long Words
|
PROGRAMMING
| 800
|
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500
|
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,697,014,942
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 46
| 0
|
t1 = int(input())
for j in range(t1):
ch=input()
l=len(ch)
if l>10:
print(ch[0]+str(l-2)+ch[-1])
else:
print(ch)
##
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
t1 = int(input())
for j in range(t1):
ch=input()
l=len(ch)
if l>10:
print(ch[0]+str(l-2)+ch[-1])
else:
print(ch)
##
```
| 3.977
|
804
|
A
|
Find Amir
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms",
"greedy",
"math"
] | null | null |
A few years ago Sajjad left his school and register to another one due to security reasons. Now he wishes to find Amir, one of his schoolmates and good friends.
There are *n* schools numerated from 1 to *n*. One can travel between each pair of them, to do so, he needs to buy a ticket. The ticker between schools *i* and *j* costs and can be used multiple times. Help Sajjad to find the minimum cost he needs to pay for tickets to visit all schools. He can start and finish in any school.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of schools.
|
Print single integer: the minimum cost of tickets needed to visit all schools.
|
[
"2\n",
"10\n"
] |
[
"0\n",
"4\n"
] |
In the first example we can buy a ticket between the schools that costs <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c67d72010e0498bfd065a6a38fdeaec90358507b.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
| 500
|
[
{
"input": "2",
"output": "0"
},
{
"input": "10",
"output": "4"
},
{
"input": "43670",
"output": "21834"
},
{
"input": "4217",
"output": "2108"
},
{
"input": "17879",
"output": "8939"
},
{
"input": "31809",
"output": "15904"
},
{
"input": "40873",
"output": "20436"
},
{
"input": "77859",
"output": "38929"
},
{
"input": "53022",
"output": "26510"
},
{
"input": "79227",
"output": "39613"
},
{
"input": "100000",
"output": "49999"
},
{
"input": "82801",
"output": "41400"
},
{
"input": "5188",
"output": "2593"
},
{
"input": "86539",
"output": "43269"
},
{
"input": "12802",
"output": "6400"
},
{
"input": "20289",
"output": "10144"
},
{
"input": "32866",
"output": "16432"
},
{
"input": "33377",
"output": "16688"
},
{
"input": "31775",
"output": "15887"
},
{
"input": "60397",
"output": "30198"
},
{
"input": "100000",
"output": "49999"
},
{
"input": "99999",
"output": "49999"
},
{
"input": "99998",
"output": "49998"
},
{
"input": "99997",
"output": "49998"
},
{
"input": "99996",
"output": "49997"
},
{
"input": "1",
"output": "0"
},
{
"input": "2",
"output": "0"
},
{
"input": "3",
"output": "1"
},
{
"input": "4",
"output": "1"
},
{
"input": "1",
"output": "0"
},
{
"input": "3",
"output": "1"
}
] | 1,646,200,092
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 31
| 62
| 0
|
n=int(input())
n-=1
print(n//2)
|
Title: Find Amir
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A few years ago Sajjad left his school and register to another one due to security reasons. Now he wishes to find Amir, one of his schoolmates and good friends.
There are *n* schools numerated from 1 to *n*. One can travel between each pair of them, to do so, he needs to buy a ticket. The ticker between schools *i* and *j* costs and can be used multiple times. Help Sajjad to find the minimum cost he needs to pay for tickets to visit all schools. He can start and finish in any school.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of schools.
Output Specification:
Print single integer: the minimum cost of tickets needed to visit all schools.
Demo Input:
['2\n', '10\n']
Demo Output:
['0\n', '4\n']
Note:
In the first example we can buy a ticket between the schools that costs <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c67d72010e0498bfd065a6a38fdeaec90358507b.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
|
```python
n=int(input())
n-=1
print(n//2)
```
| 3
|
|
155
|
A
|
I_love_\%username\%
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
|
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
|
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
|
[
"5\n100 50 200 150 200\n",
"10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n"
] |
[
"2\n",
"4\n"
] |
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing.
| 500
|
[
{
"input": "5\n100 50 200 150 200",
"output": "2"
},
{
"input": "10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242",
"output": "4"
},
{
"input": "1\n6",
"output": "0"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n100 36 53 7 81",
"output": "2"
},
{
"input": "5\n7 36 53 81 100",
"output": "4"
},
{
"input": "5\n100 81 53 36 7",
"output": "4"
},
{
"input": "10\n8 6 3 4 9 10 7 7 1 3",
"output": "5"
},
{
"input": "10\n1627 1675 1488 1390 1812 1137 1746 1324 1952 1862",
"output": "6"
},
{
"input": "10\n1 3 3 4 6 7 7 8 9 10",
"output": "7"
},
{
"input": "10\n1952 1862 1812 1746 1675 1627 1488 1390 1324 1137",
"output": "9"
},
{
"input": "25\n1448 4549 2310 2725 2091 3509 1565 2475 2232 3989 4231 779 2967 2702 608 3739 721 1552 2767 530 3114 665 1940 48 4198",
"output": "5"
},
{
"input": "33\n1097 1132 1091 1104 1049 1038 1023 1080 1104 1029 1035 1061 1049 1060 1088 1106 1105 1087 1063 1076 1054 1103 1047 1041 1028 1120 1126 1063 1117 1110 1044 1093 1101",
"output": "5"
},
{
"input": "34\n821 5536 2491 6074 7216 9885 764 1603 778 8736 8987 771 617 1587 8943 7922 439 7367 4115 8886 7878 6899 8811 5752 3184 3401 9760 9400 8995 4681 1323 6637 6554 6498",
"output": "7"
},
{
"input": "68\n6764 6877 6950 6768 6839 6755 6726 6778 6699 6805 6777 6985 6821 6801 6791 6805 6940 6761 6677 6999 6911 6699 6959 6933 6903 6843 6972 6717 6997 6756 6789 6668 6735 6852 6735 6880 6723 6834 6810 6694 6780 6679 6698 6857 6826 6896 6979 6968 6957 6988 6960 6700 6919 6892 6984 6685 6813 6678 6715 6857 6976 6902 6780 6686 6777 6686 6842 6679",
"output": "9"
},
{
"input": "60\n9000 9014 9034 9081 9131 9162 9174 9199 9202 9220 9221 9223 9229 9235 9251 9260 9268 9269 9270 9298 9307 9309 9313 9323 9386 9399 9407 9495 9497 9529 9531 9544 9614 9615 9627 9627 9643 9654 9656 9657 9685 9699 9701 9736 9745 9758 9799 9827 9843 9845 9854 9854 9885 9891 9896 9913 9942 9963 9986 9992",
"output": "57"
},
{
"input": "100\n7 61 12 52 41 16 34 99 30 44 48 89 31 54 21 1 48 52 61 15 35 87 21 76 64 92 44 81 16 93 84 92 32 15 68 76 53 39 26 4 11 26 7 4 99 99 61 65 55 85 65 67 47 39 2 74 63 49 98 87 5 94 22 30 25 42 31 84 49 23 89 60 16 26 92 27 9 57 75 61 94 35 83 47 99 100 63 24 91 88 79 10 15 45 22 64 3 11 89 83",
"output": "4"
},
{
"input": "100\n9999 9999 9999 9998 9998 9998 9997 9996 9996 9995 9993 9993 9991 9990 9989 9986 9984 9984 9983 9981 9981 9980 9980 9980 9979 9977 9977 9977 9977 9977 9976 9976 9975 9975 9973 9972 9972 9972 9972 9971 9969 9969 9969 9968 9967 9965 9962 9962 9962 9962 9960 9958 9958 9955 9954 9954 9954 9954 9950 9949 9949 9947 9943 9943 9940 9940 9939 9937 9937 9937 9936 9935 9932 9932 9931 9929 9927 9927 9926 9923 9919 9919 9918 9918 9918 9917 9917 9916 9916 9915 9914 9911 9910 9907 9907 9906 9905 9905 9904 9901",
"output": "57"
},
{
"input": "100\n158 159 157 156 155 154 160 153 161 152 162 163 151 164 150 165 149 148 147 166 146 167 145 144 143 142 168 141 169 170 140 139 138 137 171 136 135 134 172 173 174 133 175 132 177 178 131 179 180 130 129 181 128 127 182 126 183 125 124 184 123 122 121 120 119 118 117 185 186 187 188 189 116 190 115 191 192 193 114 113 112 111 110 109 108 194 195 107 106 105 196 197 104 198 199 103 102 200 101 100",
"output": "99"
},
{
"input": "2\n0 10000",
"output": "1"
},
{
"input": "2\n5 5",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n10 10",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
}
] | 1,676,386,899
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 37
| 92
| 0
|
n=int(input())
h=input().split()
mx=int(h[0])
mn=int(h[0])
kol=0
for i in h:
if int(i)>mx:
mx=int(i)
kol+=1
if int(i)<mn:
mn=int(i)
kol+=1
print(kol)
|
Title: I_love_\%username\%
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
Output Specification:
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
Demo Input:
['5\n100 50 200 150 200\n', '10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n']
Demo Output:
['2\n', '4\n']
Note:
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing.
|
```python
n=int(input())
h=input().split()
mx=int(h[0])
mn=int(h[0])
kol=0
for i in h:
if int(i)>mx:
mx=int(i)
kol+=1
if int(i)<mn:
mn=int(i)
kol+=1
print(kol)
```
| 3
|
|
900
|
B
|
Position in Fraction
|
PROGRAMMING
| 1,300
|
[
"math",
"number theory"
] | null | null |
You have a fraction . You need to find the first occurrence of digit *c* into decimal notation of the fraction after decimal point.
|
The first contains three single positive integers *a*, *b*, *c* (1<=≤<=*a*<=<<=*b*<=≤<=105, 0<=≤<=*c*<=≤<=9).
|
Print position of the first occurrence of digit *c* into the fraction. Positions are numbered from 1 after decimal point. It there is no such position, print -1.
|
[
"1 2 0\n",
"2 3 7\n"
] |
[
"2",
"-1"
] |
The fraction in the first example has the following decimal notation: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/896357459a466614a0542f34c9cfb0cef1afc9ed.png" style="max-width: 100.0%;max-height: 100.0%;"/>. The first zero stands on second position.
The fraction in the second example has the following decimal notation: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/130ba579a8276fc53a1917606eee9db58817f28d.png" style="max-width: 100.0%;max-height: 100.0%;"/>. There is no digit 7 in decimal notation of the fraction.
| 1,000
|
[
{
"input": "1 2 0",
"output": "2"
},
{
"input": "2 3 7",
"output": "-1"
},
{
"input": "1 100000 1",
"output": "5"
},
{
"input": "1 7 7",
"output": "6"
},
{
"input": "99999 100000 8",
"output": "-1"
},
{
"input": "44102 73848 2",
"output": "132"
},
{
"input": "7 31 3",
"output": "15"
},
{
"input": "8880 81608 9",
"output": "161"
},
{
"input": "4942 62768 5",
"output": "122"
},
{
"input": "69168 84860 4",
"output": "107"
},
{
"input": "971 1883 3",
"output": "130"
},
{
"input": "1636 3269 6",
"output": "150"
},
{
"input": "6873 7769 3",
"output": "163"
},
{
"input": "13805 15538 3",
"output": "164"
},
{
"input": "10958 21926 3",
"output": "117"
},
{
"input": "8 51 0",
"output": "10"
},
{
"input": "1 10 1",
"output": "1"
},
{
"input": "1 9 0",
"output": "-1"
},
{
"input": "53 101 6",
"output": "-1"
},
{
"input": "1 10001 9",
"output": "5"
},
{
"input": "25102 31579 2",
"output": "174"
},
{
"input": "38790 39359 0",
"output": "212"
},
{
"input": "47117 78718 0",
"output": "213"
},
{
"input": "1 57 0",
"output": "1"
},
{
"input": "1 3 0",
"output": "-1"
},
{
"input": "1 100 0",
"output": "1"
},
{
"input": "2 3 0",
"output": "-1"
},
{
"input": "99971 99989 0",
"output": "9"
},
{
"input": "567 1580 0",
"output": "6"
},
{
"input": "45 97 0",
"output": "39"
},
{
"input": "35 111 4",
"output": "-1"
},
{
"input": "1 2 5",
"output": "1"
},
{
"input": "1 7 0",
"output": "-1"
}
] | 1,516,731,950
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 33
| 77
| 6,041,600
|
from decimal import *
getcontext().prec = 2048
getcontext().rounding = ROUND_DOWN
num, denom, target = [int(x) for x in input().split()]
a = Decimal(num)/Decimal(denom)
a = str(a)
a = a[a.find('.') : ]
if len(a) < 2047:
a = a + '0'
print(a.find(str(target)))
|
Title: Position in Fraction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have a fraction . You need to find the first occurrence of digit *c* into decimal notation of the fraction after decimal point.
Input Specification:
The first contains three single positive integers *a*, *b*, *c* (1<=≤<=*a*<=<<=*b*<=≤<=105, 0<=≤<=*c*<=≤<=9).
Output Specification:
Print position of the first occurrence of digit *c* into the fraction. Positions are numbered from 1 after decimal point. It there is no such position, print -1.
Demo Input:
['1 2 0\n', '2 3 7\n']
Demo Output:
['2', '-1']
Note:
The fraction in the first example has the following decimal notation: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/896357459a466614a0542f34c9cfb0cef1afc9ed.png" style="max-width: 100.0%;max-height: 100.0%;"/>. The first zero stands on second position.
The fraction in the second example has the following decimal notation: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/130ba579a8276fc53a1917606eee9db58817f28d.png" style="max-width: 100.0%;max-height: 100.0%;"/>. There is no digit 7 in decimal notation of the fraction.
|
```python
from decimal import *
getcontext().prec = 2048
getcontext().rounding = ROUND_DOWN
num, denom, target = [int(x) for x in input().split()]
a = Decimal(num)/Decimal(denom)
a = str(a)
a = a[a.find('.') : ]
if len(a) < 2047:
a = a + '0'
print(a.find(str(target)))
```
| 3
|
|
961
|
A
|
Tetris
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
You are given a following process.
There is a platform with $n$ columns. $1 \times 1$ squares are appearing one after another in some columns on this platform. If there are no squares in the column, a square will occupy the bottom row. Otherwise a square will appear at the top of the highest square of this column.
When all of the $n$ columns have at least one square in them, the bottom row is being removed. You will receive $1$ point for this, and all the squares left will fall down one row.
You task is to calculate the amount of points you will receive.
|
The first line of input contain 2 integer numbers $n$ and $m$ ($1 \le n, m \le 1000$) — the length of the platform and the number of the squares.
The next line contain $m$ integer numbers $c_1, c_2, \dots, c_m$ ($1 \le c_i \le n$) — column in which $i$-th square will appear.
|
Print one integer — the amount of points you will receive.
|
[
"3 9\n1 1 2 2 2 3 1 2 3\n"
] |
[
"2\n"
] |
In the sample case the answer will be equal to $2$ because after the appearing of $6$-th square will be removed one row (counts of the squares on the platform will look like $[2~ 3~ 1]$, and after removing one row will be $[1~ 2~ 0]$).
After the appearing of $9$-th square counts will be $[2~ 3~ 1]$, and after removing one row it will look like $[1~ 2~ 0]$.
So the answer will be equal to $2$.
| 0
|
[
{
"input": "3 9\n1 1 2 2 2 3 1 2 3",
"output": "2"
},
{
"input": "1 7\n1 1 1 1 1 1 1",
"output": "7"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "3 5\n1 1 1 2 3",
"output": "1"
},
{
"input": "4 6\n4 4 4 4 4 4",
"output": "0"
},
{
"input": "4 6\n2 3 4 4 4 4",
"output": "0"
},
{
"input": "3 12\n1 1 1 1 2 2 2 2 3 3 3 3",
"output": "4"
},
{
"input": "8 8\n2 2 3 4 5 6 7 8",
"output": "0"
},
{
"input": "100 1\n50",
"output": "0"
},
{
"input": "2 1\n2",
"output": "0"
},
{
"input": "2 1\n1",
"output": "0"
},
{
"input": "2 4\n1 2 1 1",
"output": "1"
},
{
"input": "3 4\n3 2 2 2",
"output": "0"
},
{
"input": "2 2\n2 2",
"output": "0"
},
{
"input": "2 5\n2 1 1 2 1",
"output": "2"
},
{
"input": "15 3\n13 14 15",
"output": "0"
},
{
"input": "4 9\n1 2 3 1 2 3 1 2 3",
"output": "0"
},
{
"input": "100 3\n1 2 3",
"output": "0"
},
{
"input": "1000 10\n999 999 998 34 454 546 343 35 34 1000",
"output": "0"
},
{
"input": "4 2\n1 2",
"output": "0"
}
] | 1,539,256,574
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 124
| 0
|
n, m = map(int, input().split())
a = [int(i) for i in input().split()]
b = [0 for i in range(n)]
for i in a:
b[i - 1] += 1
print(min(b))
|
Title: Tetris
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a following process.
There is a platform with $n$ columns. $1 \times 1$ squares are appearing one after another in some columns on this platform. If there are no squares in the column, a square will occupy the bottom row. Otherwise a square will appear at the top of the highest square of this column.
When all of the $n$ columns have at least one square in them, the bottom row is being removed. You will receive $1$ point for this, and all the squares left will fall down one row.
You task is to calculate the amount of points you will receive.
Input Specification:
The first line of input contain 2 integer numbers $n$ and $m$ ($1 \le n, m \le 1000$) — the length of the platform and the number of the squares.
The next line contain $m$ integer numbers $c_1, c_2, \dots, c_m$ ($1 \le c_i \le n$) — column in which $i$-th square will appear.
Output Specification:
Print one integer — the amount of points you will receive.
Demo Input:
['3 9\n1 1 2 2 2 3 1 2 3\n']
Demo Output:
['2\n']
Note:
In the sample case the answer will be equal to $2$ because after the appearing of $6$-th square will be removed one row (counts of the squares on the platform will look like $[2~ 3~ 1]$, and after removing one row will be $[1~ 2~ 0]$).
After the appearing of $9$-th square counts will be $[2~ 3~ 1]$, and after removing one row it will look like $[1~ 2~ 0]$.
So the answer will be equal to $2$.
|
```python
n, m = map(int, input().split())
a = [int(i) for i in input().split()]
b = [0 for i in range(n)]
for i in a:
b[i - 1] += 1
print(min(b))
```
| 3
|
|
628
|
B
|
New Skateboard
|
PROGRAMMING
| 1,300
|
[
"dp"
] | null | null |
Max wants to buy a new skateboard. He has calculated the amount of money that is needed to buy a new skateboard. He left a calculator on the floor and went to ask some money from his parents. Meanwhile his little brother Yusuf came and started to press the keys randomly. Unfortunately Max has forgotten the number which he had calculated. The only thing he knows is that the number is divisible by 4.
You are given a string *s* consisting of digits (the number on the display of the calculator after Yusuf randomly pressed the keys). Your task is to find the number of substrings which are divisible by 4. A substring can start with a zero.
A substring of a string is a nonempty sequence of consecutive characters.
For example if string *s* is 124 then we have four substrings that are divisible by 4: 12, 4, 24 and 124. For the string 04 the answer is three: 0, 4, 04.
As input/output can reach huge size it is recommended to use fast input/output methods: for example, prefer to use gets/scanf/printf instead of getline/cin/cout in C++, prefer to use BufferedReader/PrintWriter instead of Scanner/System.out in Java.
|
The only line contains string *s* (1<=≤<=|*s*|<=≤<=3·105). The string *s* contains only digits from 0 to 9.
|
Print integer *a* — the number of substrings of the string *s* that are divisible by 4.
Note that the answer can be huge, so you should use 64-bit integer type to store it. In C++ you can use the long long integer type and in Java you can use long integer type.
|
[
"124\n",
"04\n",
"5810438174\n"
] |
[
"4\n",
"3\n",
"9\n"
] |
none
| 0
|
[
{
"input": "124",
"output": "4"
},
{
"input": "04",
"output": "3"
},
{
"input": "5810438174",
"output": "9"
},
{
"input": "1",
"output": "0"
},
{
"input": "039",
"output": "1"
},
{
"input": "97247",
"output": "6"
},
{
"input": "5810438174",
"output": "9"
},
{
"input": "12883340691714056185860211260984431382156326935244",
"output": "424"
},
{
"input": "2144315253572020279108092911160072328496568665545836825277616363478721946398140227406814602154768031",
"output": "1528"
},
{
"input": "80124649014054971081213608137817466046254652492627741860478258558206397113198232823859870363821007188476405951611069347299689170240023979048198711745011542774268179055311013054073075176122755643483380248999657649211459997766221072399103579977409770898200358240970169892326442892826731631357561876251276209119521202062222947560634301788787748428236988789594458520867663257476744168528121470923031438015546006185059454402637036376247785881323277542968298682307854655591317046086531554595892680980142608",
"output": "30826"
},
{
"input": "123456",
"output": "7"
},
{
"input": "4",
"output": "1"
},
{
"input": "123",
"output": "1"
}
] | 1,570,740,280
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 22
| 483
| 4,198,400
|
s=input()
a=[0]
count=0
ans=0
for i in range(1,len(s)):
p=int(s[i-1]+s[i])
#print(p)
if(p%4==0):
a.append(1)
else:
a.append(0)
#print(a)
for i in range(len(a)):
if(a[i]==1):
count=count+i
for i in s:
if(int(i)%4==0):
ans+=1
output=count+ans
#print(count)
#print(ans)
print(output)
|
Title: New Skateboard
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Max wants to buy a new skateboard. He has calculated the amount of money that is needed to buy a new skateboard. He left a calculator on the floor and went to ask some money from his parents. Meanwhile his little brother Yusuf came and started to press the keys randomly. Unfortunately Max has forgotten the number which he had calculated. The only thing he knows is that the number is divisible by 4.
You are given a string *s* consisting of digits (the number on the display of the calculator after Yusuf randomly pressed the keys). Your task is to find the number of substrings which are divisible by 4. A substring can start with a zero.
A substring of a string is a nonempty sequence of consecutive characters.
For example if string *s* is 124 then we have four substrings that are divisible by 4: 12, 4, 24 and 124. For the string 04 the answer is three: 0, 4, 04.
As input/output can reach huge size it is recommended to use fast input/output methods: for example, prefer to use gets/scanf/printf instead of getline/cin/cout in C++, prefer to use BufferedReader/PrintWriter instead of Scanner/System.out in Java.
Input Specification:
The only line contains string *s* (1<=≤<=|*s*|<=≤<=3·105). The string *s* contains only digits from 0 to 9.
Output Specification:
Print integer *a* — the number of substrings of the string *s* that are divisible by 4.
Note that the answer can be huge, so you should use 64-bit integer type to store it. In C++ you can use the long long integer type and in Java you can use long integer type.
Demo Input:
['124\n', '04\n', '5810438174\n']
Demo Output:
['4\n', '3\n', '9\n']
Note:
none
|
```python
s=input()
a=[0]
count=0
ans=0
for i in range(1,len(s)):
p=int(s[i-1]+s[i])
#print(p)
if(p%4==0):
a.append(1)
else:
a.append(0)
#print(a)
for i in range(len(a)):
if(a[i]==1):
count=count+i
for i in s:
if(int(i)%4==0):
ans+=1
output=count+ans
#print(count)
#print(ans)
print(output)
```
| 3
|
|
697
|
A
|
Pineapple Incident
|
PROGRAMMING
| 900
|
[
"implementation",
"math"
] | null | null |
Ted has a pineapple. This pineapple is able to bark like a bulldog! At time *t* (in seconds) it barks for the first time. Then every *s* seconds after it, it barks twice with 1 second interval. Thus it barks at times *t*, *t*<=+<=*s*, *t*<=+<=*s*<=+<=1, *t*<=+<=2*s*, *t*<=+<=2*s*<=+<=1, etc.
Barney woke up in the morning and wants to eat the pineapple, but he can't eat it when it's barking. Barney plans to eat it at time *x* (in seconds), so he asked you to tell him if it's gonna bark at that time.
|
The first and only line of input contains three integers *t*, *s* and *x* (0<=≤<=*t*,<=*x*<=≤<=109, 2<=≤<=*s*<=≤<=109) — the time the pineapple barks for the first time, the pineapple barking interval, and the time Barney wants to eat the pineapple respectively.
|
Print a single "YES" (without quotes) if the pineapple will bark at time *x* or a single "NO" (without quotes) otherwise in the only line of output.
|
[
"3 10 4\n",
"3 10 3\n",
"3 8 51\n",
"3 8 52\n"
] |
[
"NO\n",
"YES\n",
"YES\n",
"YES\n"
] |
In the first and the second sample cases pineapple will bark at moments 3, 13, 14, ..., so it won't bark at the moment 4 and will bark at the moment 3.
In the third and fourth sample cases pineapple will bark at moments 3, 11, 12, 19, 20, 27, 28, 35, 36, 43, 44, 51, 52, 59, ..., so it will bark at both moments 51 and 52.
| 500
|
[
{
"input": "3 10 4",
"output": "NO"
},
{
"input": "3 10 3",
"output": "YES"
},
{
"input": "3 8 51",
"output": "YES"
},
{
"input": "3 8 52",
"output": "YES"
},
{
"input": "456947336 740144 45",
"output": "NO"
},
{
"input": "33 232603 599417964",
"output": "YES"
},
{
"input": "4363010 696782227 701145238",
"output": "YES"
},
{
"input": "9295078 2 6",
"output": "NO"
},
{
"input": "76079 281367 119938421",
"output": "YES"
},
{
"input": "93647 7 451664565",
"output": "YES"
},
{
"input": "5 18553 10908",
"output": "NO"
},
{
"input": "6 52 30",
"output": "NO"
},
{
"input": "6431 855039 352662",
"output": "NO"
},
{
"input": "749399100 103031711 761562532",
"output": "NO"
},
{
"input": "21 65767 55245",
"output": "NO"
},
{
"input": "4796601 66897 4860613",
"output": "NO"
},
{
"input": "8 6728951 860676",
"output": "NO"
},
{
"input": "914016 6 914019",
"output": "NO"
},
{
"input": "60686899 78474 60704617",
"output": "NO"
},
{
"input": "3 743604 201724",
"output": "NO"
},
{
"input": "571128 973448796 10",
"output": "NO"
},
{
"input": "688051712 67 51",
"output": "NO"
},
{
"input": "74619 213344 6432326",
"output": "NO"
},
{
"input": "6947541 698167 6",
"output": "NO"
},
{
"input": "83 6 6772861",
"output": "NO"
},
{
"input": "251132 67561 135026988",
"output": "NO"
},
{
"input": "8897216 734348516 743245732",
"output": "YES"
},
{
"input": "50 64536 153660266",
"output": "YES"
},
{
"input": "876884 55420 971613604",
"output": "YES"
},
{
"input": "0 6906451 366041903",
"output": "YES"
},
{
"input": "11750 8 446010134",
"output": "YES"
},
{
"input": "582692707 66997 925047377",
"output": "YES"
},
{
"input": "11 957526890 957526901",
"output": "YES"
},
{
"input": "556888 514614196 515171084",
"output": "YES"
},
{
"input": "6 328006 584834704",
"output": "YES"
},
{
"input": "4567998 4 204966403",
"output": "YES"
},
{
"input": "60 317278 109460971",
"output": "YES"
},
{
"input": "906385 342131991 685170368",
"output": "YES"
},
{
"input": "1 38 902410512",
"output": "YES"
},
{
"input": "29318 787017 587931018",
"output": "YES"
},
{
"input": "351416375 243431 368213115",
"output": "YES"
},
{
"input": "54 197366062 197366117",
"output": "YES"
},
{
"input": "586389 79039 850729874",
"output": "YES"
},
{
"input": "723634470 2814619 940360134",
"output": "YES"
},
{
"input": "0 2 0",
"output": "YES"
},
{
"input": "0 2 1",
"output": "NO"
},
{
"input": "0 2 2",
"output": "YES"
},
{
"input": "0 2 3",
"output": "YES"
},
{
"input": "0 2 1000000000",
"output": "YES"
},
{
"input": "0 10 23",
"output": "NO"
},
{
"input": "0 2 999999999",
"output": "YES"
},
{
"input": "10 5 11",
"output": "NO"
},
{
"input": "1 2 1000000000",
"output": "YES"
},
{
"input": "1 10 20",
"output": "NO"
},
{
"input": "1 2 999999937",
"output": "YES"
},
{
"input": "10 3 5",
"output": "NO"
},
{
"input": "3 2 5",
"output": "YES"
},
{
"input": "0 4 0",
"output": "YES"
},
{
"input": "0 215 403",
"output": "NO"
},
{
"input": "5 2 10",
"output": "YES"
},
{
"input": "0 2 900000000",
"output": "YES"
},
{
"input": "0 79 4000",
"output": "NO"
},
{
"input": "5 1000 1000",
"output": "NO"
},
{
"input": "1 5 103",
"output": "NO"
},
{
"input": "5 2 6",
"output": "NO"
},
{
"input": "120 2 1000000000",
"output": "YES"
},
{
"input": "2 2 1000000000",
"output": "YES"
},
{
"input": "5 5 13",
"output": "NO"
},
{
"input": "10 5 15",
"output": "YES"
},
{
"input": "11 2 0",
"output": "NO"
},
{
"input": "3 8 53",
"output": "NO"
},
{
"input": "2 2 4",
"output": "YES"
},
{
"input": "4 4 0",
"output": "NO"
},
{
"input": "1 2 3",
"output": "YES"
},
{
"input": "5 3 9",
"output": "YES"
},
{
"input": "5 6 19",
"output": "NO"
},
{
"input": "3 10 125",
"output": "NO"
},
{
"input": "5 3 8",
"output": "YES"
},
{
"input": "6 3 9",
"output": "YES"
},
{
"input": "0 3 5",
"output": "NO"
},
{
"input": "5 3 300000035",
"output": "YES"
},
{
"input": "5 2 7",
"output": "YES"
},
{
"input": "1 5 6",
"output": "YES"
},
{
"input": "4 2 6",
"output": "YES"
},
{
"input": "0 3 999999998",
"output": "NO"
},
{
"input": "0 10001 0",
"output": "YES"
},
{
"input": "6 5 3",
"output": "NO"
},
{
"input": "1 5 1000000000",
"output": "NO"
},
{
"input": "1 3 6",
"output": "NO"
},
{
"input": "3 3 1000000000",
"output": "YES"
},
{
"input": "3 3 4",
"output": "NO"
},
{
"input": "3 3 5",
"output": "NO"
},
{
"input": "3 3 0",
"output": "NO"
},
{
"input": "1 2 4",
"output": "YES"
},
{
"input": "5 5 10",
"output": "YES"
}
] | 1,559,619,941
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 95
| 124
| 0
|
import math
t, s, x = map(int, input().split())
if x == t:
print("YES")
elif x < t + s:
print("NO")
else:
n = math.ceil((x - t - 1) / s)
d = t + n * s + 1
if d == x or x == d - 1:
print("YES")
else:
print("NO")
|
Title: Pineapple Incident
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ted has a pineapple. This pineapple is able to bark like a bulldog! At time *t* (in seconds) it barks for the first time. Then every *s* seconds after it, it barks twice with 1 second interval. Thus it barks at times *t*, *t*<=+<=*s*, *t*<=+<=*s*<=+<=1, *t*<=+<=2*s*, *t*<=+<=2*s*<=+<=1, etc.
Barney woke up in the morning and wants to eat the pineapple, but he can't eat it when it's barking. Barney plans to eat it at time *x* (in seconds), so he asked you to tell him if it's gonna bark at that time.
Input Specification:
The first and only line of input contains three integers *t*, *s* and *x* (0<=≤<=*t*,<=*x*<=≤<=109, 2<=≤<=*s*<=≤<=109) — the time the pineapple barks for the first time, the pineapple barking interval, and the time Barney wants to eat the pineapple respectively.
Output Specification:
Print a single "YES" (without quotes) if the pineapple will bark at time *x* or a single "NO" (without quotes) otherwise in the only line of output.
Demo Input:
['3 10 4\n', '3 10 3\n', '3 8 51\n', '3 8 52\n']
Demo Output:
['NO\n', 'YES\n', 'YES\n', 'YES\n']
Note:
In the first and the second sample cases pineapple will bark at moments 3, 13, 14, ..., so it won't bark at the moment 4 and will bark at the moment 3.
In the third and fourth sample cases pineapple will bark at moments 3, 11, 12, 19, 20, 27, 28, 35, 36, 43, 44, 51, 52, 59, ..., so it will bark at both moments 51 and 52.
|
```python
import math
t, s, x = map(int, input().split())
if x == t:
print("YES")
elif x < t + s:
print("NO")
else:
n = math.ceil((x - t - 1) / s)
d = t + n * s + 1
if d == x or x == d - 1:
print("YES")
else:
print("NO")
```
| 3
|
|
888
|
B
|
Buggy Robot
|
PROGRAMMING
| 1,000
|
[
"greedy"
] | null | null |
Ivan has a robot which is situated on an infinite grid. Initially the robot is standing in the starting cell (0,<=0). The robot can process commands. There are four types of commands it can perform:
- U — move from the cell (*x*,<=*y*) to (*x*,<=*y*<=+<=1); - D — move from (*x*,<=*y*) to (*x*,<=*y*<=-<=1); - L — move from (*x*,<=*y*) to (*x*<=-<=1,<=*y*); - R — move from (*x*,<=*y*) to (*x*<=+<=1,<=*y*).
Ivan entered a sequence of *n* commands, and the robot processed it. After this sequence the robot ended up in the starting cell (0,<=0), but Ivan doubts that the sequence is such that after performing it correctly the robot ends up in the same cell. He thinks that some commands were ignored by robot. To acknowledge whether the robot is severely bugged, he needs to calculate the maximum possible number of commands that were performed correctly. Help Ivan to do the calculations!
|
The first line contains one number *n* — the length of sequence of commands entered by Ivan (1<=≤<=*n*<=≤<=100).
The second line contains the sequence itself — a string consisting of *n* characters. Each character can be U, D, L or R.
|
Print the maximum possible number of commands from the sequence the robot could perform to end up in the starting cell.
|
[
"4\nLDUR\n",
"5\nRRRUU\n",
"6\nLLRRRR\n"
] |
[
"4\n",
"0\n",
"4\n"
] |
none
| 0
|
[
{
"input": "4\nLDUR",
"output": "4"
},
{
"input": "5\nRRRUU",
"output": "0"
},
{
"input": "6\nLLRRRR",
"output": "4"
},
{
"input": "88\nLLUUULRDRRURDDLURRLRDRLLRULRUUDDLLLLRRDDURDURRLDURRLDRRRUULDDLRRRDDRRLUULLURDURUDDDDDLDR",
"output": "76"
},
{
"input": "89\nLDLLLDRDUDURRRRRUDULDDDLLUDLRLRLRLDLDUULRDUDLRRDLUDLURRDDRRDLDUDUUURUUUDRLUDUDLURDLDLLDDU",
"output": "80"
},
{
"input": "90\nRRRDUULLLRDUUDDRLDLRLUDURDRDUUURUURDDRRRURLDDDUUDRLLLULURDRDRURLDRRRRUULDULDDLLLRRLRDLLLLR",
"output": "84"
},
{
"input": "91\nRLDRLRRLLDLULULLURULLRRULUDUULLUDULDUULURUDRUDUURDULDUDDUUUDRRUUDLLRULRULURLDRDLDRURLLLRDDD",
"output": "76"
},
{
"input": "92\nRLRDDLULRLLUURRDDDLDDDLDDUURRRULLRDULDULLLUUULDUDLRLRRDRDRDDULDRLUDRDULDRURUDUULLRDRRLLDRLRR",
"output": "86"
},
{
"input": "93\nRLLURLULRURDDLUURLUDDRDLUURLRDLRRRDUULLRDRRLRLDURRDLLRDDLLLDDDLDRRURLLDRUDULDDRRULRRULRLDRDLR",
"output": "84"
},
{
"input": "94\nRDULDDDLULRDRUDRUUDUUDRRRULDRRUDURUULRDUUDLULLLUDURRDRDLUDRULRRRULUURUDDDDDUDLLRDLDRLLRUUURLUL",
"output": "86"
},
{
"input": "95\nRDLUUULLUURDDRLDLLRRRULRLRDULULRULRUDURLULDDDRLURLDRULDUDUUULLRDDURUULULLDDLDRDRLLLURLRDLLDDDDU",
"output": "86"
},
{
"input": "96\nRDDRLRLLDDULRLRURUDLRLDUDRURLLUUDLLURDLRRUURDRRUDRURLLDLLRDURDURLRLUDURULLLRDUURULUUULRRURRDLURL",
"output": "84"
},
{
"input": "97\nRURDDLRLLRULUDURDLRLLUUDURRLLUDLLLDUDRUULDRUUURURULRDLDRRLLUUUDLLLDDLLLLRLLDUDRRDLLUDLRURUDULRLUR",
"output": "82"
},
{
"input": "98\nRUDURLULLDDLLRDLLRDDLLLLRLDDDDRRRDDRRURLDRLLRUUUDLUUUDDDUDRUURLURUUDUUDRULRRULLRRLRULLULDLUURLULRD",
"output": "92"
},
{
"input": "99\nRRULLDULRRDRULLDUDRUDDDRLLUUDRDDUDURLDDRUUDRRUUURRRURDDLDUURDLRLURRDDLUDDLUDURDRUDDURLURURLRUDRURLD",
"output": "86"
},
{
"input": "100\nUDRLRRLLRRLRRRDDLLDDDLULLDDLURUURUULUDDDRDDLLRDLLUURLRDRLRRLRLLLULDUDDUURRLRDULDRDURRRRRRULDRRDLDRRL",
"output": "88"
},
{
"input": "1\nU",
"output": "0"
},
{
"input": "5\nUUULD",
"output": "2"
},
{
"input": "1\nD",
"output": "0"
},
{
"input": "5\nURLUL",
"output": "2"
},
{
"input": "5\nDDDRU",
"output": "2"
},
{
"input": "2\nLR",
"output": "2"
},
{
"input": "8\nDDRDLDUR",
"output": "4"
},
{
"input": "6\nLLLLUD",
"output": "2"
},
{
"input": "13\nRRRLLLLLLLLLL",
"output": "6"
}
] | 1,603,618,961
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 109
| 307,200
|
n = int(input())
s = input()
l = 0
r = 0
u = 0
d = 0
count = 0
for i in s:
if i == 'L':
l = l+1
if i == 'R':
r = r+1
if i == 'U':
u = u+1
if i == 'D':
d = d+1
if l>=r:
count = 2*r
else:
count = 2*l
if u>=d:
count = count+2*d
else:
count = count+2*u
print(count)
|
Title: Buggy Robot
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ivan has a robot which is situated on an infinite grid. Initially the robot is standing in the starting cell (0,<=0). The robot can process commands. There are four types of commands it can perform:
- U — move from the cell (*x*,<=*y*) to (*x*,<=*y*<=+<=1); - D — move from (*x*,<=*y*) to (*x*,<=*y*<=-<=1); - L — move from (*x*,<=*y*) to (*x*<=-<=1,<=*y*); - R — move from (*x*,<=*y*) to (*x*<=+<=1,<=*y*).
Ivan entered a sequence of *n* commands, and the robot processed it. After this sequence the robot ended up in the starting cell (0,<=0), but Ivan doubts that the sequence is such that after performing it correctly the robot ends up in the same cell. He thinks that some commands were ignored by robot. To acknowledge whether the robot is severely bugged, he needs to calculate the maximum possible number of commands that were performed correctly. Help Ivan to do the calculations!
Input Specification:
The first line contains one number *n* — the length of sequence of commands entered by Ivan (1<=≤<=*n*<=≤<=100).
The second line contains the sequence itself — a string consisting of *n* characters. Each character can be U, D, L or R.
Output Specification:
Print the maximum possible number of commands from the sequence the robot could perform to end up in the starting cell.
Demo Input:
['4\nLDUR\n', '5\nRRRUU\n', '6\nLLRRRR\n']
Demo Output:
['4\n', '0\n', '4\n']
Note:
none
|
```python
n = int(input())
s = input()
l = 0
r = 0
u = 0
d = 0
count = 0
for i in s:
if i == 'L':
l = l+1
if i == 'R':
r = r+1
if i == 'U':
u = u+1
if i == 'D':
d = d+1
if l>=r:
count = 2*r
else:
count = 2*l
if u>=d:
count = count+2*d
else:
count = count+2*u
print(count)
```
| 3
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,676,802,422
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 20
| 93
| 0
|
# -*- coding: utf-8 -*-
"""Untitled32.ipynb
Automatically generated by Colaboratory.
Original file is located at
https://colab.research.google.com/drive/1r2sT1YOHXEcOkHEnYjqrRkDVYewH_SCi
"""
n, m, a = map(int, input().split(" "))
if m%a == 0: #false
val1 = m // a
else:
val1 = m // a + 1
if n%a == 0: #false
val2 = n // a
else:
val2 = n // a + 1
print(val1*val2)
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
# -*- coding: utf-8 -*-
"""Untitled32.ipynb
Automatically generated by Colaboratory.
Original file is located at
https://colab.research.google.com/drive/1r2sT1YOHXEcOkHEnYjqrRkDVYewH_SCi
"""
n, m, a = map(int, input().split(" "))
if m%a == 0: #false
val1 = m // a
else:
val1 = m // a + 1
if n%a == 0: #false
val2 = n // a
else:
val2 = n // a + 1
print(val1*val2)
```
| 3.9535
|
400
|
B
|
Inna and New Matrix of Candies
|
PROGRAMMING
| 1,200
|
[
"brute force",
"implementation",
"schedules"
] | null | null |
Inna likes sweets and a game called the "Candy Matrix". Today, she came up with the new game "Candy Matrix 2: Reload".
The field for the new game is a rectangle table of size *n*<=×<=*m*. Each line of the table contains one cell with a dwarf figurine, one cell with a candy, the other cells of the line are empty. The game lasts for several moves. During each move the player should choose all lines of the matrix where dwarf is not on the cell with candy and shout "Let's go!". After that, all the dwarves from the chosen lines start to simultaneously move to the right. During each second, each dwarf goes to the adjacent cell that is located to the right of its current cell. The movement continues until one of the following events occurs:
- some dwarf in one of the chosen lines is located in the rightmost cell of his row; - some dwarf in the chosen lines is located in the cell with the candy.
The point of the game is to transport all the dwarves to the candy cells.
Inna is fabulous, as she came up with such an interesting game. But what about you? Your task is to play this game optimally well. Specifically, you should say by the given game field what minimum number of moves the player needs to reach the goal of the game.
|
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*<=≤<=1000; 2<=≤<=*m*<=≤<=1000).
Next *n* lines each contain *m* characters — the game field for the "Candy Martix 2: Reload". Character "*" represents an empty cell of the field, character "G" represents a dwarf and character "S" represents a candy. The matrix doesn't contain other characters. It is guaranteed that each line contains exactly one character "G" and one character "S".
|
In a single line print a single integer — either the minimum number of moves needed to achieve the aim of the game, or -1, if the aim cannot be achieved on the given game field.
|
[
"3 4\n*G*S\nG**S\n*G*S\n",
"1 3\nS*G\n"
] |
[
"2\n",
"-1\n"
] |
none
| 1,000
|
[
{
"input": "3 4\n*G*S\nG**S\n*G*S",
"output": "2"
},
{
"input": "1 3\nS*G",
"output": "-1"
},
{
"input": "10 10\nG********S\n*G*******S\n**G******S\n***G*****S\n****G****S\n*****G***S\n******G**S\n*******G*S\n********GS\nG********S",
"output": "9"
},
{
"input": "5 10\nG***S*****\nG****S****\n***GS*****\nG*S*******\nG***S*****",
"output": "4"
},
{
"input": "4 8\nG*S*****\n****G*S*\nG*****S*\n**G***S*",
"output": "3"
},
{
"input": "4 10\n***G****S*\n*****GS***\nG****S****\nG*******S*",
"output": "3"
},
{
"input": "1 2\nSG",
"output": "-1"
},
{
"input": "1 2\nGS",
"output": "1"
},
{
"input": "1 4\nSG**",
"output": "-1"
}
] | 1,611,579,570
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 77
| 307,200
|
distance=lambda x: (x.find('S')-x.find('G'))
def main():
n,m=map(int,input().split())
s={distance(input()) for i in range(n)}
if min(s)<0: print(-1)
else: print(len(s))
main()
|
Title: Inna and New Matrix of Candies
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Inna likes sweets and a game called the "Candy Matrix". Today, she came up with the new game "Candy Matrix 2: Reload".
The field for the new game is a rectangle table of size *n*<=×<=*m*. Each line of the table contains one cell with a dwarf figurine, one cell with a candy, the other cells of the line are empty. The game lasts for several moves. During each move the player should choose all lines of the matrix where dwarf is not on the cell with candy and shout "Let's go!". After that, all the dwarves from the chosen lines start to simultaneously move to the right. During each second, each dwarf goes to the adjacent cell that is located to the right of its current cell. The movement continues until one of the following events occurs:
- some dwarf in one of the chosen lines is located in the rightmost cell of his row; - some dwarf in the chosen lines is located in the cell with the candy.
The point of the game is to transport all the dwarves to the candy cells.
Inna is fabulous, as she came up with such an interesting game. But what about you? Your task is to play this game optimally well. Specifically, you should say by the given game field what minimum number of moves the player needs to reach the goal of the game.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*<=≤<=1000; 2<=≤<=*m*<=≤<=1000).
Next *n* lines each contain *m* characters — the game field for the "Candy Martix 2: Reload". Character "*" represents an empty cell of the field, character "G" represents a dwarf and character "S" represents a candy. The matrix doesn't contain other characters. It is guaranteed that each line contains exactly one character "G" and one character "S".
Output Specification:
In a single line print a single integer — either the minimum number of moves needed to achieve the aim of the game, or -1, if the aim cannot be achieved on the given game field.
Demo Input:
['3 4\n*G*S\nG**S\n*G*S\n', '1 3\nS*G\n']
Demo Output:
['2\n', '-1\n']
Note:
none
|
```python
distance=lambda x: (x.find('S')-x.find('G'))
def main():
n,m=map(int,input().split())
s={distance(input()) for i in range(n)}
if min(s)<0: print(-1)
else: print(len(s))
main()
```
| 3
|
|
729
|
B
|
Spotlights
|
PROGRAMMING
| 1,200
|
[
"dp",
"implementation"
] | null | null |
Theater stage is a rectangular field of size *n*<=×<=*m*. The director gave you the stage's plan which actors will follow. For each cell it is stated in the plan if there would be an actor in this cell or not.
You are to place a spotlight on the stage in some good position. The spotlight will project light in one of the four directions (if you look at the stage from above) — left, right, up or down. Thus, the spotlight's position is a cell it is placed to and a direction it shines.
A position is good if two conditions hold:
- there is no actor in the cell the spotlight is placed to; - there is at least one actor in the direction the spotlight projects.
Count the number of good positions for placing the spotlight. Two positions of spotlight are considered to be different if the location cells or projection direction differ.
|
The first line contains two positive integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of rows and the number of columns in the plan.
The next *n* lines contain *m* integers, 0 or 1 each — the description of the plan. Integer 1, means there will be an actor in the corresponding cell, while 0 means the cell will remain empty. It is guaranteed that there is at least one actor in the plan.
|
Print one integer — the number of good positions for placing the spotlight.
|
[
"2 4\n0 1 0 0\n1 0 1 0\n",
"4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0\n"
] |
[
"9\n",
"20\n"
] |
In the first example the following positions are good:
1. the (1, 1) cell and right direction; 1. the (1, 1) cell and down direction; 1. the (1, 3) cell and left direction; 1. the (1, 3) cell and down direction; 1. the (1, 4) cell and left direction; 1. the (2, 2) cell and left direction; 1. the (2, 2) cell and up direction; 1. the (2, 2) and right direction; 1. the (2, 4) cell and left direction.
Therefore, there are 9 good positions in this example.
| 1,000
|
[
{
"input": "2 4\n0 1 0 0\n1 0 1 0",
"output": "9"
},
{
"input": "4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0",
"output": "20"
},
{
"input": "1 5\n1 1 0 0 0",
"output": "3"
},
{
"input": "2 10\n0 0 0 0 0 0 0 1 0 0\n1 0 0 0 0 0 0 0 0 0",
"output": "20"
},
{
"input": "3 1\n1\n0\n0",
"output": "2"
},
{
"input": "5 7\n0 0 0 0 0 0 1\n0 0 0 0 0 0 1\n0 0 0 1 0 0 0\n0 0 0 0 0 0 0\n0 0 0 0 0 0 0",
"output": "25"
},
{
"input": "10 20\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "4"
},
{
"input": "5 7\n0 0 0 0 0 0 0\n0 1 1 1 1 0 1\n0 1 1 1 1 1 1\n0 0 0 0 0 0 0\n0 1 1 1 1 0 1",
"output": "26"
},
{
"input": "10 20\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "121"
},
{
"input": "1 2\n0 1",
"output": "1"
},
{
"input": "1 2\n1 0",
"output": "1"
},
{
"input": "1 2\n1 1",
"output": "0"
},
{
"input": "2 1\n1\n0",
"output": "1"
},
{
"input": "2 1\n0\n1",
"output": "1"
},
{
"input": "2 1\n1\n1",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "4 4\n1 1 1 1\n1 0 0 1\n1 0 0 1\n1 1 1 1",
"output": "16"
}
] | 1,479,636,719
| 4,019
|
Python 3
|
OK
|
TESTS
| 72
| 483
| 2,867,200
|
n, m = map(int, input().split())
d = []
res = 0
for i in range(n):
s = input()
if s.count('1') != 0:
l = s.find('1')
r = s.rfind('1')
res += s[:l].count('0')
res += s[r+1:].count('0')
res += s[l+1:r].count('0') * 2
#print(res)
d.append(s)
#print(d)
for i in range(0, m * 2, 2):
ss = ''
for k in range(n):
ss += d[k][i]
if ss.count('1') != 0:
l = ss.find('1')
r = ss.rfind('1')
res += ss[:l].count('0')
res += ss[r+1:].count('0')
res += ss[l+1:r].count('0') * 2
#print(ss, res)
print(res)
|
Title: Spotlights
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Theater stage is a rectangular field of size *n*<=×<=*m*. The director gave you the stage's plan which actors will follow. For each cell it is stated in the plan if there would be an actor in this cell or not.
You are to place a spotlight on the stage in some good position. The spotlight will project light in one of the four directions (if you look at the stage from above) — left, right, up or down. Thus, the spotlight's position is a cell it is placed to and a direction it shines.
A position is good if two conditions hold:
- there is no actor in the cell the spotlight is placed to; - there is at least one actor in the direction the spotlight projects.
Count the number of good positions for placing the spotlight. Two positions of spotlight are considered to be different if the location cells or projection direction differ.
Input Specification:
The first line contains two positive integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of rows and the number of columns in the plan.
The next *n* lines contain *m* integers, 0 or 1 each — the description of the plan. Integer 1, means there will be an actor in the corresponding cell, while 0 means the cell will remain empty. It is guaranteed that there is at least one actor in the plan.
Output Specification:
Print one integer — the number of good positions for placing the spotlight.
Demo Input:
['2 4\n0 1 0 0\n1 0 1 0\n', '4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0\n']
Demo Output:
['9\n', '20\n']
Note:
In the first example the following positions are good:
1. the (1, 1) cell and right direction; 1. the (1, 1) cell and down direction; 1. the (1, 3) cell and left direction; 1. the (1, 3) cell and down direction; 1. the (1, 4) cell and left direction; 1. the (2, 2) cell and left direction; 1. the (2, 2) cell and up direction; 1. the (2, 2) and right direction; 1. the (2, 4) cell and left direction.
Therefore, there are 9 good positions in this example.
|
```python
n, m = map(int, input().split())
d = []
res = 0
for i in range(n):
s = input()
if s.count('1') != 0:
l = s.find('1')
r = s.rfind('1')
res += s[:l].count('0')
res += s[r+1:].count('0')
res += s[l+1:r].count('0') * 2
#print(res)
d.append(s)
#print(d)
for i in range(0, m * 2, 2):
ss = ''
for k in range(n):
ss += d[k][i]
if ss.count('1') != 0:
l = ss.find('1')
r = ss.rfind('1')
res += ss[:l].count('0')
res += ss[r+1:].count('0')
res += ss[l+1:r].count('0') * 2
#print(ss, res)
print(res)
```
| 3
|
|
884
|
D
|
Boxes And Balls
|
PROGRAMMING
| 2,300
|
[
"data structures",
"greedy"
] | null | null |
Ivan has *n* different boxes. The first of them contains some balls of *n* different colors.
Ivan wants to play a strange game. He wants to distribute the balls into boxes in such a way that for every *i* (1<=≤<=*i*<=≤<=*n*) *i*-th box will contain all balls with color *i*.
In order to do this, Ivan will make some turns. Each turn he does the following:
1. Ivan chooses any non-empty box and takes all balls from this box; 1. Then Ivan chooses any *k* empty boxes (the box from the first step becomes empty, and Ivan is allowed to choose it), separates the balls he took on the previous step into *k* non-empty groups and puts each group into one of the boxes. He should put each group into a separate box. He can choose either *k*<==<=2 or *k*<==<=3.
The penalty of the turn is the number of balls Ivan takes from the box during the first step of the turn. And penalty of the game is the total penalty of turns made by Ivan until he distributes all balls to corresponding boxes.
Help Ivan to determine the minimum possible penalty of the game!
|
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200000) — the number of boxes and colors.
The second line contains *n* integer numbers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=109), where *a**i* is the number of balls with color *i*.
|
Print one number — the minimum possible penalty of the game.
|
[
"3\n1 2 3\n",
"4\n2 3 4 5\n"
] |
[
"6\n",
"19\n"
] |
In the first example you take all the balls from the first box, choose *k* = 3 and sort all colors to corresponding boxes. Penalty is 6.
In the second example you make two turns:
1. Take all the balls from the first box, choose *k* = 3, put balls of color 3 to the third box, of color 4 — to the fourth box and the rest put back into the first box. Penalty is 14; 1. Take all the balls from the first box, choose *k* = 2, put balls of color 1 to the first box, of color 2 — to the second box. Penalty is 5.
Total penalty is 19.
| 0
|
[
{
"input": "3\n1 2 3",
"output": "6"
},
{
"input": "4\n2 3 4 5",
"output": "19"
},
{
"input": "6\n1 4 4 4 4 4",
"output": "38"
},
{
"input": "8\n821407370 380061316 428719552 90851747 825473738 704702117 845629927 245820158",
"output": "8176373828"
},
{
"input": "1\n10",
"output": "0"
},
{
"input": "1\n4",
"output": "0"
},
{
"input": "1\n12312",
"output": "0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "2\n3 4",
"output": "7"
}
] | 1,509,726,608
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 467
| 16,486,400
|
import heapq
n = input()
A = list(map(int, input().split()))
if (len(A) % 2 == 0):
A.append(0)
st = 0
heapq.heapify(A)
while (len(A) > 1):
abc = 0
a = heapq.heappop(A)
b = heapq.heappop(A)
c = heapq.heappop(A)
abc = a + b + c
st = st + abc
heapq.heappush(A, abc)
print(st)
|
Title: Boxes And Balls
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ivan has *n* different boxes. The first of them contains some balls of *n* different colors.
Ivan wants to play a strange game. He wants to distribute the balls into boxes in such a way that for every *i* (1<=≤<=*i*<=≤<=*n*) *i*-th box will contain all balls with color *i*.
In order to do this, Ivan will make some turns. Each turn he does the following:
1. Ivan chooses any non-empty box and takes all balls from this box; 1. Then Ivan chooses any *k* empty boxes (the box from the first step becomes empty, and Ivan is allowed to choose it), separates the balls he took on the previous step into *k* non-empty groups and puts each group into one of the boxes. He should put each group into a separate box. He can choose either *k*<==<=2 or *k*<==<=3.
The penalty of the turn is the number of balls Ivan takes from the box during the first step of the turn. And penalty of the game is the total penalty of turns made by Ivan until he distributes all balls to corresponding boxes.
Help Ivan to determine the minimum possible penalty of the game!
Input Specification:
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200000) — the number of boxes and colors.
The second line contains *n* integer numbers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=109), where *a**i* is the number of balls with color *i*.
Output Specification:
Print one number — the minimum possible penalty of the game.
Demo Input:
['3\n1 2 3\n', '4\n2 3 4 5\n']
Demo Output:
['6\n', '19\n']
Note:
In the first example you take all the balls from the first box, choose *k* = 3 and sort all colors to corresponding boxes. Penalty is 6.
In the second example you make two turns:
1. Take all the balls from the first box, choose *k* = 3, put balls of color 3 to the third box, of color 4 — to the fourth box and the rest put back into the first box. Penalty is 14; 1. Take all the balls from the first box, choose *k* = 2, put balls of color 1 to the first box, of color 2 — to the second box. Penalty is 5.
Total penalty is 19.
|
```python
import heapq
n = input()
A = list(map(int, input().split()))
if (len(A) % 2 == 0):
A.append(0)
st = 0
heapq.heapify(A)
while (len(A) > 1):
abc = 0
a = heapq.heappop(A)
b = heapq.heappop(A)
c = heapq.heappop(A)
abc = a + b + c
st = st + abc
heapq.heappush(A, abc)
print(st)
```
| 3
|
|
369
|
A
|
Valera and Plates
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation"
] | null | null |
Valera is a lazy student. He has *m* clean bowls and *k* clean plates.
Valera has made an eating plan for the next *n* days. As Valera is lazy, he will eat exactly one dish per day. At that, in order to eat a dish, he needs exactly one clean plate or bowl. We know that Valera can cook only two types of dishes. He can eat dishes of the first type from bowls and dishes of the second type from either bowls or plates.
When Valera finishes eating, he leaves a dirty plate/bowl behind. His life philosophy doesn't let him eat from dirty kitchenware. So sometimes he needs to wash his plate/bowl before eating. Find the minimum number of times Valera will need to wash a plate/bowl, if he acts optimally.
|
The first line of the input contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=1000) — the number of the planned days, the number of clean bowls and the number of clean plates.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2). If *a**i* equals one, then on day *i* Valera will eat a first type dish. If *a**i* equals two, then on day *i* Valera will eat a second type dish.
|
Print a single integer — the minimum number of times Valera will need to wash a plate/bowl.
|
[
"3 1 1\n1 2 1\n",
"4 3 1\n1 1 1 1\n",
"3 1 2\n2 2 2\n",
"8 2 2\n1 2 1 2 1 2 1 2\n"
] |
[
"1\n",
"1\n",
"0\n",
"4\n"
] |
In the first sample Valera will wash a bowl only on the third day, so the answer is one.
In the second sample, Valera will have the first type of the dish during all four days, and since there are only three bowls, he will wash a bowl exactly once.
In the third sample, Valera will have the second type of dish for all three days, and as they can be eaten from either a plate or a bowl, he will never need to wash a plate/bowl.
| 500
|
[
{
"input": "3 1 1\n1 2 1",
"output": "1"
},
{
"input": "4 3 1\n1 1 1 1",
"output": "1"
},
{
"input": "3 1 2\n2 2 2",
"output": "0"
},
{
"input": "8 2 2\n1 2 1 2 1 2 1 2",
"output": "4"
},
{
"input": "2 100 100\n2 2",
"output": "0"
},
{
"input": "1 1 1\n2",
"output": "0"
},
{
"input": "233 100 1\n2 2 1 1 1 2 2 2 2 1 1 2 2 2 1 2 2 1 1 1 2 2 1 1 1 1 2 1 2 2 1 1 2 2 1 2 2 1 2 1 2 1 2 2 2 1 1 1 1 2 1 2 1 1 2 1 1 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 2 2 2 1 1 2 2 1 1 1 1 2 1 1 2 1 2 2 2 1 1 1 2 2 2 1 1 1 1 2 1 2 1 1 1 1 2 2 2 1 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 2 1 1 1 2 2 1 1 2 1 2 1 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 1 2 2 1 1 1 2 2 1 1 2 2 1 1 2 1 1 2 2 1 2 2 2 2 2 2 1 2 2 2 2 2 1 1 2 2 2 2 2 2 1 1 1 2 1 2 2 2 2 2 2 2 2 1 1 2 1 2 1 2 2",
"output": "132"
},
{
"input": "123 100 1\n2 2 2 1 1 2 2 2 2 1 1 2 2 2 1 2 2 2 2 1 2 2 2 1 1 1 2 2 2 2 1 2 2 2 2 2 2 1 2 1 2 1 2 2 2 1 2 1 2 2 1 2 2 1 2 2 1 2 2 1 2 2 2 1 1 1 1 1 1 1 1 1 2 2 2 2 2 1 1 2 2 1 1 1 1 2 1 2 2 1 2 2 2 1 1 1 2 2 2 1 2 2 2 2 1 2 2 2 2 1 2 2 2 1 1 2 1 2 1 2 1 1 1",
"output": "22"
},
{
"input": "188 100 1\n2 2 1 1 1 2 2 2 2 1 1 2 2 2 1 2 2 1 1 1 2 2 1 1 1 1 2 1 2 2 1 1 2 2 1 2 2 1 2 1 2 1 2 2 2 1 1 1 1 2 1 2 1 1 2 1 1 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 2 2 2 1 1 2 2 1 1 1 1 2 1 1 2 1 2 2 2 1 1 1 2 2 2 1 1 1 1 2 1 2 1 1 1 1 2 2 2 1 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 2 1 1 1 2 2 1 1 2 1 2 1 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 1 2 2 1 1 1 2 2 1 1 2 2 1 1 2 1",
"output": "87"
},
{
"input": "3 1 2\n1 1 1",
"output": "2"
},
{
"input": "3 2 2\n1 1 1",
"output": "1"
},
{
"input": "3 2 1\n1 1 1",
"output": "1"
},
{
"input": "3 1 1\n1 1 1",
"output": "2"
},
{
"input": "5 1 2\n2 2 2 2 2",
"output": "2"
},
{
"input": "5 2 2\n2 2 2 2 2",
"output": "1"
},
{
"input": "5 2 1\n2 2 2 2 2",
"output": "2"
},
{
"input": "5 1 1\n2 2 2 2 2",
"output": "3"
},
{
"input": "1 1 2\n2",
"output": "0"
},
{
"input": "1 2 2\n2",
"output": "0"
},
{
"input": "1 2 1\n2",
"output": "0"
},
{
"input": "1 1 1\n2",
"output": "0"
},
{
"input": "6 3 1\n1 1 2 2 2 2",
"output": "2"
},
{
"input": "100 40 20\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "40"
},
{
"input": "7 5 2\n2 2 1 1 1 1 1",
"output": "0"
},
{
"input": "10 4 4\n2 2 2 2 2 2 1 1 1 1",
"output": "2"
},
{
"input": "3 2 1\n2 1 1",
"output": "0"
},
{
"input": "7 6 1\n2 1 1 1 1 1 1",
"output": "0"
},
{
"input": "7 5 1\n1 1 1 2 2 2 2",
"output": "1"
},
{
"input": "5 3 1\n1 1 2 2 2",
"output": "1"
},
{
"input": "3 1 1\n2 2 2",
"output": "1"
},
{
"input": "5 2 2\n2 2 2 2 2",
"output": "1"
},
{
"input": "3 1 3\n1 1 1",
"output": "2"
},
{
"input": "5 2 1\n1 1 2 2 2",
"output": "2"
},
{
"input": "4 3 2\n2 1 1 1",
"output": "0"
},
{
"input": "4 2 1\n1 2 2 2",
"output": "1"
},
{
"input": "14 4 7\n1 1 1 2 2 2 2 2 2 2 2 2 2 2",
"output": "3"
},
{
"input": "12 10 4\n2 2 2 2 2 2 1 1 1 1 1 1",
"output": "0"
},
{
"input": "5 3 2\n2 2 1 1 1",
"output": "0"
}
] | 1,679,325,071
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 63
| 46
| 0
|
def solve():
days,bowl,plate=map(int,input().split());a=list(map(int,input().split()));ones=a.count(1);two=a.count(2);c=0
bowl-=ones;
if bowl<0:c+=abs(bowl);bowl=0
plate+=bowl;
plate-=two
if plate<0:c+=abs(plate)
print(c)
solve()
|
Title: Valera and Plates
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera is a lazy student. He has *m* clean bowls and *k* clean plates.
Valera has made an eating plan for the next *n* days. As Valera is lazy, he will eat exactly one dish per day. At that, in order to eat a dish, he needs exactly one clean plate or bowl. We know that Valera can cook only two types of dishes. He can eat dishes of the first type from bowls and dishes of the second type from either bowls or plates.
When Valera finishes eating, he leaves a dirty plate/bowl behind. His life philosophy doesn't let him eat from dirty kitchenware. So sometimes he needs to wash his plate/bowl before eating. Find the minimum number of times Valera will need to wash a plate/bowl, if he acts optimally.
Input Specification:
The first line of the input contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=1000) — the number of the planned days, the number of clean bowls and the number of clean plates.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2). If *a**i* equals one, then on day *i* Valera will eat a first type dish. If *a**i* equals two, then on day *i* Valera will eat a second type dish.
Output Specification:
Print a single integer — the minimum number of times Valera will need to wash a plate/bowl.
Demo Input:
['3 1 1\n1 2 1\n', '4 3 1\n1 1 1 1\n', '3 1 2\n2 2 2\n', '8 2 2\n1 2 1 2 1 2 1 2\n']
Demo Output:
['1\n', '1\n', '0\n', '4\n']
Note:
In the first sample Valera will wash a bowl only on the third day, so the answer is one.
In the second sample, Valera will have the first type of the dish during all four days, and since there are only three bowls, he will wash a bowl exactly once.
In the third sample, Valera will have the second type of dish for all three days, and as they can be eaten from either a plate or a bowl, he will never need to wash a plate/bowl.
|
```python
def solve():
days,bowl,plate=map(int,input().split());a=list(map(int,input().split()));ones=a.count(1);two=a.count(2);c=0
bowl-=ones;
if bowl<0:c+=abs(bowl);bowl=0
plate+=bowl;
plate-=two
if plate<0:c+=abs(plate)
print(c)
solve()
```
| 3
|
|
366
|
B
|
Dima and To-do List
|
PROGRAMMING
| 1,200
|
[
"brute force",
"implementation"
] | null | null |
You helped Dima to have a great weekend, but it's time to work. Naturally, Dima, as all other men who have girlfriends, does everything wrong.
Inna and Dima are now in one room. Inna tells Dima off for everything he does in her presence. After Inna tells him off for something, she goes to another room, walks there in circles muttering about how useless her sweetheart is. During that time Dima has time to peacefully complete *k*<=-<=1 tasks. Then Inna returns and tells Dima off for the next task he does in her presence and goes to another room again. It continues until Dima is through with his tasks.
Overall, Dima has *n* tasks to do, each task has a unique number from 1 to *n*. Dima loves order, so he does tasks consecutively, starting from some task. For example, if Dima has 6 tasks to do in total, then, if he starts from the 5-th task, the order is like that: first Dima does the 5-th task, then the 6-th one, then the 1-st one, then the 2-nd one, then the 3-rd one, then the 4-th one.
Inna tells Dima off (only lovingly and appropriately!) so often and systematically that he's very well learned the power with which she tells him off for each task. Help Dima choose the first task so that in total he gets told off with as little power as possible.
|
The first line of the input contains two integers *n*,<=*k* (1<=≤<=*k*<=≤<=*n*<=≤<=105). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103), where *a**i* is the power Inna tells Dima off with if she is present in the room while he is doing the *i*-th task.
It is guaranteed that *n* is divisible by *k*.
|
In a single line print the number of the task Dima should start with to get told off with as little power as possible. If there are multiple solutions, print the one with the minimum number of the first task to do.
|
[
"6 2\n3 2 1 6 5 4\n",
"10 5\n1 3 5 7 9 9 4 1 8 5\n"
] |
[
"1\n",
"3\n"
] |
Explanation of the first example.
If Dima starts from the first task, Inna tells him off with power 3, then Dima can do one more task (as *k* = 2), then Inna tells him off for the third task with power 1, then she tells him off for the fifth task with power 5. Thus, Dima gets told off with total power 3 + 1 + 5 = 9. If Dima started from the second task, for example, then Inna would tell him off for tasks 2, 4 and 6 with power 2 + 6 + 4 = 12.
Explanation of the second example.
In the second example *k* = 5, thus, Dima manages to complete 4 tasks in-between the telling off sessions. Thus, Inna tells Dima off for tasks number 1 and 6 (if he starts from 1 or 6), 2 and 7 (if he starts from 2 or 7) and so on. The optimal answer is to start from task 3 or 8, 3 has a smaller number, so the answer is 3.
| 1,000
|
[
{
"input": "6 2\n3 2 1 6 5 4",
"output": "1"
},
{
"input": "10 5\n1 3 5 7 9 9 4 1 8 5",
"output": "3"
},
{
"input": "20 4\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "10 10\n8 4 5 7 6 9 2 2 3 5",
"output": "7"
},
{
"input": "50 10\n1 2 3 4 5 6 7 8 9 10 10 1 1 1 1 1 1 1 1 1 10 1 1 1 1 1 1 1 1 1 10 1 1 1 1 1 1 1 1 1 10 1 1 1 1 1 1 1 1 1",
"output": "2"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "2 1\n1 1",
"output": "1"
},
{
"input": "4 2\n2 1 1 3",
"output": "1"
},
{
"input": "15 5\n5 5 5 5 5 1 2 3 4 5 1 2 3 4 5",
"output": "1"
},
{
"input": "20 10\n3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 3 3 6 4",
"output": "1"
}
] | 1,533,281,873
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 187
| 6,656,000
|
"""
6 2
3 2 1 6 5 4
"""
n, k = map(int, input().split())
l = [int(x) for x in input().split()]
ans = []
minn = 123456567
key = 0
for i in range(k):
j = i
summ = 0
while j < n:
summ += l[j]
j += k
if(summ < minn):
minn = summ
key = i
print(key + 1)
|
Title: Dima and To-do List
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You helped Dima to have a great weekend, but it's time to work. Naturally, Dima, as all other men who have girlfriends, does everything wrong.
Inna and Dima are now in one room. Inna tells Dima off for everything he does in her presence. After Inna tells him off for something, she goes to another room, walks there in circles muttering about how useless her sweetheart is. During that time Dima has time to peacefully complete *k*<=-<=1 tasks. Then Inna returns and tells Dima off for the next task he does in her presence and goes to another room again. It continues until Dima is through with his tasks.
Overall, Dima has *n* tasks to do, each task has a unique number from 1 to *n*. Dima loves order, so he does tasks consecutively, starting from some task. For example, if Dima has 6 tasks to do in total, then, if he starts from the 5-th task, the order is like that: first Dima does the 5-th task, then the 6-th one, then the 1-st one, then the 2-nd one, then the 3-rd one, then the 4-th one.
Inna tells Dima off (only lovingly and appropriately!) so often and systematically that he's very well learned the power with which she tells him off for each task. Help Dima choose the first task so that in total he gets told off with as little power as possible.
Input Specification:
The first line of the input contains two integers *n*,<=*k* (1<=≤<=*k*<=≤<=*n*<=≤<=105). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103), where *a**i* is the power Inna tells Dima off with if she is present in the room while he is doing the *i*-th task.
It is guaranteed that *n* is divisible by *k*.
Output Specification:
In a single line print the number of the task Dima should start with to get told off with as little power as possible. If there are multiple solutions, print the one with the minimum number of the first task to do.
Demo Input:
['6 2\n3 2 1 6 5 4\n', '10 5\n1 3 5 7 9 9 4 1 8 5\n']
Demo Output:
['1\n', '3\n']
Note:
Explanation of the first example.
If Dima starts from the first task, Inna tells him off with power 3, then Dima can do one more task (as *k* = 2), then Inna tells him off for the third task with power 1, then she tells him off for the fifth task with power 5. Thus, Dima gets told off with total power 3 + 1 + 5 = 9. If Dima started from the second task, for example, then Inna would tell him off for tasks 2, 4 and 6 with power 2 + 6 + 4 = 12.
Explanation of the second example.
In the second example *k* = 5, thus, Dima manages to complete 4 tasks in-between the telling off sessions. Thus, Inna tells Dima off for tasks number 1 and 6 (if he starts from 1 or 6), 2 and 7 (if he starts from 2 or 7) and so on. The optimal answer is to start from task 3 or 8, 3 has a smaller number, so the answer is 3.
|
```python
"""
6 2
3 2 1 6 5 4
"""
n, k = map(int, input().split())
l = [int(x) for x in input().split()]
ans = []
minn = 123456567
key = 0
for i in range(k):
j = i
summ = 0
while j < n:
summ += l[j]
j += k
if(summ < minn):
minn = summ
key = i
print(key + 1)
```
| 3
|
|
948
|
A
|
Protect Sheep
|
PROGRAMMING
| 900
|
[
"brute force",
"dfs and similar",
"graphs",
"implementation"
] | null | null |
Bob is a farmer. He has a large pasture with many sheep. Recently, he has lost some of them due to wolf attacks. He thus decided to place some shepherd dogs in such a way that all his sheep are protected.
The pasture is a rectangle consisting of *R*<=×<=*C* cells. Each cell is either empty, contains a sheep, a wolf or a dog. Sheep and dogs always stay in place, but wolves can roam freely around the pasture, by repeatedly moving to the left, right, up or down to a neighboring cell. When a wolf enters a cell with a sheep, it consumes it. However, no wolf can enter a cell with a dog.
Initially there are no dogs. Place dogs onto the pasture in such a way that no wolf can reach any sheep, or determine that it is impossible. Note that since you have many dogs, you do not need to minimize their number.
|
First line contains two integers *R* (1<=≤<=*R*<=≤<=500) and *C* (1<=≤<=*C*<=≤<=500), denoting the number of rows and the numbers of columns respectively.
Each of the following *R* lines is a string consisting of exactly *C* characters, representing one row of the pasture. Here, 'S' means a sheep, 'W' a wolf and '.' an empty cell.
|
If it is impossible to protect all sheep, output a single line with the word "No".
Otherwise, output a line with the word "Yes". Then print *R* lines, representing the pasture after placing dogs. Again, 'S' means a sheep, 'W' a wolf, 'D' is a dog and '.' an empty space. You are not allowed to move, remove or add a sheep or a wolf.
If there are multiple solutions, you may print any of them. You don't have to minimize the number of dogs.
|
[
"6 6\n..S...\n..S.W.\n.S....\n..W...\n...W..\n......\n",
"1 2\nSW\n",
"5 5\n.S...\n...S.\nS....\n...S.\n.S...\n"
] |
[
"Yes\n..SD..\n..SDW.\n.SD...\n.DW...\nDD.W..\n......\n",
"No\n",
"Yes\n.S...\n...S.\nS.D..\n...S.\n.S...\n"
] |
In the first example, we can split the pasture into two halves, one containing wolves and one containing sheep. Note that the sheep at (2,1) is safe, as wolves cannot move diagonally.
In the second example, there are no empty spots to put dogs that would guard the lone sheep.
In the third example, there are no wolves, so the task is very easy. We put a dog in the center to observe the peacefulness of the meadow, but the solution would be correct even without him.
| 500
|
[
{
"input": "1 2\nSW",
"output": "No"
},
{
"input": "10 10\n....W.W.W.\n.........S\n.S.S...S..\nW.......SS\n.W..W.....\n.W...W....\nS..S...S.S\n....W...S.\n..S..S.S.S\nSS.......S",
"output": "Yes\nDDDDWDWDWD\nDDDDDDDDDS\nDSDSDDDSDD\nWDDDDDDDSS\nDWDDWDDDDD\nDWDDDWDDDD\nSDDSDDDSDS\nDDDDWDDDSD\nDDSDDSDSDS\nSSDDDDDDDS"
},
{
"input": "10 10\n....W.W.W.\n...W.....S\n.S.S...S..\nW......WSS\n.W..W.....\n.W...W....\nS..S...S.S\n...WWW..S.\n..S..S.S.S\nSS.......S",
"output": "No"
},
{
"input": "1 50\nW...S..............W.....S..S...............S...W.",
"output": "Yes\nWDDDSDDDDDDDDDDDDDDWDDDDDSDDSDDDDDDDDDDDDDDDSDDDWD"
},
{
"input": "2 4\n...S\n...W",
"output": "No"
},
{
"input": "4 2\n..\n..\n..\nSW",
"output": "No"
},
{
"input": "4 2\n..\n..\n..\nWS",
"output": "No"
},
{
"input": "2 4\n...W\n...S",
"output": "No"
},
{
"input": "50 1\nS\n.\n.\n.\n.\n.\n.\nS\n.\n.\n.\n.\n.\n.\n.\n.\nS\n.\nW\n.\nS\n.\n.\n.\n.\nS\n.\n.\n.\n.\n.\n.\n.\nW\n.\n.\n.\nW\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.",
"output": "Yes\nS\nD\nD\nD\nD\nD\nD\nS\nD\nD\nD\nD\nD\nD\nD\nD\nS\nD\nW\nD\nS\nD\nD\nD\nD\nS\nD\nD\nD\nD\nD\nD\nD\nW\nD\nD\nD\nW\nD\nD\nD\nD\nD\nD\nD\nD\nD\nD\nD\nD"
},
{
"input": "4 4\nW..S\nW..S\nW..S\nW..S",
"output": "Yes\nWDDS\nWDDS\nWDDS\nWDDS"
},
{
"input": "4 4\nSSSS\n....\n....\nWWWW",
"output": "Yes\nSSSS\nDDDD\nDDDD\nWWWW"
},
{
"input": "4 4\nWWWW\n....\n....\nSSSS",
"output": "Yes\nWWWW\nDDDD\nDDDD\nSSSS"
},
{
"input": "4 4\nS..W\nS..W\nS..W\nS..W",
"output": "Yes\nSDDW\nSDDW\nSDDW\nSDDW"
},
{
"input": "1 1\n.",
"output": "Yes\nD"
},
{
"input": "1 1\nW",
"output": "Yes\nW"
},
{
"input": "1 1\nS",
"output": "Yes\nS"
},
{
"input": "4 2\n..\n..\n.W\n.S",
"output": "No"
},
{
"input": "4 2\n..\n..\n.S\n.W",
"output": "No"
},
{
"input": "4 2\n..\n..\nW.\nS.",
"output": "No"
},
{
"input": "4 2\n..\n..\nS.\nW.",
"output": "No"
},
{
"input": "2 4\n....\n..SW",
"output": "No"
},
{
"input": "2 4\n....\n..WS",
"output": "No"
},
{
"input": "1 2\nS.",
"output": "Yes\nSD"
}
] | 1,520,697,082
| 982
|
Python 3
|
OK
|
TESTS
| 98
| 124
| 8,192,000
|
r, c = map(int, input().split())
pasture = []
pasture.append(list('.' * (c + 2)))
for i in range(r):
pasture.append(['.'] + list(input()) + ['.'])
pasture.append(list('.' * (c + 2)))
adj = [(1, 0), (-1, 0), (0, 1), (0, -1)]
for i in range(1, r + 1):
for j in range(1, c + 1):
if pasture[i][j] == 'S':
if any(pasture[i + a][j + b] == 'W' for a,b in adj):
print('No')
exit()
for a,b in adj:
if pasture[i + a][j + b] == '.':
pasture[i + a][j + b] = 'D'
print('Yes')
print('\n'.join(''.join(row[1:-1]) for row in pasture[1:-1]))
|
Title: Protect Sheep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bob is a farmer. He has a large pasture with many sheep. Recently, he has lost some of them due to wolf attacks. He thus decided to place some shepherd dogs in such a way that all his sheep are protected.
The pasture is a rectangle consisting of *R*<=×<=*C* cells. Each cell is either empty, contains a sheep, a wolf or a dog. Sheep and dogs always stay in place, but wolves can roam freely around the pasture, by repeatedly moving to the left, right, up or down to a neighboring cell. When a wolf enters a cell with a sheep, it consumes it. However, no wolf can enter a cell with a dog.
Initially there are no dogs. Place dogs onto the pasture in such a way that no wolf can reach any sheep, or determine that it is impossible. Note that since you have many dogs, you do not need to minimize their number.
Input Specification:
First line contains two integers *R* (1<=≤<=*R*<=≤<=500) and *C* (1<=≤<=*C*<=≤<=500), denoting the number of rows and the numbers of columns respectively.
Each of the following *R* lines is a string consisting of exactly *C* characters, representing one row of the pasture. Here, 'S' means a sheep, 'W' a wolf and '.' an empty cell.
Output Specification:
If it is impossible to protect all sheep, output a single line with the word "No".
Otherwise, output a line with the word "Yes". Then print *R* lines, representing the pasture after placing dogs. Again, 'S' means a sheep, 'W' a wolf, 'D' is a dog and '.' an empty space. You are not allowed to move, remove or add a sheep or a wolf.
If there are multiple solutions, you may print any of them. You don't have to minimize the number of dogs.
Demo Input:
['6 6\n..S...\n..S.W.\n.S....\n..W...\n...W..\n......\n', '1 2\nSW\n', '5 5\n.S...\n...S.\nS....\n...S.\n.S...\n']
Demo Output:
['Yes\n..SD..\n..SDW.\n.SD...\n.DW...\nDD.W..\n......\n', 'No\n', 'Yes\n.S...\n...S.\nS.D..\n...S.\n.S...\n']
Note:
In the first example, we can split the pasture into two halves, one containing wolves and one containing sheep. Note that the sheep at (2,1) is safe, as wolves cannot move diagonally.
In the second example, there are no empty spots to put dogs that would guard the lone sheep.
In the third example, there are no wolves, so the task is very easy. We put a dog in the center to observe the peacefulness of the meadow, but the solution would be correct even without him.
|
```python
r, c = map(int, input().split())
pasture = []
pasture.append(list('.' * (c + 2)))
for i in range(r):
pasture.append(['.'] + list(input()) + ['.'])
pasture.append(list('.' * (c + 2)))
adj = [(1, 0), (-1, 0), (0, 1), (0, -1)]
for i in range(1, r + 1):
for j in range(1, c + 1):
if pasture[i][j] == 'S':
if any(pasture[i + a][j + b] == 'W' for a,b in adj):
print('No')
exit()
for a,b in adj:
if pasture[i + a][j + b] == '.':
pasture[i + a][j + b] = 'D'
print('Yes')
print('\n'.join(''.join(row[1:-1]) for row in pasture[1:-1]))
```
| 3
|
|
387
|
B
|
George and Round
|
PROGRAMMING
| 1,200
|
[
"brute force",
"greedy",
"two pointers"
] | null | null |
George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*.
To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities.
George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=≥<=*d*), by changing limits on the input data.
However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=3000) — the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*<=≤<=106) — the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b*1<=≤<=*b*2...<=≤<=*b**m*<=≤<=106) — the complexities of the problems prepared by George.
|
Print a single integer — the answer to the problem.
|
[
"3 5\n1 2 3\n1 2 2 3 3\n",
"3 5\n1 2 3\n1 1 1 1 1\n",
"3 1\n2 3 4\n1\n"
] |
[
"0\n",
"2\n",
"3\n"
] |
In the first sample the set of the prepared problems meets the requirements for a good round.
In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round.
In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2, 3, 4.
| 1,000
|
[
{
"input": "3 5\n1 2 3\n1 2 2 3 3",
"output": "0"
},
{
"input": "3 5\n1 2 3\n1 1 1 1 1",
"output": "2"
},
{
"input": "3 1\n2 3 4\n1",
"output": "3"
},
{
"input": "29 100\n20 32 41 67 72 155 331 382 399 412 465 470 484 511 515 529 616 637 679 715 733 763 826 843 862 903 925 979 989\n15 15 15 17 18 19 19 20 21 21 22 24 25 26 26 27 28 31 32 32 37 38 38 39 39 40 41 42 43 43 45 45 46 47 49 49 50 50 50 51 52 53 53 55 56 57 59 59 59 60 60 62 62 63 63 64 64 64 66 67 69 69 70 70 72 72 73 74 75 76 77 78 80 80 81 81 83 83 83 84 86 86 86 86 87 88 89 91 91 91 92 93 94 94 96 97 97 97 98 98",
"output": "24"
}
] | 1,692,037,038
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 41
| 77
| 1,945,600
|
n,m=map(int,input().split())
l1=list(map(int,input().split()))
l2=list(map(int,input().split()))
i=0
j=0
qc=0
while i<len(l1) and j<len(l2):
if l1[i]<=l2[j]:
#print(i,j)
i=i+1
j=j+1
qc=qc+1
else:
j=j+1
#print(i,j)
print(n-qc)
|
Title: George and Round
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*.
To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities.
George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=≥<=*d*), by changing limits on the input data.
However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=3000) — the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*<=≤<=106) — the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b*1<=≤<=*b*2...<=≤<=*b**m*<=≤<=106) — the complexities of the problems prepared by George.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['3 5\n1 2 3\n1 2 2 3 3\n', '3 5\n1 2 3\n1 1 1 1 1\n', '3 1\n2 3 4\n1\n']
Demo Output:
['0\n', '2\n', '3\n']
Note:
In the first sample the set of the prepared problems meets the requirements for a good round.
In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round.
In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2, 3, 4.
|
```python
n,m=map(int,input().split())
l1=list(map(int,input().split()))
l2=list(map(int,input().split()))
i=0
j=0
qc=0
while i<len(l1) and j<len(l2):
if l1[i]<=l2[j]:
#print(i,j)
i=i+1
j=j+1
qc=qc+1
else:
j=j+1
#print(i,j)
print(n-qc)
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created.
We assume that Bajtek can only heap up snow drifts at integer coordinates.
|
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift.
Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct.
|
Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one.
|
[
"2\n2 1\n1 2\n",
"2\n2 1\n4 1\n"
] |
[
"1\n",
"0\n"
] |
none
| 0
|
[
{
"input": "2\n2 1\n1 2",
"output": "1"
},
{
"input": "2\n2 1\n4 1",
"output": "0"
},
{
"input": "24\n171 35\n261 20\n4 206\n501 446\n961 912\n581 748\n946 978\n463 514\n841 889\n341 466\n842 967\n54 102\n235 261\n925 889\n682 672\n623 636\n268 94\n635 710\n474 510\n697 794\n586 663\n182 184\n806 663\n468 459",
"output": "21"
},
{
"input": "17\n660 646\n440 442\n689 618\n441 415\n922 865\n950 972\n312 366\n203 229\n873 860\n219 199\n344 308\n169 176\n961 992\n153 84\n201 230\n987 938\n834 815",
"output": "16"
},
{
"input": "11\n798 845\n722 911\n374 270\n629 537\n748 856\n831 885\n486 641\n751 829\n609 492\n98 27\n654 663",
"output": "10"
},
{
"input": "1\n321 88",
"output": "0"
},
{
"input": "9\n811 859\n656 676\n76 141\n945 951\n497 455\n18 55\n335 294\n267 275\n656 689",
"output": "7"
},
{
"input": "7\n948 946\n130 130\n761 758\n941 938\n971 971\n387 385\n509 510",
"output": "6"
},
{
"input": "6\n535 699\n217 337\n508 780\n180 292\n393 112\n732 888",
"output": "5"
},
{
"input": "14\n25 23\n499 406\n193 266\n823 751\n219 227\n101 138\n978 992\n43 74\n997 932\n237 189\n634 538\n774 740\n842 767\n742 802",
"output": "13"
},
{
"input": "12\n548 506\n151 198\n370 380\n655 694\n654 690\n407 370\n518 497\n819 827\n765 751\n802 771\n741 752\n653 662",
"output": "11"
},
{
"input": "40\n685 711\n433 403\n703 710\n491 485\n616 619\n288 282\n884 871\n367 352\n500 511\n977 982\n51 31\n576 564\n508 519\n755 762\n22 20\n368 353\n232 225\n953 955\n452 436\n311 330\n967 988\n369 364\n791 803\n150 149\n651 661\n118 93\n398 387\n748 766\n852 852\n230 228\n555 545\n515 519\n667 678\n867 862\n134 146\n859 863\n96 99\n486 469\n303 296\n780 786",
"output": "38"
},
{
"input": "3\n175 201\n907 909\n388 360",
"output": "2"
},
{
"input": "7\n312 298\n86 78\n73 97\n619 594\n403 451\n538 528\n71 86",
"output": "6"
},
{
"input": "19\n802 820\n368 248\n758 794\n455 378\n876 888\n771 814\n245 177\n586 555\n844 842\n364 360\n820 856\n731 624\n982 975\n825 856\n122 121\n862 896\n42 4\n792 841\n828 820",
"output": "16"
},
{
"input": "32\n643 877\n842 614\n387 176\n99 338\n894 798\n652 728\n611 648\n622 694\n579 781\n243 46\n322 305\n198 438\n708 579\n246 325\n536 459\n874 593\n120 277\n989 907\n223 110\n35 130\n761 692\n690 661\n518 766\n226 93\n678 597\n725 617\n661 574\n775 496\n56 416\n14 189\n358 359\n898 901",
"output": "31"
},
{
"input": "32\n325 327\n20 22\n72 74\n935 933\n664 663\n726 729\n785 784\n170 171\n315 314\n577 580\n984 987\n313 317\n434 435\n962 961\n55 54\n46 44\n743 742\n434 433\n617 612\n332 332\n883 886\n940 936\n793 792\n645 644\n611 607\n418 418\n465 465\n219 218\n167 164\n56 54\n403 405\n210 210",
"output": "29"
},
{
"input": "32\n652 712\n260 241\n27 154\n188 16\n521 351\n518 356\n452 540\n790 827\n339 396\n336 551\n897 930\n828 627\n27 168\n180 113\n134 67\n794 671\n812 711\n100 241\n686 813\n138 289\n384 506\n884 932\n913 959\n470 508\n730 734\n373 478\n788 862\n392 426\n148 68\n113 49\n713 852\n924 894",
"output": "29"
},
{
"input": "14\n685 808\n542 677\n712 747\n832 852\n187 410\n399 338\n626 556\n530 635\n267 145\n215 209\n559 684\n944 949\n753 596\n601 823",
"output": "13"
},
{
"input": "5\n175 158\n16 2\n397 381\n668 686\n957 945",
"output": "4"
},
{
"input": "5\n312 284\n490 509\n730 747\n504 497\n782 793",
"output": "4"
},
{
"input": "2\n802 903\n476 348",
"output": "1"
},
{
"input": "4\n325 343\n425 442\n785 798\n275 270",
"output": "3"
},
{
"input": "28\n462 483\n411 401\n118 94\n111 127\n5 6\n70 52\n893 910\n73 63\n818 818\n182 201\n642 633\n900 886\n893 886\n684 700\n157 173\n953 953\n671 660\n224 225\n832 801\n152 157\n601 585\n115 101\n739 722\n611 606\n659 642\n461 469\n702 689\n649 653",
"output": "25"
},
{
"input": "36\n952 981\n885 900\n803 790\n107 129\n670 654\n143 132\n66 58\n813 819\n849 837\n165 198\n247 228\n15 39\n619 618\n105 138\n868 855\n965 957\n293 298\n613 599\n227 212\n745 754\n723 704\n877 858\n503 487\n678 697\n592 595\n155 135\n962 982\n93 89\n660 673\n225 212\n967 987\n690 680\n804 813\n489 518\n240 221\n111 124",
"output": "34"
},
{
"input": "30\n89 3\n167 156\n784 849\n943 937\n144 95\n24 159\n80 120\n657 683\n585 596\n43 147\n909 964\n131 84\n345 389\n333 321\n91 126\n274 325\n859 723\n866 922\n622 595\n690 752\n902 944\n127 170\n426 383\n905 925\n172 284\n793 810\n414 510\n890 884\n123 24\n267 255",
"output": "29"
},
{
"input": "5\n664 666\n951 941\n739 742\n844 842\n2 2",
"output": "4"
},
{
"input": "3\n939 867\n411 427\n757 708",
"output": "2"
},
{
"input": "36\n429 424\n885 972\n442 386\n512 511\n751 759\n4 115\n461 497\n496 408\n8 23\n542 562\n296 331\n448 492\n412 395\n109 166\n622 640\n379 355\n251 262\n564 586\n66 115\n275 291\n666 611\n629 534\n510 567\n635 666\n738 803\n420 369\n92 17\n101 144\n141 92\n258 258\n184 235\n492 456\n311 210\n394 357\n531 512\n634 636",
"output": "34"
},
{
"input": "29\n462 519\n871 825\n127 335\n156 93\n576 612\n885 830\n634 779\n340 105\n744 795\n716 474\n93 139\n563 805\n137 276\n177 101\n333 14\n391 437\n873 588\n817 518\n460 597\n572 670\n140 303\n392 441\n273 120\n862 578\n670 639\n410 161\n544 577\n193 116\n252 195",
"output": "28"
},
{
"input": "23\n952 907\n345 356\n812 807\n344 328\n242 268\n254 280\n1000 990\n80 78\n424 396\n595 608\n755 813\n383 380\n55 56\n598 633\n203 211\n508 476\n600 593\n206 192\n855 882\n517 462\n967 994\n642 657\n493 488",
"output": "22"
},
{
"input": "10\n579 816\n806 590\n830 787\n120 278\n677 800\n16 67\n188 251\n559 560\n87 67\n104 235",
"output": "8"
},
{
"input": "23\n420 424\n280 303\n515 511\n956 948\n799 803\n441 455\n362 369\n299 289\n823 813\n982 967\n876 878\n185 157\n529 551\n964 989\n655 656\n1 21\n114 112\n45 56\n935 937\n1000 997\n934 942\n360 366\n648 621",
"output": "22"
},
{
"input": "23\n102 84\n562 608\n200 127\n952 999\n465 496\n322 367\n728 690\n143 147\n855 867\n861 866\n26 59\n300 273\n255 351\n192 246\n70 111\n365 277\n32 104\n298 319\n330 354\n241 141\n56 125\n315 298\n412 461",
"output": "22"
},
{
"input": "7\n429 506\n346 307\n99 171\n853 916\n322 263\n115 157\n906 924",
"output": "6"
},
{
"input": "3\n1 1\n2 1\n2 2",
"output": "0"
},
{
"input": "4\n1 1\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "5\n1 1\n1 2\n2 2\n3 1\n3 3",
"output": "0"
},
{
"input": "6\n1 1\n1 2\n2 2\n3 1\n3 2\n3 3",
"output": "0"
},
{
"input": "20\n1 1\n2 2\n3 3\n3 9\n4 4\n5 2\n5 5\n5 7\n5 8\n6 2\n6 6\n6 9\n7 7\n8 8\n9 4\n9 7\n9 9\n10 2\n10 9\n10 10",
"output": "1"
},
{
"input": "21\n1 1\n1 9\n2 1\n2 2\n2 5\n2 6\n2 9\n3 3\n3 8\n4 1\n4 4\n5 5\n5 8\n6 6\n7 7\n8 8\n9 9\n10 4\n10 10\n11 5\n11 11",
"output": "1"
},
{
"input": "22\n1 1\n1 3\n1 4\n1 8\n1 9\n1 11\n2 2\n3 3\n4 4\n4 5\n5 5\n6 6\n6 8\n7 7\n8 3\n8 4\n8 8\n9 9\n10 10\n11 4\n11 9\n11 11",
"output": "3"
},
{
"input": "50\n1 1\n2 2\n2 9\n3 3\n4 4\n4 9\n4 16\n4 24\n5 5\n6 6\n7 7\n8 8\n8 9\n8 20\n9 9\n10 10\n11 11\n12 12\n13 13\n14 7\n14 14\n14 16\n14 25\n15 4\n15 6\n15 15\n15 22\n16 6\n16 16\n17 17\n18 18\n19 6\n19 19\n20 20\n21 21\n22 6\n22 22\n23 23\n24 6\n24 7\n24 8\n24 9\n24 24\n25 1\n25 3\n25 5\n25 7\n25 23\n25 24\n25 25",
"output": "7"
},
{
"input": "55\n1 1\n1 14\n2 2\n2 19\n3 1\n3 3\n3 8\n3 14\n3 23\n4 1\n4 4\n5 5\n5 8\n5 15\n6 2\n6 3\n6 4\n6 6\n7 7\n8 8\n8 21\n9 9\n10 1\n10 10\n11 9\n11 11\n12 12\n13 13\n14 14\n15 15\n15 24\n16 5\n16 16\n17 5\n17 10\n17 17\n17 18\n17 22\n17 27\n18 18\n19 19\n20 20\n21 20\n21 21\n22 22\n23 23\n24 14\n24 24\n25 25\n26 8\n26 11\n26 26\n27 3\n27 27\n28 28",
"output": "5"
},
{
"input": "3\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "6\n4 4\n3 4\n5 4\n4 5\n4 3\n3 1",
"output": "0"
},
{
"input": "4\n1 1\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "3\n1 1\n2 2\n1 2",
"output": "0"
},
{
"input": "8\n1 3\n1 1\n4 1\n2 2\n2 5\n5 9\n5 1\n5 4",
"output": "1"
},
{
"input": "10\n1 1\n1 2\n1 3\n1 4\n5 5\n6 6\n7 7\n8 8\n9 9\n100 100",
"output": "6"
},
{
"input": "7\n1 1\n2 2\n3 3\n4 4\n1 2\n2 3\n3 4",
"output": "0"
},
{
"input": "6\n1 1\n2 1\n2 2\n2 4\n4 3\n2 3",
"output": "0"
},
{
"input": "4\n3 1\n2 1\n2 2\n1 2",
"output": "0"
},
{
"input": "6\n1 1\n2 2\n2 1\n2 4\n4 3\n2 3",
"output": "0"
},
{
"input": "3\n1 2\n1 3\n1 4",
"output": "0"
},
{
"input": "4\n1 1\n2 2\n1 2\n2 1",
"output": "0"
},
{
"input": "4\n1 3\n2 1\n3 2\n3 1",
"output": "1"
},
{
"input": "7\n1 1\n1 2\n2 2\n3 3\n3 4\n4 4\n1 4",
"output": "0"
},
{
"input": "21\n12 12\n13 12\n12 11\n13 13\n10 10\n11 10\n11 11\n501 500\n501 501\n503 502\n500 500\n503 503\n502 501\n502 502\n700 700\n702 702\n703 702\n701 701\n702 701\n703 703\n701 700",
"output": "2"
},
{
"input": "6\n1 11\n6 8\n11 10\n1 10\n11 11\n6 9",
"output": "1"
},
{
"input": "4\n1 1\n2 2\n3 2\n3 1",
"output": "0"
},
{
"input": "3\n1 2\n3 4\n3 2",
"output": "0"
},
{
"input": "3\n1 1\n1 2\n2 2",
"output": "0"
},
{
"input": "4\n5 5\n5 4\n6 3\n6 4",
"output": "0"
},
{
"input": "3\n1 1\n2 2\n2 1",
"output": "0"
}
] | 1,572,110,213
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 76
| 342
| 409,600
|
import collections
def breadth_first_search(graph, root):
visited = set()
visited.add(root)
queue = collections.deque([root])
while queue:
vertex = queue.popleft()
for neighbour in graph[vertex]:
if neighbour not in visited:
visited.add(neighbour)
queue.append(neighbour)
return visited
# The first line of input contains a single integer n (1 ≤ n ≤ 100) — the number of snow drifts.
# Each of the following n lines contains two integers xi and yi (1 ≤ xi, yi ≤ 1000) — the coordinates of the i-th snow drift.
N = int(input())
drifts = []
xcoord = set()
ycoord = set()
for n in range(N):
xi, yi = map(int, input().split())
sxi = 'x' + str(xi)
xcoord.add(sxi)
syi = 'y' + str(yi)
ycoord.add(syi)
drifts.append( (sxi, syi) )
graph = dict()
for v in xcoord | ycoord:
graph[v] = set()
for e in drifts:
graph[e[0]].add(e[1])
graph[e[1]].add(e[0])
# print(graph)
parts = []
seen = set()
for v in graph:
if v not in seen:
area = breadth_first_search(graph, v)
parts.append(area)
seen.update(area)
print(len(parts) - 1)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created.
We assume that Bajtek can only heap up snow drifts at integer coordinates.
Input Specification:
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift.
Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct.
Output Specification:
Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one.
Demo Input:
['2\n2 1\n1 2\n', '2\n2 1\n4 1\n']
Demo Output:
['1\n', '0\n']
Note:
none
|
```python
import collections
def breadth_first_search(graph, root):
visited = set()
visited.add(root)
queue = collections.deque([root])
while queue:
vertex = queue.popleft()
for neighbour in graph[vertex]:
if neighbour not in visited:
visited.add(neighbour)
queue.append(neighbour)
return visited
# The first line of input contains a single integer n (1 ≤ n ≤ 100) — the number of snow drifts.
# Each of the following n lines contains two integers xi and yi (1 ≤ xi, yi ≤ 1000) — the coordinates of the i-th snow drift.
N = int(input())
drifts = []
xcoord = set()
ycoord = set()
for n in range(N):
xi, yi = map(int, input().split())
sxi = 'x' + str(xi)
xcoord.add(sxi)
syi = 'y' + str(yi)
ycoord.add(syi)
drifts.append( (sxi, syi) )
graph = dict()
for v in xcoord | ycoord:
graph[v] = set()
for e in drifts:
graph[e[0]].add(e[1])
graph[e[1]].add(e[0])
# print(graph)
parts = []
seen = set()
for v in graph:
if v not in seen:
area = breadth_first_search(graph, v)
parts.append(area)
seen.update(area)
print(len(parts) - 1)
```
| 3
|
|
421
|
A
|
Pasha and Hamsters
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
Pasha has two hamsters: Arthur and Alexander. Pasha put *n* apples in front of them. Pasha knows which apples Arthur likes. Similarly, Pasha knows which apples Alexander likes. Pasha doesn't want any conflict between the hamsters (as they may like the same apple), so he decided to distribute the apples between the hamsters on his own. He is going to give some apples to Arthur and some apples to Alexander. It doesn't matter how many apples each hamster gets but it is important that each hamster gets only the apples he likes. It is possible that somebody doesn't get any apples.
Help Pasha distribute all the apples between the hamsters. Note that Pasha wants to distribute all the apples, not just some of them.
|
The first line contains integers *n*, *a*, *b* (1<=≤<=*n*<=≤<=100; 1<=≤<=*a*,<=*b*<=≤<=*n*) — the number of apples Pasha has, the number of apples Arthur likes and the number of apples Alexander likes, correspondingly.
The next line contains *a* distinct integers — the numbers of the apples Arthur likes. The next line contains *b* distinct integers — the numbers of the apples Alexander likes.
Assume that the apples are numbered from 1 to *n*. The input is such that the answer exists.
|
Print *n* characters, each of them equals either 1 or 2. If the *i*-h character equals 1, then the *i*-th apple should be given to Arthur, otherwise it should be given to Alexander. If there are multiple correct answers, you are allowed to print any of them.
|
[
"4 2 3\n1 2\n2 3 4\n",
"5 5 2\n3 4 1 2 5\n2 3\n"
] |
[
"1 1 2 2\n",
"1 1 1 1 1\n"
] |
none
| 500
|
[
{
"input": "4 2 3\n1 2\n2 3 4",
"output": "1 1 2 2"
},
{
"input": "5 5 2\n3 4 1 2 5\n2 3",
"output": "1 1 1 1 1"
},
{
"input": "100 69 31\n1 3 4 5 6 7 8 9 10 11 12 14 15 16 17 18 19 20 21 24 26 27 29 31 37 38 39 40 44 46 48 49 50 51 53 55 56 57 58 59 60 61 63 64 65 66 67 68 69 70 71 72 74 76 77 78 79 80 81 82 83 89 92 94 95 97 98 99 100\n2 13 22 23 25 28 30 32 33 34 35 36 41 42 43 45 47 52 54 62 73 75 84 85 86 87 88 90 91 93 96",
"output": "1 2 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 2 2 1 2 1 1 2 1 2 1 2 2 2 2 2 1 1 1 1 2 2 2 1 2 1 2 1 1 1 1 2 1 2 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 2 1 2 1 1 1 1 1 1 1 1 2 2 2 2 2 1 2 2 1 2 1 1 2 1 1 1 1"
},
{
"input": "100 56 44\n1 2 5 8 14 15 17 18 20 21 23 24 25 27 30 33 34 35 36 38 41 42 44 45 46 47 48 49 50 53 56 58 59 60 62 63 64 65 68 69 71 75 76 80 81 84 87 88 90 91 92 94 95 96 98 100\n3 4 6 7 9 10 11 12 13 16 19 22 26 28 29 31 32 37 39 40 43 51 52 54 55 57 61 66 67 70 72 73 74 77 78 79 82 83 85 86 89 93 97 99",
"output": "1 1 2 2 1 2 2 1 2 2 2 2 2 1 1 2 1 1 2 1 1 2 1 1 1 2 1 2 2 1 2 2 1 1 1 1 2 1 2 2 1 1 2 1 1 1 1 1 1 1 2 2 1 2 2 1 2 1 1 1 2 1 1 1 1 2 2 1 1 2 1 2 2 2 1 1 2 2 2 1 1 2 2 1 2 2 1 1 2 1 1 1 2 1 1 1 2 1 2 1"
},
{
"input": "100 82 18\n1 2 3 4 5 6 7 8 9 10 11 13 14 15 16 17 18 19 20 22 23 25 27 29 30 31 32 33 34 35 36 37 38 42 43 44 45 46 47 48 49 50 51 53 54 55 57 58 59 60 61 62 63 64 65 66 67 68 69 71 72 73 74 75 77 78 79 80 82 83 86 88 90 91 92 93 94 96 97 98 99 100\n12 21 24 26 28 39 40 41 52 56 70 76 81 84 85 87 89 95",
"output": "1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 2 1 1 2 1 2 1 2 1 1 1 1 1 1 1 1 1 1 2 2 2 1 1 1 1 1 1 1 1 1 1 2 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 2 1 1 1 1 2 1 1 2 2 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1"
},
{
"input": "99 72 27\n1 2 3 4 5 6 7 8 10 11 12 13 14 15 16 17 20 23 25 26 28 29 30 32 33 34 35 36 39 41 42 43 44 45 46 47 50 51 52 54 55 56 58 59 60 61 62 67 70 71 72 74 75 76 77 80 81 82 84 85 86 88 90 91 92 93 94 95 96 97 98 99\n9 18 19 21 22 24 27 31 37 38 40 48 49 53 57 63 64 65 66 68 69 73 78 79 83 87 89",
"output": "1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 2 2 1 2 2 1 2 1 1 2 1 1 1 2 1 1 1 1 1 2 2 1 2 1 1 1 1 1 1 1 2 2 1 1 1 2 1 1 1 2 1 1 1 1 1 2 2 2 2 1 2 2 1 1 1 2 1 1 1 1 2 2 1 1 1 2 1 1 1 2 1 2 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "99 38 61\n1 3 10 15 16 22 23 28 31 34 35 36 37 38 39 43 44 49 50 53 56 60 63 68 69 70 72 74 75 77 80 81 83 85 96 97 98 99\n2 4 5 6 7 8 9 11 12 13 14 17 18 19 20 21 24 25 26 27 29 30 32 33 40 41 42 45 46 47 48 51 52 54 55 57 58 59 61 62 64 65 66 67 71 73 76 78 79 82 84 86 87 88 89 90 91 92 93 94 95",
"output": "1 2 1 2 2 2 2 2 2 1 2 2 2 2 1 1 2 2 2 2 2 1 1 2 2 2 2 1 2 2 1 2 2 1 1 1 1 1 1 2 2 2 1 1 2 2 2 2 1 1 2 2 1 2 2 1 2 2 2 1 2 2 1 2 2 2 2 1 1 1 2 1 2 1 1 2 1 2 2 1 1 2 1 2 1 2 2 2 2 2 2 2 2 2 2 1 1 1 1"
},
{
"input": "99 84 15\n1 2 3 5 6 7 8 9 10 11 12 13 14 15 16 17 19 20 21 22 23 24 25 26 27 28 29 30 31 32 34 35 36 37 38 39 40 41 42 43 44 47 48 50 51 52 53 55 56 58 59 60 61 62 63 64 65 68 69 70 71 72 73 74 75 77 79 80 81 82 83 84 85 86 87 89 90 91 92 93 94 97 98 99\n4 18 33 45 46 49 54 57 66 67 76 78 88 95 96",
"output": "1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 2 2 1 1 2 1 1 1 1 2 1 1 2 1 1 1 1 1 1 1 1 2 2 1 1 1 1 1 1 1 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 2 2 1 1 1"
},
{
"input": "4 3 1\n1 3 4\n2",
"output": "1 2 1 1"
},
{
"input": "4 3 1\n1 2 4\n3",
"output": "1 1 2 1"
},
{
"input": "4 2 2\n2 3\n1 4",
"output": "2 1 1 2"
},
{
"input": "4 3 1\n2 3 4\n1",
"output": "2 1 1 1"
},
{
"input": "1 1 1\n1\n1",
"output": "1"
},
{
"input": "2 1 1\n2\n1",
"output": "2 1"
},
{
"input": "2 1 1\n1\n2",
"output": "1 2"
},
{
"input": "3 3 1\n1 2 3\n1",
"output": "1 1 1"
},
{
"input": "3 3 1\n1 2 3\n3",
"output": "1 1 1"
},
{
"input": "3 2 1\n1 3\n2",
"output": "1 2 1"
},
{
"input": "100 1 100\n84\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2"
},
{
"input": "100 100 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100\n17",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "98 51 47\n1 2 3 4 6 7 8 10 13 15 16 18 19 21 22 23 25 26 27 29 31 32 36 37 39 40 41 43 44 48 49 50 51 52 54 56 58 59 65 66 68 79 80 84 86 88 89 90 94 95 97\n5 9 11 12 14 17 20 24 28 30 33 34 35 38 42 45 46 47 53 55 57 60 61 62 63 64 67 69 70 71 72 73 74 75 76 77 78 81 82 83 85 87 91 92 93 96 98",
"output": "1 1 1 1 2 1 1 1 2 1 2 2 1 2 1 1 2 1 1 2 1 1 1 2 1 1 1 2 1 2 1 1 2 2 2 1 1 2 1 1 1 2 1 1 2 2 2 1 1 1 1 1 2 1 2 1 2 1 1 2 2 2 2 2 1 1 2 1 2 2 2 2 2 2 2 2 2 2 1 1 2 2 2 1 2 1 2 1 1 1 2 2 2 1 1 2 1 2"
},
{
"input": "98 28 70\n1 13 15 16 19 27 28 40 42 43 46 53 54 57 61 63 67 68 69 71 75 76 78 80 88 93 97 98\n2 3 4 5 6 7 8 9 10 11 12 14 17 18 20 21 22 23 24 25 26 29 30 31 32 33 34 35 36 37 38 39 41 44 45 47 48 49 50 51 52 55 56 58 59 60 62 64 65 66 70 72 73 74 77 79 81 82 83 84 85 86 87 89 90 91 92 94 95 96",
"output": "1 2 2 2 2 2 2 2 2 2 2 2 1 2 1 1 2 2 1 2 2 2 2 2 2 2 1 1 2 2 2 2 2 2 2 2 2 2 2 1 2 1 1 2 2 1 2 2 2 2 2 2 1 1 2 2 1 2 2 2 1 2 1 2 2 2 1 1 1 2 1 2 2 2 1 1 2 1 2 1 2 2 2 2 2 2 2 1 2 2 2 2 1 2 2 2 1 1"
},
{
"input": "97 21 76\n7 10 16 17 26 30 34 39 40 42 44 46 53 54 56 64 67 72 78 79 94\n1 2 3 4 5 6 8 9 11 12 13 14 15 18 19 20 21 22 23 24 25 27 28 29 31 32 33 35 36 37 38 41 43 45 47 48 49 50 51 52 55 57 58 59 60 61 62 63 65 66 68 69 70 71 73 74 75 76 77 80 81 82 83 84 85 86 87 88 89 90 91 92 93 95 96 97",
"output": "2 2 2 2 2 2 1 2 2 1 2 2 2 2 2 1 1 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 1 2 2 2 2 1 1 2 1 2 1 2 1 2 2 2 2 2 2 1 1 2 1 2 2 2 2 2 2 2 1 2 2 1 2 2 2 2 1 2 2 2 2 2 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2"
},
{
"input": "97 21 76\n1 10 12 13 17 18 22 25 31 48 50 54 61 64 67 74 78 81 86 88 94\n2 3 4 5 6 7 8 9 11 14 15 16 19 20 21 23 24 26 27 28 29 30 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 49 51 52 53 55 56 57 58 59 60 62 63 65 66 68 69 70 71 72 73 75 76 77 79 80 82 83 84 85 87 89 90 91 92 93 95 96 97",
"output": "1 2 2 2 2 2 2 2 2 1 2 1 1 2 2 2 1 1 2 2 2 1 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 1 2 2 1 2 2 1 2 2 2 2 2 2 1 2 2 2 1 2 2 1 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2"
},
{
"input": "96 10 86\n2 5 31 37 68 69 80 82 90 91\n1 3 4 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 32 33 34 35 36 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 70 71 72 73 74 75 76 77 78 79 81 83 84 85 86 87 88 89 92 93 94 95 96",
"output": "2 1 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 2 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 1 1 2 2 2 2 2"
},
{
"input": "95 4 91\n58 65 70 93\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 59 60 61 62 63 64 66 67 68 69 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 94 95",
"output": "2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 1 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2"
},
{
"input": "98 88 10\n1 2 4 5 6 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 33 34 35 36 38 39 40 41 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 62 63 64 65 66 67 68 69 71 72 73 74 75 76 77 79 80 81 83 84 85 86 87 88 89 90 92 93 94 95 96 97 98\n3 7 32 37 42 61 70 78 82 91",
"output": "1 1 2 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 2 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 2 1 1 1 2 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1"
},
{
"input": "98 96 2\n1 2 3 4 5 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98\n6 7",
"output": "1 1 1 1 1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "97 97 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97\n94",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "97 97 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97\n20",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "96 96 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96\n48",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "95 95 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95\n55",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
}
] | 1,683,517,294
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 46
| 0
|
n,a,b=map(int,input().split())
alikes=list(map(int,input().split()))
blikes=list(map(int,input().split()))
s=""
for i in range(1,n+1):
if (i in alikes):
s+="1 "
else:
s+="2 "
print(s.strip())
|
Title: Pasha and Hamsters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pasha has two hamsters: Arthur and Alexander. Pasha put *n* apples in front of them. Pasha knows which apples Arthur likes. Similarly, Pasha knows which apples Alexander likes. Pasha doesn't want any conflict between the hamsters (as they may like the same apple), so he decided to distribute the apples between the hamsters on his own. He is going to give some apples to Arthur and some apples to Alexander. It doesn't matter how many apples each hamster gets but it is important that each hamster gets only the apples he likes. It is possible that somebody doesn't get any apples.
Help Pasha distribute all the apples between the hamsters. Note that Pasha wants to distribute all the apples, not just some of them.
Input Specification:
The first line contains integers *n*, *a*, *b* (1<=≤<=*n*<=≤<=100; 1<=≤<=*a*,<=*b*<=≤<=*n*) — the number of apples Pasha has, the number of apples Arthur likes and the number of apples Alexander likes, correspondingly.
The next line contains *a* distinct integers — the numbers of the apples Arthur likes. The next line contains *b* distinct integers — the numbers of the apples Alexander likes.
Assume that the apples are numbered from 1 to *n*. The input is such that the answer exists.
Output Specification:
Print *n* characters, each of them equals either 1 or 2. If the *i*-h character equals 1, then the *i*-th apple should be given to Arthur, otherwise it should be given to Alexander. If there are multiple correct answers, you are allowed to print any of them.
Demo Input:
['4 2 3\n1 2\n2 3 4\n', '5 5 2\n3 4 1 2 5\n2 3\n']
Demo Output:
['1 1 2 2\n', '1 1 1 1 1\n']
Note:
none
|
```python
n,a,b=map(int,input().split())
alikes=list(map(int,input().split()))
blikes=list(map(int,input().split()))
s=""
for i in range(1,n+1):
if (i in alikes):
s+="1 "
else:
s+="2 "
print(s.strip())
```
| 3
|
|
270
|
A
|
Fancy Fence
|
PROGRAMMING
| 1,100
|
[
"geometry",
"implementation",
"math"
] | null | null |
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
|
The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees.
|
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
|
[
"3\n30\n60\n90\n"
] |
[
"NO\nYES\nYES\n"
] |
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square.
| 500
|
[
{
"input": "3\n30\n60\n90",
"output": "NO\nYES\nYES"
},
{
"input": "6\n1\n2\n3\n170\n179\n25",
"output": "NO\nNO\nNO\nYES\nYES\nNO"
}
] | 1,669,369,569
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 3
| 124
| 0
|
def solve():
a = int(input())
return 360 % (180 - a) == 0 and 360 // (180 - a) >= 3
for _ in range(int(input())):
print("YES" if solve() else "NO")
|
Title: Fancy Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
Input Specification:
The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees.
Output Specification:
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
Demo Input:
['3\n30\n60\n90\n']
Demo Output:
['NO\nYES\nYES\n']
Note:
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square.
|
```python
def solve():
a = int(input())
return 360 % (180 - a) == 0 and 360 // (180 - a) >= 3
for _ in range(int(input())):
print("YES" if solve() else "NO")
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,658,388,847
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 92
| 0
|
x = input()
l = 0
u = 0
for i in x:
if i.islower():
l += 1
elif i.isupper():
u += 1
else:
continue
if l > u:
print(x.lower())
elif l < u:
print(x.upper())
else:
print(x.lower())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
x = input()
l = 0
u = 0
for i in x:
if i.islower():
l += 1
elif i.isupper():
u += 1
else:
continue
if l > u:
print(x.lower())
elif l < u:
print(x.upper())
else:
print(x.lower())
```
| 3.977
|
916
|
A
|
Jamie and Alarm Snooze
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"math"
] | null | null |
Jamie loves sleeping. One day, he decides that he needs to wake up at exactly *hh*:<=*mm*. However, he hates waking up, so he wants to make waking up less painful by setting the alarm at a lucky time. He will then press the snooze button every *x* minutes until *hh*:<=*mm* is reached, and only then he will wake up. He wants to know what is the smallest number of times he needs to press the snooze button.
A time is considered lucky if it contains a digit '7'. For example, 13:<=07 and 17:<=27 are lucky, while 00:<=48 and 21:<=34 are not lucky.
Note that it is not necessary that the time set for the alarm and the wake-up time are on the same day. It is guaranteed that there is a lucky time Jamie can set so that he can wake at *hh*:<=*mm*.
Formally, find the smallest possible non-negative integer *y* such that the time representation of the time *x*·*y* minutes before *hh*:<=*mm* contains the digit '7'.
Jamie uses 24-hours clock, so after 23:<=59 comes 00:<=00.
|
The first line contains a single integer *x* (1<=≤<=*x*<=≤<=60).
The second line contains two two-digit integers, *hh* and *mm* (00<=≤<=*hh*<=≤<=23,<=00<=≤<=*mm*<=≤<=59).
|
Print the minimum number of times he needs to press the button.
|
[
"3\n11 23\n",
"5\n01 07\n"
] |
[
"2\n",
"0\n"
] |
In the first sample, Jamie needs to wake up at 11:23. So, he can set his alarm at 11:17. He would press the snooze button when the alarm rings at 11:17 and at 11:20.
In the second sample, Jamie can set his alarm at exactly at 01:07 which is lucky.
| 500
|
[
{
"input": "3\n11 23",
"output": "2"
},
{
"input": "5\n01 07",
"output": "0"
},
{
"input": "34\n09 24",
"output": "3"
},
{
"input": "2\n14 37",
"output": "0"
},
{
"input": "14\n19 54",
"output": "9"
},
{
"input": "42\n15 44",
"output": "12"
},
{
"input": "46\n02 43",
"output": "1"
},
{
"input": "14\n06 41",
"output": "1"
},
{
"input": "26\n04 58",
"output": "26"
},
{
"input": "54\n16 47",
"output": "0"
},
{
"input": "38\n20 01",
"output": "3"
},
{
"input": "11\n02 05",
"output": "8"
},
{
"input": "55\n22 10",
"output": "5"
},
{
"input": "23\n10 08",
"output": "6"
},
{
"input": "23\n23 14",
"output": "9"
},
{
"input": "51\n03 27",
"output": "0"
},
{
"input": "35\n15 25",
"output": "13"
},
{
"input": "3\n12 15",
"output": "6"
},
{
"input": "47\n00 28",
"output": "3"
},
{
"input": "31\n13 34",
"output": "7"
},
{
"input": "59\n17 32",
"output": "0"
},
{
"input": "25\n11 03",
"output": "8"
},
{
"input": "9\n16 53",
"output": "4"
},
{
"input": "53\n04 06",
"output": "3"
},
{
"input": "37\n00 12",
"output": "5"
},
{
"input": "5\n13 10",
"output": "63"
},
{
"input": "50\n01 59",
"output": "10"
},
{
"input": "34\n06 13",
"output": "4"
},
{
"input": "2\n18 19",
"output": "1"
},
{
"input": "46\n06 16",
"output": "17"
},
{
"input": "14\n03 30",
"output": "41"
},
{
"input": "40\n13 37",
"output": "0"
},
{
"input": "24\n17 51",
"output": "0"
},
{
"input": "8\n14 57",
"output": "0"
},
{
"input": "52\n18 54",
"output": "2"
},
{
"input": "20\n15 52",
"output": "24"
},
{
"input": "20\n03 58",
"output": "30"
},
{
"input": "48\n07 11",
"output": "0"
},
{
"input": "32\n04 01",
"output": "2"
},
{
"input": "60\n08 15",
"output": "1"
},
{
"input": "44\n20 20",
"output": "4"
},
{
"input": "55\n15 35",
"output": "9"
},
{
"input": "55\n03 49",
"output": "11"
},
{
"input": "23\n16 39",
"output": "4"
},
{
"input": "7\n20 36",
"output": "7"
},
{
"input": "35\n16 42",
"output": "1"
},
{
"input": "35\n05 56",
"output": "21"
},
{
"input": "3\n17 45",
"output": "0"
},
{
"input": "47\n05 59",
"output": "6"
},
{
"input": "15\n10 13",
"output": "9"
},
{
"input": "59\n06 18",
"output": "9"
},
{
"input": "34\n17 18",
"output": "0"
},
{
"input": "18\n05 23",
"output": "2"
},
{
"input": "46\n17 21",
"output": "0"
},
{
"input": "30\n06 27",
"output": "0"
},
{
"input": "14\n18 40",
"output": "3"
},
{
"input": "58\n22 54",
"output": "6"
},
{
"input": "26\n19 44",
"output": "5"
},
{
"input": "10\n15 57",
"output": "0"
},
{
"input": "54\n20 47",
"output": "0"
},
{
"input": "22\n08 45",
"output": "3"
},
{
"input": "48\n18 08",
"output": "1"
},
{
"input": "32\n07 06",
"output": "0"
},
{
"input": "60\n19 19",
"output": "2"
},
{
"input": "45\n07 25",
"output": "0"
},
{
"input": "29\n12 39",
"output": "8"
},
{
"input": "13\n08 28",
"output": "3"
},
{
"input": "41\n21 42",
"output": "5"
},
{
"input": "41\n09 32",
"output": "3"
},
{
"input": "9\n21 45",
"output": "2"
},
{
"input": "37\n10 43",
"output": "5"
},
{
"input": "3\n20 50",
"output": "1"
},
{
"input": "47\n00 04",
"output": "1"
},
{
"input": "15\n13 10",
"output": "21"
},
{
"input": "15\n17 23",
"output": "0"
},
{
"input": "43\n22 13",
"output": "2"
},
{
"input": "27\n10 26",
"output": "6"
},
{
"input": "55\n22 24",
"output": "5"
},
{
"input": "55\n03 30",
"output": "11"
},
{
"input": "24\n23 27",
"output": "0"
},
{
"input": "52\n11 33",
"output": "3"
},
{
"input": "18\n22 48",
"output": "17"
},
{
"input": "1\n12 55",
"output": "8"
},
{
"input": "1\n04 27",
"output": "0"
},
{
"input": "1\n12 52",
"output": "5"
},
{
"input": "1\n20 16",
"output": "9"
},
{
"input": "1\n04 41",
"output": "4"
},
{
"input": "1\n20 21",
"output": "4"
},
{
"input": "1\n04 45",
"output": "8"
},
{
"input": "1\n12 18",
"output": "1"
},
{
"input": "1\n04 42",
"output": "5"
},
{
"input": "1\n02 59",
"output": "2"
},
{
"input": "1\n18 24",
"output": "7"
},
{
"input": "1\n02 04",
"output": "7"
},
{
"input": "1\n18 28",
"output": "1"
},
{
"input": "1\n18 01",
"output": "2"
},
{
"input": "1\n10 25",
"output": "8"
},
{
"input": "1\n02 49",
"output": "2"
},
{
"input": "1\n02 30",
"output": "3"
},
{
"input": "1\n18 54",
"output": "7"
},
{
"input": "1\n02 19",
"output": "2"
},
{
"input": "1\n05 25",
"output": "8"
},
{
"input": "60\n23 55",
"output": "6"
},
{
"input": "60\n08 19",
"output": "1"
},
{
"input": "60\n00 00",
"output": "7"
},
{
"input": "60\n08 24",
"output": "1"
},
{
"input": "60\n16 13",
"output": "9"
},
{
"input": "60\n08 21",
"output": "1"
},
{
"input": "60\n16 45",
"output": "9"
},
{
"input": "60\n08 26",
"output": "1"
},
{
"input": "60\n08 50",
"output": "1"
},
{
"input": "60\n05 21",
"output": "12"
},
{
"input": "60\n13 29",
"output": "6"
},
{
"input": "60\n05 18",
"output": "12"
},
{
"input": "60\n13 42",
"output": "6"
},
{
"input": "60\n05 07",
"output": "0"
},
{
"input": "60\n05 47",
"output": "0"
},
{
"input": "60\n21 55",
"output": "4"
},
{
"input": "60\n05 36",
"output": "12"
},
{
"input": "60\n21 08",
"output": "4"
},
{
"input": "60\n21 32",
"output": "4"
},
{
"input": "60\n16 31",
"output": "9"
},
{
"input": "5\n00 00",
"output": "73"
},
{
"input": "2\n06 58",
"output": "390"
},
{
"input": "60\n00 00",
"output": "7"
},
{
"input": "2\n00 00",
"output": "181"
},
{
"input": "10\n00 00",
"output": "37"
},
{
"input": "60\n01 00",
"output": "8"
},
{
"input": "12\n00 06",
"output": "31"
},
{
"input": "1\n00 01",
"output": "4"
},
{
"input": "5\n00 05",
"output": "74"
},
{
"input": "60\n01 01",
"output": "8"
},
{
"input": "11\n18 11",
"output": "2"
},
{
"input": "60\n01 15",
"output": "8"
},
{
"input": "10\n00 16",
"output": "38"
},
{
"input": "60\n00 59",
"output": "7"
},
{
"input": "30\n00 00",
"output": "13"
},
{
"input": "60\n01 05",
"output": "8"
},
{
"input": "4\n00 03",
"output": "4"
},
{
"input": "4\n00 00",
"output": "91"
},
{
"input": "60\n00 01",
"output": "7"
},
{
"input": "6\n00 03",
"output": "1"
},
{
"input": "13\n00 00",
"output": "1"
},
{
"input": "1\n18 01",
"output": "2"
},
{
"input": "5\n06 00",
"output": "145"
},
{
"input": "60\n04 08",
"output": "11"
},
{
"input": "5\n01 55",
"output": "96"
},
{
"input": "8\n00 08",
"output": "47"
},
{
"input": "23\n18 23",
"output": "2"
},
{
"input": "6\n00 06",
"output": "62"
},
{
"input": "59\n18 59",
"output": "2"
},
{
"input": "11\n00 10",
"output": "3"
},
{
"input": "10\n00 01",
"output": "37"
},
{
"input": "59\n00 00",
"output": "7"
},
{
"input": "10\n18 10",
"output": "2"
},
{
"input": "5\n00 01",
"output": "73"
},
{
"input": "1\n00 00",
"output": "3"
},
{
"input": "8\n00 14",
"output": "47"
},
{
"input": "60\n03 00",
"output": "10"
},
{
"input": "60\n00 10",
"output": "7"
},
{
"input": "5\n01 13",
"output": "87"
},
{
"input": "30\n02 43",
"output": "18"
},
{
"input": "17\n00 08",
"output": "3"
},
{
"input": "3\n00 00",
"output": "1"
},
{
"input": "60\n00 05",
"output": "7"
},
{
"input": "5\n18 05",
"output": "2"
},
{
"input": "30\n00 30",
"output": "14"
},
{
"input": "1\n00 06",
"output": "9"
},
{
"input": "55\n00 00",
"output": "7"
},
{
"input": "8\n02 08",
"output": "62"
},
{
"input": "7\n00 00",
"output": "9"
},
{
"input": "6\n08 06",
"output": "2"
},
{
"input": "48\n06 24",
"output": "16"
},
{
"input": "8\n06 58",
"output": "98"
},
{
"input": "3\n12 00",
"output": "1"
},
{
"input": "5\n01 06",
"output": "86"
},
{
"input": "2\n00 08",
"output": "185"
},
{
"input": "3\n18 03",
"output": "2"
},
{
"input": "1\n17 00",
"output": "0"
},
{
"input": "59\n00 48",
"output": "7"
},
{
"input": "5\n12 01",
"output": "49"
},
{
"input": "55\n01 25",
"output": "9"
},
{
"input": "2\n07 23",
"output": "0"
},
{
"input": "10\n01 10",
"output": "44"
},
{
"input": "2\n00 01",
"output": "2"
},
{
"input": "59\n00 01",
"output": "6"
},
{
"input": "5\n00 02",
"output": "1"
},
{
"input": "4\n01 02",
"output": "106"
},
{
"input": "5\n00 06",
"output": "74"
},
{
"input": "42\n00 08",
"output": "9"
},
{
"input": "60\n01 20",
"output": "8"
},
{
"input": "3\n06 00",
"output": "1"
},
{
"input": "4\n00 01",
"output": "1"
},
{
"input": "2\n00 06",
"output": "184"
},
{
"input": "1\n00 57",
"output": "0"
},
{
"input": "6\n00 00",
"output": "61"
},
{
"input": "5\n08 40",
"output": "9"
},
{
"input": "58\n00 55",
"output": "1"
},
{
"input": "2\n00 02",
"output": "182"
},
{
"input": "1\n08 01",
"output": "2"
},
{
"input": "10\n10 10",
"output": "14"
},
{
"input": "60\n01 11",
"output": "8"
},
{
"input": "2\n07 00",
"output": "0"
},
{
"input": "15\n00 03",
"output": "25"
},
{
"input": "6\n04 34",
"output": "106"
},
{
"input": "16\n00 16",
"output": "24"
},
{
"input": "2\n00 59",
"output": "1"
},
{
"input": "59\n00 08",
"output": "7"
},
{
"input": "10\n03 10",
"output": "56"
},
{
"input": "3\n08 03",
"output": "2"
},
{
"input": "20\n06 11",
"output": "37"
},
{
"input": "4\n01 00",
"output": "106"
},
{
"input": "38\n01 08",
"output": "12"
},
{
"input": "60\n00 06",
"output": "7"
},
{
"input": "5\n12 00",
"output": "49"
},
{
"input": "6\n01 42",
"output": "78"
},
{
"input": "4\n00 04",
"output": "92"
},
{
"input": "60\n04 05",
"output": "11"
},
{
"input": "1\n00 53",
"output": "6"
},
{
"input": "5\n08 05",
"output": "2"
},
{
"input": "60\n18 45",
"output": "1"
},
{
"input": "60\n06 23",
"output": "13"
},
{
"input": "6\n00 15",
"output": "3"
},
{
"input": "58\n00 06",
"output": "7"
},
{
"input": "2\n06 44",
"output": "383"
},
{
"input": "1\n08 00",
"output": "1"
},
{
"input": "10\n06 58",
"output": "78"
},
{
"input": "59\n00 58",
"output": "8"
},
{
"input": "1\n18 00",
"output": "1"
},
{
"input": "50\n00 42",
"output": "9"
},
{
"input": "30\n18 30",
"output": "2"
},
{
"input": "60\n21 59",
"output": "4"
},
{
"input": "2\n10 52",
"output": "87"
},
{
"input": "56\n00 00",
"output": "7"
},
{
"input": "16\n18 16",
"output": "2"
},
{
"input": "5\n01 05",
"output": "86"
},
{
"input": "5\n05 00",
"output": "133"
},
{
"input": "5\n23 59",
"output": "72"
},
{
"input": "7\n17 13",
"output": "0"
},
{
"input": "58\n00 00",
"output": "7"
},
{
"input": "15\n00 07",
"output": "0"
},
{
"input": "59\n08 00",
"output": "1"
},
{
"input": "46\n00 00",
"output": "8"
},
{
"input": "59\n01 05",
"output": "2"
},
{
"input": "2\n01 00",
"output": "211"
},
{
"input": "60\n00 24",
"output": "7"
},
{
"input": "10\n00 08",
"output": "37"
},
{
"input": "10\n00 06",
"output": "37"
},
{
"input": "60\n01 24",
"output": "8"
},
{
"input": "50\n00 10",
"output": "8"
},
{
"input": "2\n03 00",
"output": "271"
},
{
"input": "4\n19 04",
"output": "17"
},
{
"input": "25\n00 23",
"output": "16"
},
{
"input": "10\n01 01",
"output": "43"
}
] | 1,516,376,085
| 3,585
|
Python 3
|
OK
|
TESTS
| 254
| 77
| 5,632,000
|
def counting(hour,minu,inc):
count=0
h=hour
m=minu
x=inc
flag=1
while(flag):
if '7' in str(m) or '7' in str(h):
print(count)
flag=0
else:
if (m-x)<0:
temp=m-x
tem=60+temp
m=tem
if(h-1)<0:
h=23
else:
h-=1
count+=1
else:
m-=x
count+=1
x=int(input().strip())
h,m=[int(t) for t in input().strip().split(' ')]
counting(h,m,x)
|
Title: Jamie and Alarm Snooze
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Jamie loves sleeping. One day, he decides that he needs to wake up at exactly *hh*:<=*mm*. However, he hates waking up, so he wants to make waking up less painful by setting the alarm at a lucky time. He will then press the snooze button every *x* minutes until *hh*:<=*mm* is reached, and only then he will wake up. He wants to know what is the smallest number of times he needs to press the snooze button.
A time is considered lucky if it contains a digit '7'. For example, 13:<=07 and 17:<=27 are lucky, while 00:<=48 and 21:<=34 are not lucky.
Note that it is not necessary that the time set for the alarm and the wake-up time are on the same day. It is guaranteed that there is a lucky time Jamie can set so that he can wake at *hh*:<=*mm*.
Formally, find the smallest possible non-negative integer *y* such that the time representation of the time *x*·*y* minutes before *hh*:<=*mm* contains the digit '7'.
Jamie uses 24-hours clock, so after 23:<=59 comes 00:<=00.
Input Specification:
The first line contains a single integer *x* (1<=≤<=*x*<=≤<=60).
The second line contains two two-digit integers, *hh* and *mm* (00<=≤<=*hh*<=≤<=23,<=00<=≤<=*mm*<=≤<=59).
Output Specification:
Print the minimum number of times he needs to press the button.
Demo Input:
['3\n11 23\n', '5\n01 07\n']
Demo Output:
['2\n', '0\n']
Note:
In the first sample, Jamie needs to wake up at 11:23. So, he can set his alarm at 11:17. He would press the snooze button when the alarm rings at 11:17 and at 11:20.
In the second sample, Jamie can set his alarm at exactly at 01:07 which is lucky.
|
```python
def counting(hour,minu,inc):
count=0
h=hour
m=minu
x=inc
flag=1
while(flag):
if '7' in str(m) or '7' in str(h):
print(count)
flag=0
else:
if (m-x)<0:
temp=m-x
tem=60+temp
m=tem
if(h-1)<0:
h=23
else:
h-=1
count+=1
else:
m-=x
count+=1
x=int(input().strip())
h,m=[int(t) for t in input().strip().split(' ')]
counting(h,m,x)
```
| 3
|
|
378
|
A
|
Playing with Dice
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw.
The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
|
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
|
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
|
[
"2 5\n",
"2 4\n"
] |
[
"3 0 3\n",
"2 1 3\n"
] |
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct.
You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| < |*b* - *x*|.
| 500
|
[
{
"input": "2 5",
"output": "3 0 3"
},
{
"input": "2 4",
"output": "2 1 3"
},
{
"input": "5 3",
"output": "2 1 3"
},
{
"input": "1 6",
"output": "3 0 3"
},
{
"input": "5 1",
"output": "3 1 2"
},
{
"input": "6 3",
"output": "2 0 4"
},
{
"input": "2 3",
"output": "2 0 4"
},
{
"input": "5 6",
"output": "5 0 1"
},
{
"input": "4 4",
"output": "0 6 0"
},
{
"input": "1 1",
"output": "0 6 0"
},
{
"input": "6 4",
"output": "1 1 4"
},
{
"input": "1 4",
"output": "2 0 4"
},
{
"input": "5 5",
"output": "0 6 0"
},
{
"input": "4 5",
"output": "4 0 2"
},
{
"input": "4 3",
"output": "3 0 3"
},
{
"input": "1 5",
"output": "2 1 3"
},
{
"input": "6 5",
"output": "1 0 5"
},
{
"input": "2 2",
"output": "0 6 0"
},
{
"input": "1 3",
"output": "1 1 4"
},
{
"input": "3 6",
"output": "4 0 2"
},
{
"input": "3 1",
"output": "4 1 1"
},
{
"input": "3 2",
"output": "4 0 2"
},
{
"input": "3 5",
"output": "3 1 2"
},
{
"input": "3 3",
"output": "0 6 0"
},
{
"input": "6 2",
"output": "2 1 3"
},
{
"input": "4 1",
"output": "4 0 2"
},
{
"input": "5 2",
"output": "3 0 3"
},
{
"input": "4 2",
"output": "3 1 2"
},
{
"input": "2 1",
"output": "5 0 1"
},
{
"input": "6 1",
"output": "3 0 3"
},
{
"input": "4 6",
"output": "4 1 1"
},
{
"input": "2 6",
"output": "3 1 2"
},
{
"input": "3 4",
"output": "3 0 3"
},
{
"input": "1 2",
"output": "1 0 5"
},
{
"input": "6 6",
"output": "0 6 0"
},
{
"input": "5 4",
"output": "2 0 4"
},
{
"input": "3 3",
"output": "0 6 0"
},
{
"input": "1 1",
"output": "0 6 0"
}
] | 1,567,808,031
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 38
| 140
| 102,400
|
input_ = [int(i) for i in input().split()]
player_1 = input_[0]
player_2 = input_[1]
player_1_win = 0
player_2_win = 0
tie = 0
for i in range(1,7):
if abs(i - player_1) < abs(i - player_2):
player_1_win += 1
elif abs(i - player_1) > abs(i - player_2):
player_2_win += 1
else:
tie += 1
print(player_1_win, tie, player_2_win)
|
Title: Playing with Dice
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw.
The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
Input Specification:
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
Output Specification:
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
Demo Input:
['2 5\n', '2 4\n']
Demo Output:
['3 0 3\n', '2 1 3\n']
Note:
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct.
You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| < |*b* - *x*|.
|
```python
input_ = [int(i) for i in input().split()]
player_1 = input_[0]
player_2 = input_[1]
player_1_win = 0
player_2_win = 0
tie = 0
for i in range(1,7):
if abs(i - player_1) < abs(i - player_2):
player_1_win += 1
elif abs(i - player_1) > abs(i - player_2):
player_2_win += 1
else:
tie += 1
print(player_1_win, tie, player_2_win)
```
| 3
|
|
884
|
C
|
Bertown Subway
|
PROGRAMMING
| 1,500
|
[
"dfs and similar",
"greedy",
"math"
] | null | null |
The construction of subway in Bertown is almost finished! The President of Berland will visit this city soon to look at the new subway himself.
There are *n* stations in the subway. It was built according to the Bertown Transport Law:
1. For each station *i* there exists exactly one train that goes from this station. Its destination station is *p**i*, possibly *p**i*<==<=*i*; 1. For each station *i* there exists exactly one station *j* such that *p**j*<==<=*i*.
The President will consider the convenience of subway after visiting it. The convenience is the number of ordered pairs (*x*,<=*y*) such that person can start at station *x* and, after taking some subway trains (possibly zero), arrive at station *y* (1<=≤<=*x*,<=*y*<=≤<=*n*).
The mayor of Bertown thinks that if the subway is not convenient enough, then the President might consider installing a new mayor (and, of course, the current mayor doesn't want it to happen). Before President visits the city mayor has enough time to rebuild some paths of subway, thus changing the values of *p**i* for not more than two subway stations. Of course, breaking the Bertown Transport Law is really bad, so the subway must be built according to the Law even after changes.
The mayor wants to do these changes in such a way that the convenience of the subway is maximized. Help him to calculate the maximum possible convenience he can get!
|
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=100000) — the number of stations.
The second line contains *n* integer numbers *p*1, *p*2, ..., *p**n* (1<=≤<=*p**i*<=≤<=*n*) — the current structure of the subway. All these numbers are distinct.
|
Print one number — the maximum possible value of convenience.
|
[
"3\n2 1 3\n",
"5\n1 5 4 3 2\n"
] |
[
"9\n",
"17\n"
] |
In the first example the mayor can change *p*<sub class="lower-index">2</sub> to 3 and *p*<sub class="lower-index">3</sub> to 1, so there will be 9 pairs: (1, 1), (1, 2), (1, 3), (2, 1), (2, 2), (2, 3), (3, 1), (3, 2), (3, 3).
In the second example the mayor can change *p*<sub class="lower-index">2</sub> to 4 and *p*<sub class="lower-index">3</sub> to 5.
| 0
|
[
{
"input": "3\n2 1 3",
"output": "9"
},
{
"input": "5\n1 5 4 3 2",
"output": "17"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n1 2",
"output": "4"
},
{
"input": "2\n2 1",
"output": "4"
},
{
"input": "100\n98 52 63 2 18 96 31 58 84 40 41 45 66 100 46 71 26 48 81 20 73 91 68 76 13 93 17 29 64 95 79 21 55 75 19 85 54 51 89 78 15 87 43 59 36 1 90 35 65 56 62 28 86 5 82 49 3 99 33 9 92 32 74 69 27 22 77 16 44 94 34 6 57 70 23 12 61 25 8 11 67 47 83 88 10 14 30 7 97 60 42 37 24 38 53 50 4 80 72 39",
"output": "5416"
},
{
"input": "5\n1 4 2 3 5",
"output": "17"
},
{
"input": "6\n5 3 6 1 4 2",
"output": "36"
},
{
"input": "10\n5 1 6 2 8 3 4 10 9 7",
"output": "82"
},
{
"input": "20\n1 6 15 9 18 17 7 8 3 19 2 13 11 12 14 4 5 20 16 10",
"output": "326"
},
{
"input": "3\n1 2 3",
"output": "5"
}
] | 1,509,116,511
| 3,411
|
Python 3
|
OK
|
TESTS
| 27
| 982
| 21,401,600
|
n = int(input())
data = list(map(int,input().split()))
gp = { i:i for i in range(n) }
sets = { i:[i] for i in range(n) }
for i in range(n):
u,v = i,data[i]-1
if gp[u]!= gp[v]:
temp=gp[v]
for i in sets[gp[v]]:
gp[i]=gp[u]
sets[gp[u]].append(i)
del sets[temp]
l=[]
for i in sets:
l.append(len(sets[i]))
l.sort(reverse=True)
n=len(l)
if n==1:
print(l[0]*l[0])
else:
ans=(l[0]+l[1])**2
for i in range(2,n):
ans+=l[i]**2
print(ans)
|
Title: Bertown Subway
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The construction of subway in Bertown is almost finished! The President of Berland will visit this city soon to look at the new subway himself.
There are *n* stations in the subway. It was built according to the Bertown Transport Law:
1. For each station *i* there exists exactly one train that goes from this station. Its destination station is *p**i*, possibly *p**i*<==<=*i*; 1. For each station *i* there exists exactly one station *j* such that *p**j*<==<=*i*.
The President will consider the convenience of subway after visiting it. The convenience is the number of ordered pairs (*x*,<=*y*) such that person can start at station *x* and, after taking some subway trains (possibly zero), arrive at station *y* (1<=≤<=*x*,<=*y*<=≤<=*n*).
The mayor of Bertown thinks that if the subway is not convenient enough, then the President might consider installing a new mayor (and, of course, the current mayor doesn't want it to happen). Before President visits the city mayor has enough time to rebuild some paths of subway, thus changing the values of *p**i* for not more than two subway stations. Of course, breaking the Bertown Transport Law is really bad, so the subway must be built according to the Law even after changes.
The mayor wants to do these changes in such a way that the convenience of the subway is maximized. Help him to calculate the maximum possible convenience he can get!
Input Specification:
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=100000) — the number of stations.
The second line contains *n* integer numbers *p*1, *p*2, ..., *p**n* (1<=≤<=*p**i*<=≤<=*n*) — the current structure of the subway. All these numbers are distinct.
Output Specification:
Print one number — the maximum possible value of convenience.
Demo Input:
['3\n2 1 3\n', '5\n1 5 4 3 2\n']
Demo Output:
['9\n', '17\n']
Note:
In the first example the mayor can change *p*<sub class="lower-index">2</sub> to 3 and *p*<sub class="lower-index">3</sub> to 1, so there will be 9 pairs: (1, 1), (1, 2), (1, 3), (2, 1), (2, 2), (2, 3), (3, 1), (3, 2), (3, 3).
In the second example the mayor can change *p*<sub class="lower-index">2</sub> to 4 and *p*<sub class="lower-index">3</sub> to 5.
|
```python
n = int(input())
data = list(map(int,input().split()))
gp = { i:i for i in range(n) }
sets = { i:[i] for i in range(n) }
for i in range(n):
u,v = i,data[i]-1
if gp[u]!= gp[v]:
temp=gp[v]
for i in sets[gp[v]]:
gp[i]=gp[u]
sets[gp[u]].append(i)
del sets[temp]
l=[]
for i in sets:
l.append(len(sets[i]))
l.sort(reverse=True)
n=len(l)
if n==1:
print(l[0]*l[0])
else:
ans=(l[0]+l[1])**2
for i in range(2,n):
ans+=l[i]**2
print(ans)
```
| 3
|
|
82
|
A
|
Double Cola
|
PROGRAMMING
| 1,100
|
[
"implementation",
"math"
] |
A. Double Cola
|
1
|
256
|
Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum.
For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny.
Write a program that will print the name of a man who will drink the *n*-th can.
Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon.
|
The input data consist of a single integer *n* (1<=≤<=*n*<=≤<=109).
It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers.
|
Print the single line — the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially.
|
[
"1\n",
"6\n",
"1802\n"
] |
[
"Sheldon\n",
"Sheldon\n",
"Penny\n"
] |
none
| 500
|
[
{
"input": "1",
"output": "Sheldon"
},
{
"input": "6",
"output": "Sheldon"
},
{
"input": "1802",
"output": "Penny"
},
{
"input": "1",
"output": "Sheldon"
},
{
"input": "2",
"output": "Leonard"
},
{
"input": "3",
"output": "Penny"
},
{
"input": "4",
"output": "Rajesh"
},
{
"input": "5",
"output": "Howard"
},
{
"input": "10",
"output": "Penny"
},
{
"input": "534",
"output": "Rajesh"
},
{
"input": "5033",
"output": "Howard"
},
{
"input": "10010",
"output": "Howard"
},
{
"input": "500000000",
"output": "Penny"
},
{
"input": "63",
"output": "Rajesh"
},
{
"input": "841",
"output": "Leonard"
},
{
"input": "3667",
"output": "Penny"
},
{
"input": "38614",
"output": "Howard"
},
{
"input": "282798",
"output": "Rajesh"
},
{
"input": "9266286",
"output": "Rajesh"
},
{
"input": "27385966",
"output": "Leonard"
},
{
"input": "121580142",
"output": "Penny"
},
{
"input": "5",
"output": "Howard"
},
{
"input": "300",
"output": "Howard"
},
{
"input": "1745",
"output": "Leonard"
},
{
"input": "8302",
"output": "Rajesh"
},
{
"input": "184518",
"output": "Sheldon"
},
{
"input": "1154414",
"output": "Rajesh"
},
{
"input": "28643950",
"output": "Leonard"
},
{
"input": "159222638",
"output": "Howard"
},
{
"input": "24",
"output": "Penny"
},
{
"input": "505",
"output": "Penny"
},
{
"input": "4425",
"output": "Rajesh"
},
{
"input": "12079",
"output": "Sheldon"
},
{
"input": "469726",
"output": "Penny"
},
{
"input": "3961838",
"output": "Penny"
},
{
"input": "57710446",
"output": "Leonard"
},
{
"input": "80719470",
"output": "Howard"
},
{
"input": "1000000000",
"output": "Penny"
},
{
"input": "999999999",
"output": "Penny"
},
{
"input": "999999998",
"output": "Penny"
},
{
"input": "5",
"output": "Howard"
}
] | 1,606,491,193
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 41
| 140
| 0
|
import math
for _ in range(1):
s=["Sheldon", "Leonard", "Penny", "Rajesh", "Howard"]
n=int(input())
while(n>5):
n=(n-4)//2
print(s[n-1])
|
Title: Double Cola
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum.
For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny.
Write a program that will print the name of a man who will drink the *n*-th can.
Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon.
Input Specification:
The input data consist of a single integer *n* (1<=≤<=*n*<=≤<=109).
It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers.
Output Specification:
Print the single line — the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially.
Demo Input:
['1\n', '6\n', '1802\n']
Demo Output:
['Sheldon\n', 'Sheldon\n', 'Penny\n']
Note:
none
|
```python
import math
for _ in range(1):
s=["Sheldon", "Leonard", "Penny", "Rajesh", "Howard"]
n=int(input())
while(n>5):
n=(n-4)//2
print(s[n-1])
```
| 3.93
|
621
|
A
|
Wet Shark and Odd and Even
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Today, Wet Shark is given *n* integers. Using any of these integers no more than once, Wet Shark wants to get maximum possible even (divisible by 2) sum. Please, calculate this value for Wet Shark.
Note, that if Wet Shark uses no integers from the *n* integers, the sum is an even integer 0.
|
The first line of the input contains one integer, *n* (1<=≤<=*n*<=≤<=100<=000). The next line contains *n* space separated integers given to Wet Shark. Each of these integers is in range from 1 to 109, inclusive.
|
Print the maximum possible even sum that can be obtained if we use some of the given integers.
|
[
"3\n1 2 3\n",
"5\n999999999 999999999 999999999 999999999 999999999\n"
] |
[
"6",
"3999999996"
] |
In the first sample, we can simply take all three integers for a total sum of 6.
In the second sample Wet Shark should take any four out of five integers 999 999 999.
| 500
|
[
{
"input": "3\n1 2 3",
"output": "6"
},
{
"input": "5\n999999999 999999999 999999999 999999999 999999999",
"output": "3999999996"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "15\n39 52 88 78 46 95 84 98 55 3 68 42 6 18 98",
"output": "870"
},
{
"input": "15\n59 96 34 48 8 72 67 90 15 85 7 90 97 47 25",
"output": "840"
},
{
"input": "15\n87 37 91 29 58 45 51 74 70 71 47 38 91 89 44",
"output": "922"
},
{
"input": "15\n11 81 49 7 11 14 30 67 29 50 90 81 77 18 59",
"output": "674"
},
{
"input": "15\n39 21 95 89 73 90 9 55 85 32 30 21 68 59 82",
"output": "848"
},
{
"input": "15\n59 70 48 54 26 67 84 39 40 18 77 69 70 88 93",
"output": "902"
},
{
"input": "15\n87 22 98 32 88 36 72 31 100 97 17 16 60 22 20",
"output": "798"
},
{
"input": "15\n15 63 51 13 37 9 43 19 55 79 57 60 50 59 31",
"output": "632"
},
{
"input": "1\n4",
"output": "4"
},
{
"input": "2\n1 4",
"output": "4"
},
{
"input": "3\n1 2 4",
"output": "6"
},
{
"input": "2\n9 3",
"output": "12"
},
{
"input": "2\n1000000000 1001",
"output": "1000000000"
},
{
"input": "3\n1 8 4",
"output": "12"
},
{
"input": "3\n7 4 4",
"output": "8"
},
{
"input": "5\n2 3 4 5 3",
"output": "14"
},
{
"input": "2\n4 5",
"output": "4"
},
{
"input": "3\n2 4 5",
"output": "6"
},
{
"input": "3\n2 2 3",
"output": "4"
},
{
"input": "2\n2 3",
"output": "2"
},
{
"input": "4\n2 3 7 7",
"output": "16"
},
{
"input": "2\n999999999 2",
"output": "2"
},
{
"input": "2\n2 5",
"output": "2"
},
{
"input": "3\n5 3 1",
"output": "8"
},
{
"input": "4\n3 2 5 7",
"output": "14"
}
] | 1,623,999,566
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 87
| 140
| 8,601,600
|
n=int(input())
l=list(map(int,input().split()))
if sum(l)%2==0:
print(sum(l))
else:
o=0
l.sort()
for i in l:
if i%2!=0:
o=i
break
print(sum(l)-o)
|
Title: Wet Shark and Odd and Even
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today, Wet Shark is given *n* integers. Using any of these integers no more than once, Wet Shark wants to get maximum possible even (divisible by 2) sum. Please, calculate this value for Wet Shark.
Note, that if Wet Shark uses no integers from the *n* integers, the sum is an even integer 0.
Input Specification:
The first line of the input contains one integer, *n* (1<=≤<=*n*<=≤<=100<=000). The next line contains *n* space separated integers given to Wet Shark. Each of these integers is in range from 1 to 109, inclusive.
Output Specification:
Print the maximum possible even sum that can be obtained if we use some of the given integers.
Demo Input:
['3\n1 2 3\n', '5\n999999999 999999999 999999999 999999999 999999999\n']
Demo Output:
['6', '3999999996']
Note:
In the first sample, we can simply take all three integers for a total sum of 6.
In the second sample Wet Shark should take any four out of five integers 999 999 999.
|
```python
n=int(input())
l=list(map(int,input().split()))
if sum(l)%2==0:
print(sum(l))
else:
o=0
l.sort()
for i in l:
if i%2!=0:
o=i
break
print(sum(l)-o)
```
| 3
|
|
405
|
A
|
Gravity Flip
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
Little Chris is bored during his physics lessons (too easy), so he has built a toy box to keep himself occupied. The box is special, since it has the ability to change gravity.
There are *n* columns of toy cubes in the box arranged in a line. The *i*-th column contains *a**i* cubes. At first, the gravity in the box is pulling the cubes downwards. When Chris switches the gravity, it begins to pull all the cubes to the right side of the box. The figure shows the initial and final configurations of the cubes in the box: the cubes that have changed their position are highlighted with orange.
Given the initial configuration of the toy cubes in the box, find the amounts of cubes in each of the *n* columns after the gravity switch!
|
The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=100), the number of the columns in the box. The next line contains *n* space-separated integer numbers. The *i*-th number *a**i* (1<=≤<=*a**i*<=≤<=100) denotes the number of cubes in the *i*-th column.
|
Output *n* integer numbers separated by spaces, where the *i*-th number is the amount of cubes in the *i*-th column after the gravity switch.
|
[
"4\n3 2 1 2\n",
"3\n2 3 8\n"
] |
[
"1 2 2 3 \n",
"2 3 8 \n"
] |
The first example case is shown on the figure. The top cube of the first column falls to the top of the last column; the top cube of the second column falls to the top of the third column; the middle cube of the first column falls to the top of the second column.
In the second example case the gravity switch does not change the heights of the columns.
| 500
|
[
{
"input": "4\n3 2 1 2",
"output": "1 2 2 3 "
},
{
"input": "3\n2 3 8",
"output": "2 3 8 "
},
{
"input": "5\n2 1 2 1 2",
"output": "1 1 2 2 2 "
},
{
"input": "1\n1",
"output": "1 "
},
{
"input": "2\n4 3",
"output": "3 4 "
},
{
"input": "6\n100 40 60 20 1 80",
"output": "1 20 40 60 80 100 "
},
{
"input": "10\n10 8 6 7 5 3 4 2 9 1",
"output": "1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "100\n82 51 81 14 37 17 78 92 64 15 8 86 89 8 87 77 66 10 15 12 100 25 92 47 21 78 20 63 13 49 41 36 41 79 16 87 87 69 3 76 80 60 100 49 70 59 72 8 38 71 45 97 71 14 76 54 81 4 59 46 39 29 92 3 49 22 53 99 59 52 74 31 92 43 42 23 44 9 82 47 7 40 12 9 3 55 37 85 46 22 84 52 98 41 21 77 63 17 62 91",
"output": "3 3 3 4 7 8 8 8 9 9 10 12 12 13 14 14 15 15 16 17 17 20 21 21 22 22 23 25 29 31 36 37 37 38 39 40 41 41 41 42 43 44 45 46 46 47 47 49 49 49 51 52 52 53 54 55 59 59 59 60 62 63 63 64 66 69 70 71 71 72 74 76 76 77 77 78 78 79 80 81 81 82 82 84 85 86 87 87 87 89 91 92 92 92 92 97 98 99 100 100 "
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 "
},
{
"input": "10\n1 9 7 6 2 4 7 8 1 3",
"output": "1 1 2 3 4 6 7 7 8 9 "
},
{
"input": "20\n53 32 64 20 41 97 50 20 66 68 22 60 74 61 97 54 80 30 72 59",
"output": "20 20 22 30 32 41 50 53 54 59 60 61 64 66 68 72 74 80 97 97 "
},
{
"input": "30\n7 17 4 18 16 12 14 10 1 13 2 16 13 17 8 16 13 14 9 17 17 5 13 5 1 7 6 20 18 12",
"output": "1 1 2 4 5 5 6 7 7 8 9 10 12 12 13 13 13 13 14 14 16 16 16 17 17 17 17 18 18 20 "
},
{
"input": "40\n22 58 68 58 48 53 52 1 16 78 75 17 63 15 36 32 78 75 49 14 42 46 66 54 49 82 40 43 46 55 12 73 5 45 61 60 1 11 31 84",
"output": "1 1 5 11 12 14 15 16 17 22 31 32 36 40 42 43 45 46 46 48 49 49 52 53 54 55 58 58 60 61 63 66 68 73 75 75 78 78 82 84 "
},
{
"input": "70\n1 3 3 1 3 3 1 1 1 3 3 2 3 3 1 1 1 2 3 1 3 2 3 3 3 2 2 3 1 3 3 2 1 1 2 1 2 1 2 2 1 1 1 3 3 2 3 2 3 2 3 3 2 2 2 3 2 3 3 3 1 1 3 3 1 1 1 1 3 1",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 "
},
{
"input": "90\n17 75 51 30 100 5 50 95 51 73 66 5 7 76 43 49 23 55 3 24 95 79 10 11 44 93 17 99 53 66 82 66 63 76 19 4 51 71 75 43 27 5 24 19 48 7 91 15 55 21 7 6 27 10 2 91 64 58 18 21 16 71 90 88 21 20 6 6 95 85 11 7 40 65 52 49 92 98 46 88 17 48 85 96 77 46 100 34 67 52",
"output": "2 3 4 5 5 5 6 6 6 7 7 7 7 10 10 11 11 15 16 17 17 17 18 19 19 20 21 21 21 23 24 24 27 27 30 34 40 43 43 44 46 46 48 48 49 49 50 51 51 51 52 52 53 55 55 58 63 64 65 66 66 66 67 71 71 73 75 75 76 76 77 79 82 85 85 88 88 90 91 91 92 93 95 95 95 96 98 99 100 100 "
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "100\n1 1 1 1 2 1 1 1 1 1 2 2 1 1 2 1 2 1 1 1 2 1 1 2 1 2 1 1 2 2 2 1 1 2 1 1 1 2 2 2 1 1 1 2 1 2 2 1 2 1 1 2 2 1 2 1 2 1 2 2 1 1 1 2 1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 1 1 1 1 2 2 2 2 2 2 2 1 1 1 2 1 2 1",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "100\n2 1 1 1 3 2 3 3 2 3 3 1 3 3 1 3 3 1 1 1 2 3 1 2 3 1 2 3 3 1 3 1 1 2 3 2 3 3 2 3 3 1 2 2 1 2 3 2 3 2 2 1 1 3 1 3 2 1 3 1 3 1 3 1 1 3 3 3 2 3 2 2 2 2 1 3 3 3 1 2 1 2 3 2 1 3 1 3 2 1 3 1 2 1 2 3 1 3 2 3",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 "
},
{
"input": "100\n7 4 5 5 10 10 5 8 5 7 4 5 4 6 8 8 2 6 3 3 10 7 10 8 6 2 7 3 9 7 7 2 4 5 2 4 9 5 10 1 10 5 10 4 1 3 4 2 6 9 9 9 10 6 2 5 6 1 8 10 4 10 3 4 10 5 5 4 10 4 5 3 7 10 2 7 3 6 9 6 1 6 5 5 4 6 6 4 4 1 5 1 6 6 6 8 8 6 2 6",
"output": "1 1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7 7 7 7 7 7 8 8 8 8 8 8 8 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 10 10 10 10 "
},
{
"input": "100\n12 10 5 11 13 12 14 13 7 15 15 12 13 19 12 18 14 10 10 3 1 10 16 11 19 8 10 15 5 10 12 16 11 13 11 15 14 12 16 8 11 8 15 2 18 2 14 13 15 20 8 8 4 12 14 7 10 3 9 1 7 19 6 7 2 14 8 20 7 17 18 20 3 18 18 9 6 10 4 1 4 19 9 13 3 3 12 11 11 20 8 2 13 6 7 12 1 4 17 3",
"output": "1 1 1 1 2 2 2 2 3 3 3 3 3 3 4 4 4 4 5 5 6 6 6 7 7 7 7 7 7 8 8 8 8 8 8 8 9 9 9 10 10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 12 12 12 13 13 13 13 13 13 13 14 14 14 14 14 14 15 15 15 15 15 15 16 16 16 17 17 18 18 18 18 18 19 19 19 19 20 20 20 20 "
},
{
"input": "100\n5 13 1 40 30 10 23 32 33 12 6 4 15 29 31 17 23 5 36 31 32 38 24 11 34 39 19 21 6 19 31 35 1 15 6 29 22 15 17 15 1 17 2 34 20 8 27 2 29 26 13 9 22 27 27 3 20 40 4 40 33 29 36 30 35 16 19 28 26 11 36 24 29 5 40 10 38 34 33 23 34 39 31 7 10 31 22 6 36 24 14 31 34 23 2 4 26 16 2 32",
"output": "1 1 1 2 2 2 2 3 4 4 4 5 5 5 6 6 6 6 7 8 9 10 10 10 11 11 12 13 13 14 15 15 15 15 16 16 17 17 17 19 19 19 20 20 21 22 22 22 23 23 23 23 24 24 24 26 26 26 27 27 27 28 29 29 29 29 29 30 30 31 31 31 31 31 31 32 32 32 33 33 33 34 34 34 34 34 35 35 36 36 36 36 38 38 39 39 40 40 40 40 "
},
{
"input": "100\n72 44 34 74 9 60 26 37 55 77 74 69 28 66 54 55 8 36 57 31 31 48 32 66 40 70 77 43 64 28 37 10 21 58 51 32 60 28 51 52 28 35 7 33 1 68 38 70 57 71 8 20 42 57 59 4 58 10 17 47 22 48 16 3 76 67 32 37 64 47 33 41 75 69 2 76 39 9 27 75 20 21 52 25 71 21 11 29 38 10 3 1 45 55 63 36 27 7 59 41",
"output": "1 1 2 3 3 4 7 7 8 8 9 9 10 10 10 11 16 17 20 20 21 21 21 22 25 26 27 27 28 28 28 28 29 31 31 32 32 32 33 33 34 35 36 36 37 37 37 38 38 39 40 41 41 42 43 44 45 47 47 48 48 51 51 52 52 54 55 55 55 57 57 57 58 58 59 59 60 60 63 64 64 66 66 67 68 69 69 70 70 71 71 72 74 74 75 75 76 76 77 77 "
},
{
"input": "100\n75 18 61 10 56 53 42 57 79 80 31 2 50 45 54 99 84 52 71 21 86 3 19 98 14 37 40 62 63 68 5 10 87 8 81 85 52 52 57 94 2 7 56 96 19 76 1 13 81 6 80 47 22 59 99 32 9 5 36 88 98 91 70 70 12 93 12 22 85 1 97 48 94 16 84 84 51 34 62 7 68 51 30 2 37 82 4 7 27 1 80 9 61 16 59 55 12 96 94 82",
"output": "1 1 1 2 2 2 3 4 5 5 6 7 7 7 8 9 9 10 10 12 12 12 13 14 16 16 18 19 19 21 22 22 27 30 31 32 34 36 37 37 40 42 45 47 48 50 51 51 52 52 52 53 54 55 56 56 57 57 59 59 61 61 62 62 63 68 68 70 70 71 75 76 79 80 80 80 81 81 82 82 84 84 84 85 85 86 87 88 91 93 94 94 94 96 96 97 98 98 99 99 "
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "100\n50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50",
"output": "50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 "
},
{
"input": "49\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97",
"output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 "
},
{
"input": "30\n1 4 7 10 13 16 19 22 25 28 31 34 37 40 43 46 49 52 55 58 61 64 67 70 73 76 79 82 85 88",
"output": "1 4 7 10 13 16 19 22 25 28 31 34 37 40 43 46 49 52 55 58 61 64 67 70 73 76 79 82 85 88 "
},
{
"input": "100\n100 51 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 51 100 "
},
{
"input": "10\n100 90 80 70 60 50 40 30 20 10",
"output": "10 20 30 40 50 60 70 80 90 100 "
},
{
"input": "1\n10",
"output": "10 "
}
] | 1,694,060,650
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 32
| 62
| 0
|
def main():
n=int(input())
line=input()
line=line.split()
z=[]
s=''
for i in range(n):
z.append(int(line[i]))
z.sort()
for num in z:
s+=str(num)
s+=' '
print(s.strip())
main()
|
Title: Gravity Flip
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Chris is bored during his physics lessons (too easy), so he has built a toy box to keep himself occupied. The box is special, since it has the ability to change gravity.
There are *n* columns of toy cubes in the box arranged in a line. The *i*-th column contains *a**i* cubes. At first, the gravity in the box is pulling the cubes downwards. When Chris switches the gravity, it begins to pull all the cubes to the right side of the box. The figure shows the initial and final configurations of the cubes in the box: the cubes that have changed their position are highlighted with orange.
Given the initial configuration of the toy cubes in the box, find the amounts of cubes in each of the *n* columns after the gravity switch!
Input Specification:
The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=100), the number of the columns in the box. The next line contains *n* space-separated integer numbers. The *i*-th number *a**i* (1<=≤<=*a**i*<=≤<=100) denotes the number of cubes in the *i*-th column.
Output Specification:
Output *n* integer numbers separated by spaces, where the *i*-th number is the amount of cubes in the *i*-th column after the gravity switch.
Demo Input:
['4\n3 2 1 2\n', '3\n2 3 8\n']
Demo Output:
['1 2 2 3 \n', '2 3 8 \n']
Note:
The first example case is shown on the figure. The top cube of the first column falls to the top of the last column; the top cube of the second column falls to the top of the third column; the middle cube of the first column falls to the top of the second column.
In the second example case the gravity switch does not change the heights of the columns.
|
```python
def main():
n=int(input())
line=input()
line=line.split()
z=[]
s=''
for i in range(n):
z.append(int(line[i]))
z.sort()
for num in z:
s+=str(num)
s+=' '
print(s.strip())
main()
```
| 3
|
|
202
|
A
|
LLPS
|
PROGRAMMING
| 800
|
[
"binary search",
"bitmasks",
"brute force",
"greedy",
"implementation",
"strings"
] | null | null |
This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline.
You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=<<=*p*2<=<<=...<=<<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba".
String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| > |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=<<=|*x*|, *r*<=<<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=><=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post".
String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z".
|
The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10.
|
Print the lexicographically largest palindromic subsequence of string *s*.
|
[
"radar\n",
"bowwowwow\n",
"codeforces\n",
"mississipp\n"
] |
[
"rr\n",
"wwwww\n",
"s\n",
"ssss\n"
] |
Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
| 500
|
[
{
"input": "radar",
"output": "rr"
},
{
"input": "bowwowwow",
"output": "wwwww"
},
{
"input": "codeforces",
"output": "s"
},
{
"input": "mississipp",
"output": "ssss"
},
{
"input": "tourist",
"output": "u"
},
{
"input": "romka",
"output": "r"
},
{
"input": "helloworld",
"output": "w"
},
{
"input": "zzzzzzzazz",
"output": "zzzzzzzzz"
},
{
"input": "testcase",
"output": "tt"
},
{
"input": "hahahahaha",
"output": "hhhhh"
},
{
"input": "abbbbbbbbb",
"output": "bbbbbbbbb"
},
{
"input": "zaz",
"output": "zz"
},
{
"input": "aza",
"output": "z"
},
{
"input": "dcbaedcba",
"output": "e"
},
{
"input": "abcdeabcd",
"output": "e"
},
{
"input": "edcbabcde",
"output": "ee"
},
{
"input": "aaaaaaaaab",
"output": "b"
},
{
"input": "testzzzzzz",
"output": "zzzzzz"
},
{
"input": "zzzzzzwait",
"output": "zzzzzz"
},
{
"input": "rrrrrqponm",
"output": "rrrrr"
},
{
"input": "zzyzyy",
"output": "zzz"
},
{
"input": "aababb",
"output": "bbb"
},
{
"input": "zanzibar",
"output": "zz"
},
{
"input": "hhgfedcbaa",
"output": "hh"
},
{
"input": "aabcdefghh",
"output": "hh"
},
{
"input": "aruaru",
"output": "uu"
},
{
"input": "uraura",
"output": "uu"
},
{
"input": "aru",
"output": "u"
},
{
"input": "aburvabur",
"output": "v"
},
{
"input": "ura",
"output": "u"
},
{
"input": "eurottat",
"output": "u"
},
{
"input": "referee",
"output": "rr"
},
{
"input": "joking",
"output": "o"
},
{
"input": "seriously",
"output": "y"
},
{
"input": "sets",
"output": "t"
},
{
"input": "test",
"output": "tt"
},
{
"input": "klmgameklm",
"output": "mmm"
},
{
"input": "dfkjafdkdd",
"output": "kk"
},
{
"input": "zzzzzzzzzz",
"output": "zzzzzzzzzz"
},
{
"input": "aaaaaaaaaa",
"output": "aaaaaaaaaa"
},
{
"input": "buzz",
"output": "zz"
},
{
"input": "b",
"output": "b"
},
{
"input": "y",
"output": "y"
},
{
"input": "yy",
"output": "yy"
},
{
"input": "zz",
"output": "zz"
},
{
"input": "bb",
"output": "bb"
},
{
"input": "aa",
"output": "aa"
},
{
"input": "a",
"output": "a"
},
{
"input": "z",
"output": "z"
},
{
"input": "zz",
"output": "zz"
},
{
"input": "zzazazzzaz",
"output": "zzzzzzz"
},
{
"input": "hellhellhe",
"output": "llll"
},
{
"input": "hellohello",
"output": "oo"
},
{
"input": "refer",
"output": "rr"
}
] | 1,690,125,852
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 54
| 124
| 0
|
x=input()
print(max(x)*x.count(max(x)))
|
Title: LLPS
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline.
You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=<<=*p*2<=<<=...<=<<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba".
String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| > |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=<<=|*x*|, *r*<=<<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=><=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post".
String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z".
Input Specification:
The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10.
Output Specification:
Print the lexicographically largest palindromic subsequence of string *s*.
Demo Input:
['radar\n', 'bowwowwow\n', 'codeforces\n', 'mississipp\n']
Demo Output:
['rr\n', 'wwwww\n', 's\n', 'ssss\n']
Note:
Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
|
```python
x=input()
print(max(x)*x.count(max(x)))
```
| 3
|
|
118
|
A
|
String Task
|
PROGRAMMING
| 1,000
|
[
"implementation",
"strings"
] | null | null |
Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it:
- deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones.
Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string.
Help Petya cope with this easy task.
|
The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.
|
Print the resulting string. It is guaranteed that this string is not empty.
|
[
"tour\n",
"Codeforces\n",
"aBAcAba\n"
] |
[
".t.r\n",
".c.d.f.r.c.s\n",
".b.c.b\n"
] |
none
| 500
|
[
{
"input": "tour",
"output": ".t.r"
},
{
"input": "Codeforces",
"output": ".c.d.f.r.c.s"
},
{
"input": "aBAcAba",
"output": ".b.c.b"
},
{
"input": "obn",
"output": ".b.n"
},
{
"input": "wpwl",
"output": ".w.p.w.l"
},
{
"input": "ggdvq",
"output": ".g.g.d.v.q"
},
{
"input": "pumesz",
"output": ".p.m.s.z"
},
{
"input": "g",
"output": ".g"
},
{
"input": "zjuotps",
"output": ".z.j.t.p.s"
},
{
"input": "jzbwuehe",
"output": ".j.z.b.w.h"
},
{
"input": "tnkgwuugu",
"output": ".t.n.k.g.w.g"
},
{
"input": "kincenvizh",
"output": ".k.n.c.n.v.z.h"
},
{
"input": "xattxjenual",
"output": ".x.t.t.x.j.n.l"
},
{
"input": "ktajqhpqsvhw",
"output": ".k.t.j.q.h.p.q.s.v.h.w"
},
{
"input": "xnhcigytnqcmy",
"output": ".x.n.h.c.g.t.n.q.c.m"
},
{
"input": "jfmtbejyilxcec",
"output": ".j.f.m.t.b.j.l.x.c.c"
},
{
"input": "D",
"output": ".d"
},
{
"input": "ab",
"output": ".b"
},
{
"input": "Ab",
"output": ".b"
},
{
"input": "aB",
"output": ".b"
},
{
"input": "AB",
"output": ".b"
},
{
"input": "ba",
"output": ".b"
},
{
"input": "bA",
"output": ".b"
},
{
"input": "Ba",
"output": ".b"
},
{
"input": "BA",
"output": ".b"
},
{
"input": "aab",
"output": ".b"
},
{
"input": "baa",
"output": ".b"
},
{
"input": "femOZeCArKCpUiHYnbBPTIOFmsHmcpObtPYcLCdjFrUMIyqYzAokKUiiKZRouZiNMoiOuGVoQzaaCAOkquRjmmKKElLNqCnhGdQM",
"output": ".f.m.z.c.r.k.c.p.h.n.b.b.p.t.f.m.s.h.m.c.p.b.t.p.c.l.c.d.j.f.r.m.q.z.k.k.k.z.r.z.n.m.g.v.q.z.c.k.q.r.j.m.m.k.k.l.l.n.q.c.n.h.g.d.q.m"
},
{
"input": "VMBPMCmMDCLFELLIISUJDWQRXYRDGKMXJXJHXVZADRZWVWJRKFRRNSAWKKDPZZLFLNSGUNIVJFBEQsMDHSBJVDTOCSCgZWWKvZZN",
"output": ".v.m.b.p.m.c.m.m.d.c.l.f.l.l.s.j.d.w.q.r.x.r.d.g.k.m.x.j.x.j.h.x.v.z.d.r.z.w.v.w.j.r.k.f.r.r.n.s.w.k.k.d.p.z.z.l.f.l.n.s.g.n.v.j.f.b.q.s.m.d.h.s.b.j.v.d.t.c.s.c.g.z.w.w.k.v.z.z.n"
},
{
"input": "MCGFQQJNUKuAEXrLXibVjClSHjSxmlkQGTKZrRaDNDomIPOmtSgjJAjNVIVLeUGUAOHNkCBwNObVCHOWvNkLFQQbFnugYVMkJruJ",
"output": ".m.c.g.f.q.q.j.n.k.x.r.l.x.b.v.j.c.l.s.h.j.s.x.m.l.k.q.g.t.k.z.r.r.d.n.d.m.p.m.t.s.g.j.j.j.n.v.v.l.g.h.n.k.c.b.w.n.b.v.c.h.w.v.n.k.l.f.q.q.b.f.n.g.v.m.k.j.r.j"
},
{
"input": "iyaiuiwioOyzUaOtAeuEYcevvUyveuyioeeueoeiaoeiavizeeoeyYYaaAOuouueaUioueauayoiuuyiuovyOyiyoyioaoyuoyea",
"output": ".w.z.t.c.v.v.v.v.z.v"
},
{
"input": "yjnckpfyLtzwjsgpcrgCfpljnjwqzgVcufnOvhxplvflxJzqxnhrwgfJmPzifgubvspffmqrwbzivatlmdiBaddiaktdsfPwsevl",
"output": ".j.n.c.k.p.f.l.t.z.w.j.s.g.p.c.r.g.c.f.p.l.j.n.j.w.q.z.g.v.c.f.n.v.h.x.p.l.v.f.l.x.j.z.q.x.n.h.r.w.g.f.j.m.p.z.f.g.b.v.s.p.f.f.m.q.r.w.b.z.v.t.l.m.d.b.d.d.k.t.d.s.f.p.w.s.v.l"
},
{
"input": "RIIIUaAIYJOiuYIUWFPOOAIuaUEZeIooyUEUEAoIyIHYOEAlVAAIiLUAUAeiUIEiUMuuOiAgEUOIAoOUYYEYFEoOIIVeOOAOIIEg",
"output": ".r.j.w.f.p.z.h.l.v.l.m.g.f.v.g"
},
{
"input": "VBKQCFBMQHDMGNSGBQVJTGQCNHHRJMNKGKDPPSQRRVQTZNKBZGSXBPBRXPMVFTXCHZMSJVBRNFNTHBHGJLMDZJSVPZZBCCZNVLMQ",
"output": ".v.b.k.q.c.f.b.m.q.h.d.m.g.n.s.g.b.q.v.j.t.g.q.c.n.h.h.r.j.m.n.k.g.k.d.p.p.s.q.r.r.v.q.t.z.n.k.b.z.g.s.x.b.p.b.r.x.p.m.v.f.t.x.c.h.z.m.s.j.v.b.r.n.f.n.t.h.b.h.g.j.l.m.d.z.j.s.v.p.z.z.b.c.c.z.n.v.l.m.q"
},
{
"input": "iioyoaayeuyoolyiyoeuouiayiiuyTueyiaoiueyioiouyuauouayyiaeoeiiigmioiououeieeeyuyyaYyioiiooaiuouyoeoeg",
"output": ".l.t.g.m.g"
},
{
"input": "ueyiuiauuyyeueykeioouiiauzoyoeyeuyiaoaiiaaoaueyaeydaoauexuueafouiyioueeaaeyoeuaueiyiuiaeeayaioeouiuy",
"output": ".k.z.d.x.f"
},
{
"input": "FSNRBXLFQHZXGVMKLQDVHWLDSLKGKFMDRQWMWSSKPKKQBNDZRSCBLRSKCKKFFKRDMZFZGCNSMXNPMZVDLKXGNXGZQCLRTTDXLMXQ",
"output": ".f.s.n.r.b.x.l.f.q.h.z.x.g.v.m.k.l.q.d.v.h.w.l.d.s.l.k.g.k.f.m.d.r.q.w.m.w.s.s.k.p.k.k.q.b.n.d.z.r.s.c.b.l.r.s.k.c.k.k.f.f.k.r.d.m.z.f.z.g.c.n.s.m.x.n.p.m.z.v.d.l.k.x.g.n.x.g.z.q.c.l.r.t.t.d.x.l.m.x.q"
},
{
"input": "EYAYAYIOIOYOOAUOEUEUOUUYIYUUMOEOIIIAOIUOAAOIYOIOEUIERCEYYAOIOIGYUIAOYUEOEUAEAYPOYEYUUAUOAOEIYIEYUEEY",
"output": ".m.r.c.g.p"
},
{
"input": "jvvzcdcxjstbbksmqjsngxkgtttdxrljjxtwptgwwqzpvqchvgrkqlzxmptzblxhhsmrkmzzmgdfskhtmmnqzzflpmqdctvrfgtx",
"output": ".j.v.v.z.c.d.c.x.j.s.t.b.b.k.s.m.q.j.s.n.g.x.k.g.t.t.t.d.x.r.l.j.j.x.t.w.p.t.g.w.w.q.z.p.v.q.c.h.v.g.r.k.q.l.z.x.m.p.t.z.b.l.x.h.h.s.m.r.k.m.z.z.m.g.d.f.s.k.h.t.m.m.n.q.z.z.f.l.p.m.q.d.c.t.v.r.f.g.t.x"
},
{
"input": "YB",
"output": ".b"
},
{
"input": "fly",
"output": ".f.l"
},
{
"input": "YyyYYYyyYxdwdawdDAWDdaddYYYY",
"output": ".x.d.w.d.w.d.d.w.d.d.d.d"
}
] | 1,693,831,220
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 92
| 0
|
import sys
ss=(sys.stdin.readline().split()[0])
harf=['a', 'o', 'i', 'u', 'e', 'y']
ss=ss.lower()
pp='.'
adds=True
for i in range(len(ss)):
kk=ss[i] in harf
if adds==False:
pp+='.'
adds=True
if kk==True:
if adds!=True:
pp+='.'
adds=True
else:
pp+=ss[i]
adds=False
if pp[len(pp)-1]=='.':
pp=pp[0:len(pp)-1]
print(pp)
|
Title: String Task
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it:
- deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones.
Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string.
Help Petya cope with this easy task.
Input Specification:
The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.
Output Specification:
Print the resulting string. It is guaranteed that this string is not empty.
Demo Input:
['tour\n', 'Codeforces\n', 'aBAcAba\n']
Demo Output:
['.t.r\n', '.c.d.f.r.c.s\n', '.b.c.b\n']
Note:
none
|
```python
import sys
ss=(sys.stdin.readline().split()[0])
harf=['a', 'o', 'i', 'u', 'e', 'y']
ss=ss.lower()
pp='.'
adds=True
for i in range(len(ss)):
kk=ss[i] in harf
if adds==False:
pp+='.'
adds=True
if kk==True:
if adds!=True:
pp+='.'
adds=True
else:
pp+=ss[i]
adds=False
if pp[len(pp)-1]=='.':
pp=pp[0:len(pp)-1]
print(pp)
```
| 3
|
|
522
|
A
|
Reposts
|
PROGRAMMING
| 1,200
|
[
"*special",
"dfs and similar",
"dp",
"graphs",
"trees"
] | null | null |
One day Polycarp published a funny picture in a social network making a poll about the color of his handle. Many of his friends started reposting Polycarp's joke to their news feed. Some of them reposted the reposts and so on.
These events are given as a sequence of strings "name1 reposted name2", where name1 is the name of the person who reposted the joke, and name2 is the name of the person from whose news feed the joke was reposted. It is guaranteed that for each string "name1 reposted name2" user "name1" didn't have the joke in his feed yet, and "name2" already had it in his feed by the moment of repost. Polycarp was registered as "Polycarp" and initially the joke was only in his feed.
Polycarp measures the popularity of the joke as the length of the largest repost chain. Print the popularity of Polycarp's joke.
|
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=200) — the number of reposts. Next follow the reposts in the order they were made. Each of them is written on a single line and looks as "name1 reposted name2". All the names in the input consist of lowercase or uppercase English letters and/or digits and have lengths from 2 to 24 characters, inclusive.
We know that the user names are case-insensitive, that is, two names that only differ in the letter case correspond to the same social network user.
|
Print a single integer — the maximum length of a repost chain.
|
[
"5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya\n",
"6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp\n",
"1\nSoMeStRaNgEgUe reposted PoLyCaRp\n"
] |
[
"6\n",
"2\n",
"2\n"
] |
none
| 500
|
[
{
"input": "5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya",
"output": "6"
},
{
"input": "6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp",
"output": "2"
},
{
"input": "1\nSoMeStRaNgEgUe reposted PoLyCaRp",
"output": "2"
},
{
"input": "1\niuNtwVf reposted POlYcarP",
"output": "2"
},
{
"input": "10\ncs reposted poLYCaRp\nAFIkDrY7Of4V7Mq reposted CS\nsoBiwyN7KOvoFUfbhux reposted aFikDry7Of4v7MQ\nvb6LbwA reposted sObIWYN7KOvoFufBHUx\nDtWKIcVwIHgj4Rcv reposted vb6lbwa\nkt reposted DTwKicvwihgJ4rCV\n75K reposted kT\njKzyxx1 reposted 75K\nuoS reposted jkZyXX1\npZJskHTCIqE3YyZ5ME reposted uoS",
"output": "11"
},
{
"input": "10\nvxrUpCXvx8Isq reposted pOLYcaRP\nICb1 reposted vXRUpCxvX8ISq\nJFMt4b8jZE7iF2m8by7y2 reposted Icb1\nqkG6ZkMIf9QRrBFQU reposted ICb1\nnawsNfcR2palIMnmKZ reposted pOlYcaRP\nKksyH reposted jFMT4b8JzE7If2M8by7y2\nwJtWwQS5FvzN0h8CxrYyL reposted NawsNfcR2paLIMnmKz\nDpBcBPYAcTXEdhldI6tPl reposted NaWSnFCr2pALiMnmkZ\nlEnwTVnlwdQg2vaIRQry reposted kKSYh\nQUVFgwllaWO reposted Wjtwwqs5FVzN0H8cxRyyl",
"output": "6"
},
{
"input": "10\nkkuLGEiHv reposted POLYcArp\n3oX1AoUqyw1eR3nCADY9hLwd reposted kkuLGeIHV\nwf97dqq5bx1dPIchCoT reposted 3OX1AOuQYW1eR3ncAdY9hLwD\nWANr8h reposted Wf97dQQ5bx1dpIcHcoT\n3Fb736lkljZK2LtSbfL reposted wANR8h\n6nq9xLOn reposted 3fB736lKlJZk2LtSbFL\nWL reposted 3Fb736lKLjZk2LTSbfl\ndvxn4Xtc6SBcvKf1 reposted wF97DQq5bX1dPiChCOt\nMCcPLIMISqxDzrj reposted 6nQ9XLOn\nxsQL4Z2Iu reposted MCcpLiMiSqxdzrj",
"output": "9"
},
{
"input": "10\nsMA4 reposted pOLyCARP\nlq3 reposted pOlycARp\nEa16LSFTQxLJnE reposted polYcARp\nkvZVZhJwXcWsnC7NA1DV2WvS reposted polYCArp\nEYqqlrjRwddI reposted pOlyCArP\nsPqQCA67Y6PBBbcaV3EhooO reposted ea16LSFTqxLJne\njjPnneZdF6WLZ3v reposted Ea16LSFTqxLjNe\nWEoi6UpnfBUx79 reposted ea16LSFtqXljNe\nqi4yra reposted eYqqlRJrWDDI\ncw7E1UCSUD reposted eYqqLRJRwDdI",
"output": "3"
}
] | 1,616,571,778
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 36
| 108
| 0
|
n=int(input())
a=[]
name=set()
name.add("polycarp")
for i in range(n):
s=list(input().lower().split(" "))
a.append([s[0],s[2]])
name.add(s[0])
name.add(s[2])
name=list(name)
def idx(s):
return name.index(s)
g=[[] for i in range(len(name))]
for i in range(len(a)):
x,y=a[i]
g[idx(y)].append(idx(x))
start=idx("polycarp")
ans=-1
def dfs(node,cnt):
global ans
if len(g[node])==0:
ans=max(ans,cnt)
return
for to in g[node]:
dfs(to,cnt+1)
dfs(start,0)
print(ans+1)
|
Title: Reposts
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Polycarp published a funny picture in a social network making a poll about the color of his handle. Many of his friends started reposting Polycarp's joke to their news feed. Some of them reposted the reposts and so on.
These events are given as a sequence of strings "name1 reposted name2", where name1 is the name of the person who reposted the joke, and name2 is the name of the person from whose news feed the joke was reposted. It is guaranteed that for each string "name1 reposted name2" user "name1" didn't have the joke in his feed yet, and "name2" already had it in his feed by the moment of repost. Polycarp was registered as "Polycarp" and initially the joke was only in his feed.
Polycarp measures the popularity of the joke as the length of the largest repost chain. Print the popularity of Polycarp's joke.
Input Specification:
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=200) — the number of reposts. Next follow the reposts in the order they were made. Each of them is written on a single line and looks as "name1 reposted name2". All the names in the input consist of lowercase or uppercase English letters and/or digits and have lengths from 2 to 24 characters, inclusive.
We know that the user names are case-insensitive, that is, two names that only differ in the letter case correspond to the same social network user.
Output Specification:
Print a single integer — the maximum length of a repost chain.
Demo Input:
['5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya\n', '6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp\n', '1\nSoMeStRaNgEgUe reposted PoLyCaRp\n']
Demo Output:
['6\n', '2\n', '2\n']
Note:
none
|
```python
n=int(input())
a=[]
name=set()
name.add("polycarp")
for i in range(n):
s=list(input().lower().split(" "))
a.append([s[0],s[2]])
name.add(s[0])
name.add(s[2])
name=list(name)
def idx(s):
return name.index(s)
g=[[] for i in range(len(name))]
for i in range(len(a)):
x,y=a[i]
g[idx(y)].append(idx(x))
start=idx("polycarp")
ans=-1
def dfs(node,cnt):
global ans
if len(g[node])==0:
ans=max(ans,cnt)
return
for to in g[node]:
dfs(to,cnt+1)
dfs(start,0)
print(ans+1)
```
| 3
|
|
959
|
A
|
Mahmoud and Ehab and the even-odd game
|
PROGRAMMING
| 800
|
[
"games",
"math"
] | null | null |
Mahmoud and Ehab play a game called the even-odd game. Ehab chooses his favorite integer *n* and then they take turns, starting from Mahmoud. In each player's turn, he has to choose an integer *a* and subtract it from *n* such that:
- 1<=≤<=*a*<=≤<=*n*. - If it's Mahmoud's turn, *a* has to be even, but if it's Ehab's turn, *a* has to be odd.
If the current player can't choose any number satisfying the conditions, he loses. Can you determine the winner if they both play optimally?
|
The only line contains an integer *n* (1<=≤<=*n*<=≤<=109), the number at the beginning of the game.
|
Output "Mahmoud" (without quotes) if Mahmoud wins and "Ehab" (without quotes) otherwise.
|
[
"1\n",
"2\n"
] |
[
"Ehab",
"Mahmoud"
] |
In the first sample, Mahmoud can't choose any integer *a* initially because there is no positive even integer less than or equal to 1 so Ehab wins.
In the second sample, Mahmoud has to choose *a* = 2 and subtract it from *n*. It's Ehab's turn and *n* = 0. There is no positive odd integer less than or equal to 0 so Mahmoud wins.
| 500
|
[
{
"input": "1",
"output": "Ehab"
},
{
"input": "2",
"output": "Mahmoud"
},
{
"input": "10000",
"output": "Mahmoud"
},
{
"input": "33333",
"output": "Ehab"
},
{
"input": "5",
"output": "Ehab"
},
{
"input": "1000000000",
"output": "Mahmoud"
},
{
"input": "999999999",
"output": "Ehab"
},
{
"input": "123123123",
"output": "Ehab"
},
{
"input": "22222221",
"output": "Ehab"
},
{
"input": "22222220",
"output": "Mahmoud"
},
{
"input": "3",
"output": "Ehab"
},
{
"input": "4",
"output": "Mahmoud"
},
{
"input": "6",
"output": "Mahmoud"
},
{
"input": "7",
"output": "Ehab"
},
{
"input": "8",
"output": "Mahmoud"
},
{
"input": "9",
"output": "Ehab"
},
{
"input": "10",
"output": "Mahmoud"
},
{
"input": "536870912",
"output": "Mahmoud"
},
{
"input": "536870913",
"output": "Ehab"
},
{
"input": "536870911",
"output": "Ehab"
}
] | 1,639,832,304
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 62
| 0
|
a=["Mahmoud","Ehab"]
print(a[int(input())%2])
|
Title: Mahmoud and Ehab and the even-odd game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mahmoud and Ehab play a game called the even-odd game. Ehab chooses his favorite integer *n* and then they take turns, starting from Mahmoud. In each player's turn, he has to choose an integer *a* and subtract it from *n* such that:
- 1<=≤<=*a*<=≤<=*n*. - If it's Mahmoud's turn, *a* has to be even, but if it's Ehab's turn, *a* has to be odd.
If the current player can't choose any number satisfying the conditions, he loses. Can you determine the winner if they both play optimally?
Input Specification:
The only line contains an integer *n* (1<=≤<=*n*<=≤<=109), the number at the beginning of the game.
Output Specification:
Output "Mahmoud" (without quotes) if Mahmoud wins and "Ehab" (without quotes) otherwise.
Demo Input:
['1\n', '2\n']
Demo Output:
['Ehab', 'Mahmoud']
Note:
In the first sample, Mahmoud can't choose any integer *a* initially because there is no positive even integer less than or equal to 1 so Ehab wins.
In the second sample, Mahmoud has to choose *a* = 2 and subtract it from *n*. It's Ehab's turn and *n* = 0. There is no positive odd integer less than or equal to 0 so Mahmoud wins.
|
```python
a=["Mahmoud","Ehab"]
print(a[int(input())%2])
```
| 3
|
|
837
|
A
|
Text Volume
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
You are given a text of single-space separated words, consisting of small and capital Latin letters.
Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text.
Calculate the volume of the given text.
|
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text.
The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters.
|
Print one integer number — volume of text.
|
[
"7\nNonZERO\n",
"24\nthis is zero answer text\n",
"24\nHarbour Space University\n"
] |
[
"5\n",
"0\n",
"1\n"
] |
In the first example there is only one word, there are 5 capital letters in it.
In the second example all of the words contain 0 capital letters.
| 0
|
[
{
"input": "7\nNonZERO",
"output": "5"
},
{
"input": "24\nthis is zero answer text",
"output": "0"
},
{
"input": "24\nHarbour Space University",
"output": "1"
},
{
"input": "2\nWM",
"output": "2"
},
{
"input": "200\nLBmJKQLCKUgtTxMoDsEerwvLOXsxASSydOqWyULsRcjMYDWdDCgaDvBfATIWPVSXlbcCLHPYahhxMEYUiaxoCebghJqvmRnaNHYTKLeOiaLDnATPZAOgSNfBzaxLymTGjfzvTegbXsAthTxyDTcmBUkqyGlVGZhoazQzVSoKbTFcCRvYsgSCwjGMxBfWEwMHuagTBxkz",
"output": "105"
},
{
"input": "199\no A r v H e J q k J k v w Q F p O R y R Z o a K R L Z E H t X y X N y y p b x B m r R S q i A x V S u i c L y M n N X c C W Z m S j e w C w T r I S X T D F l w o k f t X u n W w p Z r A k I Y E h s g",
"output": "1"
},
{
"input": "200\nhCyIdivIiISmmYIsCLbpKcTyHaOgTUQEwnQACXnrLdHAVFLtvliTEMlzBVzTesQbhXmcqvwPDeojglBMIjOXANfyQxCSjOJyO SIqOTnRzVzseGIDDYNtrwIusScWSuEhPyEmgQIVEzXofRptjeMzzhtUQxJgcUWILUhEaaRmYRBVsjoqgmyPIKwSajdlNPccOOtWrez",
"output": "50"
},
{
"input": "1\ne",
"output": "0"
},
{
"input": "1\nA",
"output": "1"
},
{
"input": "200\nABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU VWXYZABCDE KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KZ",
"output": "10"
},
{
"input": "200\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "200"
},
{
"input": "200\nffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff",
"output": "0"
},
{
"input": "24\nHarbour Space UniversitY",
"output": "2"
},
{
"input": "5\naA AA",
"output": "2"
},
{
"input": "10\nas AS ASDA",
"output": "4"
},
{
"input": "10\nas AS ASDZ",
"output": "4"
},
{
"input": "3\na A",
"output": "1"
},
{
"input": "24\nHarbour space UniversitY",
"output": "2"
},
{
"input": "10\nas AS ASAa",
"output": "3"
},
{
"input": "15\naAb ABCDFGRHTJS",
"output": "11"
},
{
"input": "53\nsdfAZEZR AZE dfdf dsdRFGSDF ZZDZSD dfsd ERBGF dsfsdfR",
"output": "6"
},
{
"input": "10\nABC ABc AB",
"output": "3"
},
{
"input": "10\nA c de CDE",
"output": "3"
},
{
"input": "4\nA AB",
"output": "2"
},
{
"input": "18\nHARbour Space UNIV",
"output": "4"
},
{
"input": "13\na b c d e f A",
"output": "1"
},
{
"input": "6\nA B CA",
"output": "2"
},
{
"input": "4\naa A",
"output": "1"
},
{
"input": "3\nA a",
"output": "1"
}
] | 1,618,665,361
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 62
| 0
|
n = int(input())
s = input().split()
mx = 0
for i in s:
k = 0
for j in i:
if j.isupper():
k += 1
mx = max(mx, k)
print(mx)
|
Title: Text Volume
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a text of single-space separated words, consisting of small and capital Latin letters.
Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text.
Calculate the volume of the given text.
Input Specification:
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text.
The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters.
Output Specification:
Print one integer number — volume of text.
Demo Input:
['7\nNonZERO\n', '24\nthis is zero answer text\n', '24\nHarbour Space University\n']
Demo Output:
['5\n', '0\n', '1\n']
Note:
In the first example there is only one word, there are 5 capital letters in it.
In the second example all of the words contain 0 capital letters.
|
```python
n = int(input())
s = input().split()
mx = 0
for i in s:
k = 0
for j in i:
if j.isupper():
k += 1
mx = max(mx, k)
print(mx)
```
| 3
|
|
379
|
A
|
New Year Candles
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
|
The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000).
|
Print a single integer — the number of hours Vasily can light up the room for.
|
[
"4 2\n",
"6 3\n"
] |
[
"7\n",
"8\n"
] |
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
| 500
|
[
{
"input": "4 2",
"output": "7"
},
{
"input": "6 3",
"output": "8"
},
{
"input": "1000 1000",
"output": "1001"
},
{
"input": "123 5",
"output": "153"
},
{
"input": "1000 2",
"output": "1999"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "2 2",
"output": "3"
},
{
"input": "3 2",
"output": "5"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "999 2",
"output": "1997"
},
{
"input": "1000 3",
"output": "1499"
},
{
"input": "1000 4",
"output": "1333"
},
{
"input": "1 1000",
"output": "1"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "10 4",
"output": "13"
},
{
"input": "4 3",
"output": "5"
},
{
"input": "91 5",
"output": "113"
},
{
"input": "777 17",
"output": "825"
},
{
"input": "100 4",
"output": "133"
},
{
"input": "5 3",
"output": "7"
},
{
"input": "6 4",
"output": "7"
},
{
"input": "26 8",
"output": "29"
},
{
"input": "9 4",
"output": "11"
},
{
"input": "20 3",
"output": "29"
},
{
"input": "17 3",
"output": "25"
}
] | 1,647,870,691
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 46
| 0
|
a, b = map(int, input().split())
res = a
while a >= b:
quo = a // b
res += quo
rem = a % b
a = quo + rem
print(res)
|
Title: New Year Candles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
Input Specification:
The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000).
Output Specification:
Print a single integer — the number of hours Vasily can light up the room for.
Demo Input:
['4 2\n', '6 3\n']
Demo Output:
['7\n', '8\n']
Note:
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
|
```python
a, b = map(int, input().split())
res = a
while a >= b:
quo = a // b
res += quo
rem = a % b
a = quo + rem
print(res)
```
| 3
|
|
385
|
A
|
Bear and Raspberry
|
PROGRAMMING
| 1,000
|
[
"brute force",
"greedy",
"implementation"
] | null | null |
The bear decided to store some raspberry for the winter. He cunningly found out the price for a barrel of honey in kilos of raspberry for each of the following *n* days. According to the bear's data, on the *i*-th (1<=≤<=*i*<=≤<=*n*) day, the price for one barrel of honey is going to is *x**i* kilos of raspberry.
Unfortunately, the bear has neither a honey barrel, nor the raspberry. At the same time, the bear's got a friend who is ready to lend him a barrel of honey for exactly one day for *c* kilograms of raspberry. That's why the bear came up with a smart plan. He wants to choose some day *d* (1<=≤<=*d*<=<<=*n*), lent a barrel of honey and immediately (on day *d*) sell it according to a daily exchange rate. The next day (*d*<=+<=1) the bear wants to buy a new barrel of honey according to a daily exchange rate (as he's got some raspberry left from selling the previous barrel) and immediately (on day *d*<=+<=1) give his friend the borrowed barrel of honey as well as *c* kilograms of raspberry for renting the barrel.
The bear wants to execute his plan at most once and then hibernate. What maximum number of kilograms of raspberry can he earn? Note that if at some point of the plan the bear runs out of the raspberry, then he won't execute such a plan.
|
The first line contains two space-separated integers, *n* and *c* (2<=≤<=*n*<=≤<=100,<=0<=≤<=*c*<=≤<=100), — the number of days and the number of kilos of raspberry that the bear should give for borrowing the barrel.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=100), the price of a honey barrel on day *i*.
|
Print a single integer — the answer to the problem.
|
[
"5 1\n5 10 7 3 20\n",
"6 2\n100 1 10 40 10 40\n",
"3 0\n1 2 3\n"
] |
[
"3\n",
"97\n",
"0\n"
] |
In the first sample the bear will lend a honey barrel at day 3 and then sell it for 7. Then the bear will buy a barrel for 3 and return it to the friend. So, the profit is (7 - 3 - 1) = 3.
In the second sample bear will lend a honey barrel at day 1 and then sell it for 100. Then the bear buy the barrel for 1 at the day 2. So, the profit is (100 - 1 - 2) = 97.
| 500
|
[
{
"input": "5 1\n5 10 7 3 20",
"output": "3"
},
{
"input": "6 2\n100 1 10 40 10 40",
"output": "97"
},
{
"input": "3 0\n1 2 3",
"output": "0"
},
{
"input": "2 0\n2 1",
"output": "1"
},
{
"input": "10 5\n10 1 11 2 12 3 13 4 14 5",
"output": "4"
},
{
"input": "100 4\n2 57 70 8 44 10 88 67 50 44 93 79 72 50 69 19 21 9 71 47 95 13 46 10 68 72 54 40 15 83 57 92 58 25 4 22 84 9 8 55 87 0 16 46 86 58 5 21 32 28 10 46 11 29 13 33 37 34 78 33 33 21 46 70 77 51 45 97 6 21 68 61 87 54 8 91 37 12 76 61 57 9 100 45 44 88 5 71 98 98 26 45 37 87 34 50 33 60 64 77",
"output": "87"
},
{
"input": "100 5\n15 91 86 53 18 52 26 89 8 4 5 100 11 64 88 91 35 57 67 72 71 71 69 73 97 23 11 1 59 86 37 82 6 67 71 11 7 31 11 68 21 43 89 54 27 10 3 33 8 57 79 26 90 81 6 28 24 7 33 50 24 13 27 85 4 93 14 62 37 67 33 40 7 48 41 4 14 9 95 10 64 62 7 93 23 6 28 27 97 64 26 83 70 0 97 74 11 82 70 93",
"output": "84"
},
{
"input": "6 100\n10 9 8 7 6 5",
"output": "0"
},
{
"input": "100 9\n66 71 37 41 23 38 77 11 74 13 51 26 93 56 81 17 12 70 85 37 54 100 14 99 12 83 44 16 99 65 13 48 92 32 69 33 100 57 58 88 25 45 44 85 5 41 82 15 37 18 21 45 3 68 33 9 52 64 8 73 32 41 87 99 26 26 47 24 79 93 9 44 11 34 85 26 14 61 49 38 25 65 49 81 29 82 28 23 2 64 38 13 77 68 67 23 58 57 83 46",
"output": "78"
},
{
"input": "100 100\n9 72 46 37 26 94 80 1 43 85 26 53 58 18 24 19 67 2 100 52 61 81 48 15 73 41 97 93 45 1 73 54 75 51 28 79 0 14 41 42 24 50 70 18 96 100 67 1 68 48 44 39 63 77 78 18 10 51 32 53 26 60 1 13 66 39 55 27 23 71 75 0 27 88 73 31 16 95 87 84 86 71 37 40 66 70 65 83 19 4 81 99 26 51 67 63 80 54 23 44",
"output": "0"
},
{
"input": "43 65\n32 58 59 75 85 18 57 100 69 0 36 38 79 95 82 47 7 55 28 88 27 88 63 71 80 86 67 53 69 37 99 54 81 19 55 12 2 17 84 77 25 26 62",
"output": "4"
},
{
"input": "12 64\n14 87 40 24 32 36 4 41 38 77 68 71",
"output": "0"
},
{
"input": "75 94\n80 92 25 48 78 17 69 52 79 73 12 15 59 55 25 61 96 27 98 43 30 43 36 94 67 54 86 99 100 61 65 8 65 19 18 21 75 31 2 98 55 87 14 1 17 97 94 11 57 29 34 71 76 67 45 0 78 29 86 82 29 23 77 100 48 43 65 62 88 34 7 28 13 1 1",
"output": "0"
},
{
"input": "59 27\n76 61 24 66 48 18 69 84 21 8 64 90 19 71 36 90 9 36 30 37 99 37 100 56 9 79 55 37 54 63 11 11 49 71 91 70 14 100 10 44 52 23 21 19 96 13 93 66 52 79 76 5 62 6 90 35 94 7 27",
"output": "63"
},
{
"input": "86 54\n41 84 16 5 20 79 73 13 23 24 42 73 70 80 69 71 33 44 62 29 86 88 40 64 61 55 58 19 16 23 84 100 38 91 89 98 47 50 55 87 12 94 2 12 0 1 4 26 50 96 68 34 94 80 8 22 60 3 72 84 65 89 44 52 50 9 24 34 81 28 56 17 38 85 78 90 62 60 1 40 91 2 7 41 84 22",
"output": "38"
},
{
"input": "37 2\n65 36 92 92 92 76 63 56 15 95 75 26 15 4 73 50 41 92 26 20 19 100 63 55 25 75 61 96 35 0 14 6 96 3 28 41 83",
"output": "91"
},
{
"input": "19 4\n85 2 56 70 33 75 89 60 100 81 42 28 18 92 29 96 49 23 14",
"output": "79"
},
{
"input": "89 1\n50 53 97 41 68 27 53 66 93 19 11 78 46 49 38 69 96 9 43 16 1 63 95 64 96 6 34 34 45 40 19 4 53 8 11 18 95 25 50 16 64 33 97 49 23 81 63 10 30 73 76 55 7 70 9 98 6 36 75 78 3 92 85 75 40 75 55 71 9 91 15 17 47 55 44 35 55 88 53 87 61 22 100 56 14 87 36 84 24",
"output": "91"
},
{
"input": "67 0\n40 48 15 46 90 7 65 52 24 15 42 81 2 6 71 94 32 18 97 67 83 98 48 51 10 47 8 68 36 46 65 75 90 30 62 9 5 35 80 60 69 58 62 68 58 73 80 9 22 46 56 64 44 11 93 73 62 54 15 20 17 69 16 33 85 62 49",
"output": "83"
},
{
"input": "96 0\n38 97 82 43 80 40 1 99 50 94 81 63 92 13 57 24 4 10 25 32 79 56 96 19 25 14 69 56 66 22 23 78 87 76 37 30 75 77 61 64 35 64 62 32 44 62 6 84 91 44 99 5 71 19 17 12 35 52 1 14 35 18 8 36 54 42 4 67 80 11 88 44 34 35 12 38 66 42 4 90 45 10 1 44 37 96 23 28 100 90 75 17 27 67 51 70",
"output": "94"
},
{
"input": "14 14\n87 63 62 31 59 47 40 89 92 43 80 30 99 42",
"output": "43"
},
{
"input": "12 0\n100 1 100 2 100 3 100 4 100 5 100 0",
"output": "100"
},
{
"input": "3 1\n1 2 3",
"output": "0"
},
{
"input": "3 2\n3 3 3",
"output": "0"
},
{
"input": "3 3\n3 2 1",
"output": "0"
},
{
"input": "3 100\n1 2 3",
"output": "0"
},
{
"input": "2 100\n0 0",
"output": "0"
},
{
"input": "2 90\n10 5",
"output": "0"
},
{
"input": "2 5\n5 4",
"output": "0"
},
{
"input": "3 1\n19 20 1",
"output": "18"
},
{
"input": "5 1\n5 10 7 4 20",
"output": "2"
},
{
"input": "5 1\n1 2 3 4 5",
"output": "0"
}
] | 1,390,577,945
| 245
|
Python 3
|
OK
|
TESTS
| 32
| 109
| 409,600
|
n, c = map(int, input().split())
arr = [int(i) for i in input().split()]
i, r = 0, 0
for i in range(n - 1):
if arr[i] - arr[i + 1] - c > r:
r = arr[i] - arr[i + 1] - c
print(r)
|
Title: Bear and Raspberry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The bear decided to store some raspberry for the winter. He cunningly found out the price for a barrel of honey in kilos of raspberry for each of the following *n* days. According to the bear's data, on the *i*-th (1<=≤<=*i*<=≤<=*n*) day, the price for one barrel of honey is going to is *x**i* kilos of raspberry.
Unfortunately, the bear has neither a honey barrel, nor the raspberry. At the same time, the bear's got a friend who is ready to lend him a barrel of honey for exactly one day for *c* kilograms of raspberry. That's why the bear came up with a smart plan. He wants to choose some day *d* (1<=≤<=*d*<=<<=*n*), lent a barrel of honey and immediately (on day *d*) sell it according to a daily exchange rate. The next day (*d*<=+<=1) the bear wants to buy a new barrel of honey according to a daily exchange rate (as he's got some raspberry left from selling the previous barrel) and immediately (on day *d*<=+<=1) give his friend the borrowed barrel of honey as well as *c* kilograms of raspberry for renting the barrel.
The bear wants to execute his plan at most once and then hibernate. What maximum number of kilograms of raspberry can he earn? Note that if at some point of the plan the bear runs out of the raspberry, then he won't execute such a plan.
Input Specification:
The first line contains two space-separated integers, *n* and *c* (2<=≤<=*n*<=≤<=100,<=0<=≤<=*c*<=≤<=100), — the number of days and the number of kilos of raspberry that the bear should give for borrowing the barrel.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=100), the price of a honey barrel on day *i*.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['5 1\n5 10 7 3 20\n', '6 2\n100 1 10 40 10 40\n', '3 0\n1 2 3\n']
Demo Output:
['3\n', '97\n', '0\n']
Note:
In the first sample the bear will lend a honey barrel at day 3 and then sell it for 7. Then the bear will buy a barrel for 3 and return it to the friend. So, the profit is (7 - 3 - 1) = 3.
In the second sample bear will lend a honey barrel at day 1 and then sell it for 100. Then the bear buy the barrel for 1 at the day 2. So, the profit is (100 - 1 - 2) = 97.
|
```python
n, c = map(int, input().split())
arr = [int(i) for i in input().split()]
i, r = 0, 0
for i in range(n - 1):
if arr[i] - arr[i + 1] - c > r:
r = arr[i] - arr[i + 1] - c
print(r)
```
| 3
|
|
686
|
A
|
Free Ice Cream
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer.
At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue).
If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress.
Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
|
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109).
Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
|
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
|
[
"5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n",
"5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n"
] |
[
"22 1\n",
"3 2\n"
] |
Consider the first sample.
1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
| 500
|
[
{
"input": "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20",
"output": "22 1"
},
{
"input": "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98",
"output": "3 2"
},
{
"input": "6 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000",
"output": "7000000000 0"
},
{
"input": "5 12\n- 12\n+ 7\n- 6\n- 1\n+ 46",
"output": "46 0"
},
{
"input": "11 1000\n- 100\n+ 100\n+ 100\n+ 100\n+ 100\n- 100\n- 100\n- 100\n- 100\n- 100\n- 100",
"output": "700 0"
},
{
"input": "1 0\n- 526403222",
"output": "0 1"
},
{
"input": "1 897986543\n- 371188251",
"output": "526798292 0"
},
{
"input": "1 0\n+ 1",
"output": "1 0"
},
{
"input": "1 0\n- 1",
"output": "0 1"
},
{
"input": "1 10\n+ 10",
"output": "20 0"
},
{
"input": "1 3\n- 5",
"output": "3 1"
},
{
"input": "1 0\n- 5",
"output": "0 1"
},
{
"input": "1 0\n+ 5",
"output": "5 0"
}
] | 1,677,922,833
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 46
| 0
|
distressedPeople = 0
peopleInQueue, iceCreams = input().split()
peopleInQueue = int(peopleInQueue)
iceCreams = int(iceCreams)
for i in range(peopleInQueue):
plusOrMinus, value = input().split()
value = int(value)
if(plusOrMinus == '+'):
iceCreams += value
elif(plusOrMinus == '-'):
if(iceCreams >= value):
iceCreams -= value
else:
distressedPeople += 1
print(iceCreams, distressedPeople)
|
Title: Free Ice Cream
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer.
At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue).
If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress.
Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
Input Specification:
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109).
Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
Output Specification:
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
Demo Input:
['5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n', '5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n']
Demo Output:
['22 1\n', '3 2\n']
Note:
Consider the first sample.
1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
|
```python
distressedPeople = 0
peopleInQueue, iceCreams = input().split()
peopleInQueue = int(peopleInQueue)
iceCreams = int(iceCreams)
for i in range(peopleInQueue):
plusOrMinus, value = input().split()
value = int(value)
if(plusOrMinus == '+'):
iceCreams += value
elif(plusOrMinus == '-'):
if(iceCreams >= value):
iceCreams -= value
else:
distressedPeople += 1
print(iceCreams, distressedPeople)
```
| 3
|
|
129
|
A
|
Cookies
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
|
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
|
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
|
[
"1\n1\n",
"10\n1 2 2 3 4 4 4 2 2 2\n",
"11\n2 2 2 2 2 2 2 2 2 2 99\n"
] |
[
"1\n",
"8\n",
"1\n"
] |
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
| 500
|
[
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 2 2 3 4 4 4 2 2 2",
"output": "8"
},
{
"input": "11\n2 2 2 2 2 2 2 2 2 2 99",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n2 2",
"output": "2"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "7\n7 7 7 7 7 7 7",
"output": "7"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "4"
},
{
"input": "100\n1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2",
"output": "50"
},
{
"input": "99\n99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99",
"output": "49"
},
{
"input": "82\n43 44 96 33 23 42 33 66 53 87 8 90 43 91 40 88 51 18 48 62 59 10 22 20 54 6 13 63 2 56 31 52 98 42 54 32 26 77 9 24 33 91 16 30 39 34 78 82 73 90 12 15 67 76 30 18 44 86 84 98 65 54 100 79 28 34 40 56 11 43 72 35 86 59 89 40 30 33 7 19 44 15",
"output": "50"
},
{
"input": "17\n50 14 17 77 74 74 38 76 41 27 45 29 66 98 38 73 38",
"output": "7"
},
{
"input": "94\n81 19 90 99 26 11 86 44 78 36 80 59 99 90 78 72 71 20 94 56 42 40 71 84 10 85 10 70 52 27 39 55 90 16 48 25 7 79 99 100 38 10 99 56 3 4 78 9 16 57 14 40 52 54 57 70 30 86 56 84 97 60 59 69 49 66 23 92 90 46 86 73 53 47 1 83 14 20 24 66 13 45 41 14 86 75 55 88 48 95 82 24 47 87",
"output": "39"
},
{
"input": "88\n64 95 12 90 40 65 98 45 52 54 79 7 81 25 98 19 68 82 41 53 35 50 5 22 32 21 8 39 8 6 72 27 81 30 12 79 21 42 60 2 66 87 46 93 62 78 52 71 76 32 78 94 86 85 55 15 34 76 41 20 32 26 94 81 89 45 74 49 11 40 40 39 49 46 80 85 90 23 80 40 86 58 70 26 48 93 23 53",
"output": "37"
},
{
"input": "84\n95 9 43 43 13 84 60 90 1 8 97 99 54 34 59 83 33 15 51 26 40 12 66 65 19 30 29 78 92 60 25 13 19 84 71 73 12 24 54 49 16 41 11 40 57 59 34 40 39 9 71 83 1 77 79 53 94 47 78 55 77 85 29 52 80 90 53 77 97 97 27 79 28 23 83 25 26 22 49 86 63 56 3 32",
"output": "51"
},
{
"input": "47\n61 97 76 94 91 22 2 68 62 73 90 47 16 79 44 71 98 68 43 6 53 52 40 27 68 67 43 96 14 91 60 61 96 24 97 13 32 65 85 96 81 77 34 18 23 14 80",
"output": "21"
},
{
"input": "69\n71 1 78 74 58 89 30 6 100 90 22 61 11 59 14 74 27 25 78 61 45 19 25 33 37 4 52 43 53 38 9 100 56 67 69 38 76 91 63 60 93 52 28 61 9 98 8 14 57 63 89 64 98 51 36 66 36 86 13 82 50 91 52 64 86 78 78 83 81",
"output": "37"
},
{
"input": "52\n38 78 36 75 19 3 56 1 39 97 24 79 84 16 93 55 96 64 12 24 1 86 80 29 12 32 36 36 73 39 76 65 53 98 30 20 28 8 86 43 70 22 75 69 62 65 81 25 53 40 71 59",
"output": "28"
},
{
"input": "74\n81 31 67 97 26 75 69 81 11 13 13 74 77 88 52 20 52 64 66 75 72 28 41 54 26 75 41 91 75 15 18 36 13 83 63 61 14 48 53 63 19 67 35 48 23 65 73 100 44 55 92 88 99 17 73 25 83 7 31 89 12 80 98 39 42 75 14 29 81 35 77 87 33 94",
"output": "47"
},
{
"input": "44\n46 56 31 31 37 71 94 2 14 100 45 72 36 72 80 3 38 54 42 98 50 32 31 42 62 31 45 50 95 100 18 17 64 22 18 25 52 56 70 57 43 40 81 28",
"output": "15"
},
{
"input": "22\n28 57 40 74 51 4 45 84 99 12 95 14 92 60 47 81 84 51 31 91 59 42",
"output": "11"
},
{
"input": "59\n73 45 94 76 41 49 65 13 74 66 36 25 47 75 40 23 92 72 11 32 32 8 81 26 68 56 41 8 76 47 96 55 70 11 84 14 83 18 70 22 30 39 28 100 48 11 92 45 78 69 86 1 54 90 98 91 13 17 35",
"output": "33"
},
{
"input": "63\n20 18 44 94 68 57 16 43 74 55 68 24 21 95 76 84 50 50 47 86 86 12 58 55 28 72 86 18 34 45 81 88 3 72 41 9 60 90 81 93 12 6 9 6 2 41 1 7 9 29 81 14 64 80 20 36 67 54 7 5 35 81 22",
"output": "37"
},
{
"input": "28\n49 84 48 19 44 91 11 82 96 95 88 90 71 82 87 25 31 23 18 13 98 45 26 65 35 12 31 14",
"output": "15"
},
{
"input": "61\n34 18 28 64 28 45 9 77 77 20 63 92 79 16 16 100 86 2 91 91 57 15 31 95 10 88 84 5 82 83 53 98 59 17 97 80 76 80 81 3 91 81 87 93 61 46 10 49 6 22 21 75 63 89 21 81 30 19 67 38 77",
"output": "35"
},
{
"input": "90\n41 90 43 1 28 75 90 50 3 70 76 64 81 63 25 69 83 82 29 91 59 66 21 61 7 55 72 49 38 69 72 20 64 58 30 81 61 29 96 14 39 5 100 20 29 98 75 29 44 78 97 45 26 77 73 59 22 99 41 6 3 96 71 20 9 18 96 18 90 62 34 78 54 5 41 6 73 33 2 54 26 21 18 6 45 57 43 73 95 75",
"output": "42"
},
{
"input": "45\n93 69 4 27 20 14 71 48 79 3 32 26 49 30 57 88 13 56 49 61 37 32 47 41 41 70 45 68 82 18 8 6 25 20 15 13 71 99 28 6 52 34 19 59 26",
"output": "23"
},
{
"input": "33\n29 95 48 49 91 10 83 71 47 25 66 36 51 12 34 10 54 74 41 96 89 26 89 1 42 33 1 62 9 32 49 65 78",
"output": "15"
},
{
"input": "34\n98 24 42 36 41 82 28 58 89 34 77 70 76 44 74 54 66 100 13 79 4 88 21 1 11 45 91 29 87 100 29 54 82 78",
"output": "13"
},
{
"input": "29\n91 84 26 84 9 63 52 9 65 56 90 2 36 7 67 33 91 14 65 38 53 36 81 83 85 14 33 95 51",
"output": "17"
},
{
"input": "100\n2 88 92 82 87 100 78 28 84 43 78 32 43 33 97 19 15 52 29 84 57 72 54 13 99 28 82 79 40 70 34 92 91 53 9 88 27 43 14 92 72 37 26 37 20 95 19 34 49 64 33 37 34 27 80 79 9 54 99 68 25 4 68 73 46 66 24 78 3 87 26 52 50 84 4 95 23 83 39 58 86 36 33 16 98 2 84 19 53 12 69 60 10 11 78 17 79 92 77 59",
"output": "45"
},
{
"input": "100\n2 95 45 73 9 54 20 97 57 82 88 26 18 71 25 27 75 54 31 11 58 85 69 75 72 91 76 5 25 80 45 49 4 73 8 81 81 38 5 12 53 77 7 96 90 35 28 80 73 94 19 69 96 17 94 49 69 9 32 19 5 12 46 29 26 40 59 59 6 95 82 50 72 2 45 69 12 5 72 29 39 72 23 96 81 28 28 56 68 58 37 41 30 1 90 84 15 24 96 43",
"output": "53"
},
{
"input": "100\n27 72 35 91 13 10 35 45 24 55 83 84 63 96 29 79 34 67 63 92 48 83 18 77 28 27 49 66 29 88 55 15 6 58 14 67 94 36 77 7 7 64 61 52 71 18 36 99 76 6 50 67 16 13 41 7 89 73 61 51 78 22 78 32 76 100 3 31 89 71 63 53 15 85 77 54 89 33 68 74 3 23 57 5 43 89 75 35 9 86 90 11 31 46 48 37 74 17 77 8",
"output": "40"
},
{
"input": "100\n69 98 69 88 11 49 55 8 25 91 17 81 47 26 15 73 96 71 18 42 42 61 48 14 92 78 35 72 4 27 62 75 83 79 17 16 46 80 96 90 82 54 37 69 85 21 67 70 96 10 46 63 21 59 56 92 54 88 77 30 75 45 44 29 86 100 51 11 65 69 66 56 82 63 27 1 51 51 13 10 3 55 26 85 34 16 87 72 13 100 81 71 90 95 86 50 83 55 55 54",
"output": "53"
},
{
"input": "100\n34 35 99 64 2 66 78 93 20 48 12 79 19 10 87 7 42 92 60 79 5 2 24 89 57 48 63 92 74 4 16 51 7 12 90 48 87 17 18 73 51 58 97 97 25 38 15 97 96 73 67 91 6 75 14 13 87 79 75 3 15 55 35 95 71 45 10 13 20 37 82 26 2 22 13 83 97 84 39 79 43 100 54 59 98 8 61 34 7 65 75 44 24 77 73 88 34 95 44 77",
"output": "55"
},
{
"input": "100\n15 86 3 1 51 26 74 85 37 87 64 58 10 6 57 26 30 47 85 65 24 72 50 40 12 35 91 47 91 60 47 87 95 34 80 91 26 3 36 39 14 86 28 70 51 44 28 21 72 79 57 61 16 71 100 94 57 67 36 74 24 21 89 85 25 2 97 67 76 53 76 80 97 64 35 13 8 32 21 52 62 61 67 14 74 73 66 44 55 76 24 3 43 42 99 61 36 80 38 66",
"output": "52"
},
{
"input": "100\n45 16 54 54 80 94 74 93 75 85 58 95 79 30 81 2 84 4 57 23 92 64 78 1 50 36 13 27 56 54 10 77 87 1 5 38 85 74 94 82 30 45 72 83 82 30 81 82 82 3 69 82 7 92 39 60 94 42 41 5 3 17 67 21 79 44 79 96 28 3 53 68 79 89 63 83 1 44 4 31 84 15 73 77 19 66 54 6 73 1 67 24 91 11 86 45 96 82 20 89",
"output": "51"
},
{
"input": "100\n84 23 50 32 90 71 92 43 58 70 6 82 7 55 85 19 70 89 12 26 29 56 74 30 2 27 4 39 63 67 91 81 11 33 75 10 82 88 39 43 43 80 68 35 55 67 53 62 73 65 86 74 43 51 14 48 42 92 83 57 22 33 24 99 5 27 78 96 7 28 11 15 8 38 85 67 5 92 24 96 57 59 14 95 91 4 9 18 45 33 74 83 64 85 14 51 51 94 29 2",
"output": "53"
},
{
"input": "100\n77 56 56 45 73 55 32 37 39 50 30 95 79 21 44 34 51 43 86 91 39 30 85 15 35 93 100 14 57 31 80 79 38 40 88 4 91 54 7 95 76 26 62 84 17 33 67 47 6 82 69 51 17 2 59 24 11 12 31 90 12 11 55 38 72 49 30 50 42 46 5 97 9 9 30 45 86 23 19 82 40 42 5 40 35 98 35 32 60 60 5 28 84 35 21 49 68 53 68 23",
"output": "48"
},
{
"input": "100\n78 38 79 61 45 86 83 83 86 90 74 69 2 84 73 39 2 5 20 71 24 80 54 89 58 34 77 40 39 62 2 47 28 53 97 75 88 98 94 96 33 71 44 90 47 36 19 89 87 98 90 87 5 85 34 79 82 3 42 88 89 63 35 7 89 30 40 48 12 41 56 76 83 60 80 80 39 56 77 4 72 96 30 55 57 51 7 19 11 1 66 1 91 87 11 62 95 85 79 25",
"output": "48"
},
{
"input": "100\n5 34 23 20 76 75 19 51 17 82 60 13 83 6 65 16 20 43 66 54 87 10 87 73 50 24 16 98 33 28 80 52 54 82 26 92 14 13 84 92 94 29 61 21 60 20 48 94 24 20 75 70 58 27 68 45 86 89 29 8 67 38 83 48 18 100 11 22 46 84 52 97 70 19 50 75 3 7 52 53 72 41 18 31 1 38 49 53 11 64 99 76 9 87 48 12 100 32 44 71",
"output": "58"
},
{
"input": "100\n76 89 68 78 24 72 73 95 98 72 58 15 2 5 56 32 9 65 50 70 94 31 29 54 89 52 31 93 43 56 26 35 72 95 51 55 78 70 11 92 17 5 54 94 81 31 78 95 73 91 95 37 59 9 53 48 65 55 84 8 45 97 64 37 96 34 36 53 66 17 72 48 99 23 27 18 92 84 44 73 60 78 53 29 68 99 19 39 61 40 69 6 77 12 47 29 15 4 8 45",
"output": "53"
},
{
"input": "100\n82 40 31 53 8 50 85 93 3 84 54 17 96 59 51 42 18 19 35 84 79 31 17 46 54 82 72 49 35 73 26 89 61 73 3 50 12 29 25 77 88 21 58 24 22 89 96 54 82 29 96 56 77 16 1 68 90 93 20 23 57 22 31 18 92 90 51 14 50 72 31 54 12 50 66 62 2 34 17 45 68 50 87 97 23 71 1 72 17 82 42 15 20 78 4 49 66 59 10 17",
"output": "54"
},
{
"input": "100\n32 82 82 24 39 53 48 5 29 24 9 37 91 37 91 95 1 97 84 52 12 56 93 47 22 20 14 17 40 22 79 34 24 2 69 30 69 29 3 89 21 46 60 92 39 29 18 24 49 18 40 22 60 13 77 50 39 64 50 70 99 8 66 31 90 38 20 54 7 21 5 56 41 68 69 20 54 89 69 62 9 53 43 89 81 97 15 2 52 78 89 65 16 61 59 42 56 25 32 52",
"output": "49"
},
{
"input": "100\n72 54 23 24 97 14 99 87 15 25 7 23 17 87 72 31 71 87 34 82 51 77 74 85 62 38 24 7 84 48 98 21 29 71 70 84 25 58 67 92 18 44 32 9 81 15 53 29 63 18 86 16 7 31 38 99 70 32 89 16 23 11 66 96 69 82 97 59 6 9 49 80 85 19 6 9 52 51 85 74 53 46 73 55 31 63 78 61 34 80 77 65 87 77 92 52 89 8 52 31",
"output": "44"
},
{
"input": "100\n56 88 8 19 7 15 11 54 35 50 19 57 63 72 51 43 50 19 57 90 40 100 8 92 11 96 30 32 59 65 93 47 62 3 50 41 30 50 72 83 61 46 83 60 20 46 33 1 5 18 83 22 34 16 41 95 63 63 7 59 55 95 91 29 64 60 64 81 45 45 10 9 88 37 69 85 21 82 41 76 42 34 47 78 51 83 65 100 13 22 59 76 63 1 26 86 36 94 99 74",
"output": "46"
},
{
"input": "100\n27 89 67 60 62 80 43 50 28 88 72 5 94 11 63 91 18 78 99 3 71 26 12 97 74 62 23 24 22 3 100 72 98 7 94 32 12 75 61 88 42 48 10 14 45 9 48 56 73 76 70 70 79 90 35 39 96 37 81 11 19 65 99 39 23 79 34 61 35 74 90 37 73 23 46 21 94 84 73 58 11 89 13 9 10 85 42 78 73 32 53 39 49 90 43 5 28 31 97 75",
"output": "53"
},
{
"input": "100\n33 24 97 96 1 14 99 51 13 65 67 20 46 88 42 44 20 49 5 89 98 83 15 40 74 83 58 3 10 79 34 2 69 28 37 100 55 52 14 8 44 94 97 89 6 42 11 28 30 33 55 56 20 57 52 25 75 1 87 42 62 41 37 12 54 85 95 80 42 36 94 96 28 76 54 36 4 17 26 24 62 15 17 79 84 36 92 78 74 91 96 77 54 92 81 91 62 98 37 37",
"output": "43"
},
{
"input": "100\n86 24 61 15 11 85 1 31 47 36 23 36 59 34 3 27 16 29 82 28 58 52 52 66 71 61 98 39 60 20 67 41 67 90 73 29 92 17 70 95 58 98 58 32 21 73 46 56 87 72 80 75 40 27 94 31 59 92 93 37 14 99 96 21 97 23 81 91 52 52 96 94 92 28 38 29 52 16 57 27 17 24 91 21 79 55 96 98 95 94 23 78 79 12 77 35 32 75 100 82",
"output": "51"
},
{
"input": "100\n88 85 41 37 69 21 7 69 36 5 92 26 64 75 22 46 67 20 70 22 62 66 38 24 47 49 68 30 90 31 67 86 86 82 9 51 43 45 48 42 73 44 31 94 45 60 54 66 20 87 11 94 34 32 87 66 56 28 75 39 37 90 72 93 55 72 31 42 30 71 87 61 4 12 12 81 23 61 56 98 71 32 30 33 96 63 92 16 8 78 47 91 47 54 49 3 81 82 41 5",
"output": "47"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "5\n1 1 3 2 2",
"output": "3"
}
] | 1,635,263,010
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 52
| 156
| 17,715,200
|
pack = int(input())
cookies = list(map(int, input(). split()))
kol = 0
summa = sum(cookies)
for i in cookies:
if (summa - i) % 2 == 0:
kol += 1
print(kol)
|
Title: Cookies
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
Input Specification:
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
Output Specification:
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
Demo Input:
['1\n1\n', '10\n1 2 2 3 4 4 4 2 2 2\n', '11\n2 2 2 2 2 2 2 2 2 2 99\n']
Demo Output:
['1\n', '8\n', '1\n']
Note:
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
|
```python
pack = int(input())
cookies = list(map(int, input(). split()))
kol = 0
summa = sum(cookies)
for i in cookies:
if (summa - i) % 2 == 0:
kol += 1
print(kol)
```
| 3
|
|
894
|
A
|
QAQ
|
PROGRAMMING
| 800
|
[
"brute force",
"dp"
] | null | null |
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
|
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
|
Print a single integer — the number of subsequences "QAQ" in the string.
|
[
"QAQAQYSYIOIWIN\n",
"QAQQQZZYNOIWIN\n"
] |
[
"4\n",
"3\n"
] |
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
| 500
|
[
{
"input": "QAQAQYSYIOIWIN",
"output": "4"
},
{
"input": "QAQQQZZYNOIWIN",
"output": "3"
},
{
"input": "QA",
"output": "0"
},
{
"input": "IAQVAQZLQBQVQFTQQQADAQJA",
"output": "24"
},
{
"input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ",
"output": "378"
},
{
"input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ",
"output": "1077"
},
{
"input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA",
"output": "568"
},
{
"input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA",
"output": "70"
},
{
"input": "W",
"output": "0"
},
{
"input": "DBA",
"output": "0"
},
{
"input": "RQAWNACASAAKAGAAAAQ",
"output": "10"
},
{
"input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA",
"output": "111"
},
{
"input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA",
"output": "411"
},
{
"input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ",
"output": "625"
},
{
"input": "QORZOYAQ",
"output": "1"
},
{
"input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA",
"output": "13174"
},
{
"input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT",
"output": "10420"
},
{
"input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ",
"output": "12488"
},
{
"input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA",
"output": "9114"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "35937"
},
{
"input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE",
"output": "254"
},
{
"input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE",
"output": "2174"
},
{
"input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ",
"output": "2962"
},
{
"input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA",
"output": "2482"
},
{
"input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ",
"output": "7768"
},
{
"input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA",
"output": "5422"
},
{
"input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ",
"output": "3024"
},
{
"input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ",
"output": "4527"
},
{
"input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH",
"output": "6416"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ",
"output": "13136"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA",
"output": "14231"
},
{
"input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "15296"
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA",
"output": "20825"
},
{
"input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ",
"output": "20825"
},
{
"input": "Q",
"output": "0"
},
{
"input": "A",
"output": "0"
},
{
"input": "FFF",
"output": "0"
},
{
"input": "AAAAAA",
"output": "0"
}
] | 1,650,276,577
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 43
| 93
| 1,638,400
|
seq = input()
l = len(seq)
subsequences = 0
for Q1 in range(l):
for A in range(Q1,l):
for Q2 in range(A,l):
if seq[Q1] == 'Q' and seq[A] == 'A' and seq[Q2] == 'Q':
subsequences += 1
print(subsequences)
|
Title: QAQ
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
Input Specification:
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
Output Specification:
Print a single integer — the number of subsequences "QAQ" in the string.
Demo Input:
['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n']
Demo Output:
['4\n', '3\n']
Note:
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
|
```python
seq = input()
l = len(seq)
subsequences = 0
for Q1 in range(l):
for A in range(Q1,l):
for Q2 in range(A,l):
if seq[Q1] == 'Q' and seq[A] == 'A' and seq[Q2] == 'Q':
subsequences += 1
print(subsequences)
```
| 3
|
|
768
|
B
|
Code For 1
|
PROGRAMMING
| 1,600
|
[
"constructive algorithms",
"dfs and similar",
"divide and conquer"
] | null | null |
Jon fought bravely to rescue the wildlings who were attacked by the white-walkers at Hardhome. On his arrival, Sam tells him that he wants to go to Oldtown to train at the Citadel to become a maester, so he can return and take the deceased Aemon's place as maester of Castle Black. Jon agrees to Sam's proposal and Sam sets off his journey to the Citadel. However becoming a trainee at the Citadel is not a cakewalk and hence the maesters at the Citadel gave Sam a problem to test his eligibility.
Initially Sam has a list with a single element *n*. Then he has to perform certain operations on this list. In each operation Sam must remove any element *x*, such that *x*<=><=1, from the list and insert at the same position , , sequentially. He must continue with these operations until all the elements in the list are either 0 or 1.
Now the masters want the total number of 1s in the range *l* to *r* (1-indexed). Sam wants to become a maester but unfortunately he cannot solve this problem. Can you help Sam to pass the eligibility test?
|
The first line contains three integers *n*, *l*, *r* (0<=≤<=*n*<=<<=250, 0<=≤<=*r*<=-<=*l*<=≤<=105, *r*<=≥<=1, *l*<=≥<=1) – initial element and the range *l* to *r*.
It is guaranteed that *r* is not greater than the length of the final list.
|
Output the total number of 1s in the range *l* to *r* in the final sequence.
|
[
"7 2 5\n",
"10 3 10\n"
] |
[
"4\n",
"5\n"
] |
Consider first example:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/288fbb682a6fa1934a47b763d6851f9d32a06150.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Elements on positions from 2-nd to 5-th in list is [1, 1, 1, 1]. The number of ones is 4.
For the second example:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/52e9bc51ef858cacc27fc274c7ba9419d5c1ded9.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Elements on positions from 3-rd to 10-th in list is [1, 1, 1, 0, 1, 0, 1, 0]. The number of ones is 5.
| 1,000
|
[
{
"input": "7 2 5",
"output": "4"
},
{
"input": "10 3 10",
"output": "5"
},
{
"input": "56 18 40",
"output": "20"
},
{
"input": "203 40 124",
"output": "67"
},
{
"input": "903316762502 354723010040 354723105411",
"output": "78355"
},
{
"input": "33534354842198 32529564319236 32529564342569",
"output": "22239"
},
{
"input": "62518534961045 50734311240112 50734311287877",
"output": "42439"
},
{
"input": "95173251245550 106288351347530 106288351372022",
"output": "16565"
},
{
"input": "542 321 956",
"output": "336"
},
{
"input": "3621 237 2637",
"output": "2124"
},
{
"input": "9056 336 896",
"output": "311"
},
{
"input": "36007 368 24490",
"output": "13253"
},
{
"input": "244269 149154 244246",
"output": "88609"
},
{
"input": "880234 669493 757150",
"output": "73585"
},
{
"input": "3740160 1031384 1104236",
"output": "64965"
},
{
"input": "11586121 15337246 15397874",
"output": "41868"
},
{
"input": "38658997 35923164 35985664",
"output": "36004"
},
{
"input": "192308932 207804787 207866400",
"output": "44142"
},
{
"input": "950099012 175922161 176000556",
"output": "69369"
},
{
"input": "2787326787 3799676481 3799680514",
"output": "2618"
},
{
"input": "14417262581 8527979363 8528075536",
"output": "80707"
},
{
"input": "39889373539 7747197212 7747278363",
"output": "47105"
},
{
"input": "251772781087 70597428577 70597479816",
"output": "46933"
},
{
"input": "0 1 1",
"output": "0"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "3 2 3",
"output": "2"
},
{
"input": "14 7 12",
"output": "5"
},
{
"input": "1125899906842623 1 100001",
"output": "100001"
},
{
"input": "1125899906842623 1125899906742623 1125899906842623",
"output": "100001"
},
{
"input": "1000 1 1023",
"output": "1000"
},
{
"input": "281474976710656 17179869184 17179869186",
"output": "1"
},
{
"input": "2 2 2",
"output": "0"
},
{
"input": "3 2 2",
"output": "1"
}
] | 1,660,045,296
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 33
| 93
| 6,553,600
|
n,l,r = list(map(int, input().split()))
def child(num):
max_val = 0
while max_val < num:
max_val *= 2
max_val += 1
return max_val
def DFS(num,l , r, gl, gr):
if(r < gl or l > gr): return 0
if(num == 0): return 0
if(num == 1): return 1
rng = r - l
ans = DFS(num//2,l,l+(rng//2) - 1,gl,gr) + DFS(num%2,l+(rng//2),l+(rng//2),gl,gr)+ DFS(num//2,l+(rng//2)+1,r,gl,gr)
return ans
if n == 0:
print(0)
else:
print(DFS(n,1,child(n),l,r))
|
Title: Code For 1
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Jon fought bravely to rescue the wildlings who were attacked by the white-walkers at Hardhome. On his arrival, Sam tells him that he wants to go to Oldtown to train at the Citadel to become a maester, so he can return and take the deceased Aemon's place as maester of Castle Black. Jon agrees to Sam's proposal and Sam sets off his journey to the Citadel. However becoming a trainee at the Citadel is not a cakewalk and hence the maesters at the Citadel gave Sam a problem to test his eligibility.
Initially Sam has a list with a single element *n*. Then he has to perform certain operations on this list. In each operation Sam must remove any element *x*, such that *x*<=><=1, from the list and insert at the same position , , sequentially. He must continue with these operations until all the elements in the list are either 0 or 1.
Now the masters want the total number of 1s in the range *l* to *r* (1-indexed). Sam wants to become a maester but unfortunately he cannot solve this problem. Can you help Sam to pass the eligibility test?
Input Specification:
The first line contains three integers *n*, *l*, *r* (0<=≤<=*n*<=<<=250, 0<=≤<=*r*<=-<=*l*<=≤<=105, *r*<=≥<=1, *l*<=≥<=1) – initial element and the range *l* to *r*.
It is guaranteed that *r* is not greater than the length of the final list.
Output Specification:
Output the total number of 1s in the range *l* to *r* in the final sequence.
Demo Input:
['7 2 5\n', '10 3 10\n']
Demo Output:
['4\n', '5\n']
Note:
Consider first example:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/288fbb682a6fa1934a47b763d6851f9d32a06150.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Elements on positions from 2-nd to 5-th in list is [1, 1, 1, 1]. The number of ones is 4.
For the second example:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/52e9bc51ef858cacc27fc274c7ba9419d5c1ded9.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Elements on positions from 3-rd to 10-th in list is [1, 1, 1, 0, 1, 0, 1, 0]. The number of ones is 5.
|
```python
n,l,r = list(map(int, input().split()))
def child(num):
max_val = 0
while max_val < num:
max_val *= 2
max_val += 1
return max_val
def DFS(num,l , r, gl, gr):
if(r < gl or l > gr): return 0
if(num == 0): return 0
if(num == 1): return 1
rng = r - l
ans = DFS(num//2,l,l+(rng//2) - 1,gl,gr) + DFS(num%2,l+(rng//2),l+(rng//2),gl,gr)+ DFS(num//2,l+(rng//2)+1,r,gl,gr)
return ans
if n == 0:
print(0)
else:
print(DFS(n,1,child(n),l,r))
```
| 3
|
|
34
|
B
|
Sale
|
PROGRAMMING
| 900
|
[
"greedy",
"sortings"
] |
B. Sale
|
2
|
256
|
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
|
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
|
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
|
[
"5 3\n-6 0 35 -2 4\n",
"4 2\n7 0 0 -7\n"
] |
[
"8\n",
"7\n"
] |
none
| 1,000
|
[
{
"input": "5 3\n-6 0 35 -2 4",
"output": "8"
},
{
"input": "4 2\n7 0 0 -7",
"output": "7"
},
{
"input": "6 6\n756 -611 251 -66 572 -818",
"output": "1495"
},
{
"input": "5 5\n976 437 937 788 518",
"output": "0"
},
{
"input": "5 3\n-2 -2 -2 -2 -2",
"output": "6"
},
{
"input": "5 1\n998 997 985 937 998",
"output": "0"
},
{
"input": "2 2\n-742 -187",
"output": "929"
},
{
"input": "3 3\n522 597 384",
"output": "0"
},
{
"input": "4 2\n-215 -620 192 647",
"output": "835"
},
{
"input": "10 6\n557 605 685 231 910 633 130 838 -564 -85",
"output": "649"
},
{
"input": "20 14\n932 442 960 943 624 624 955 998 631 910 850 517 715 123 1000 155 -10 961 966 59",
"output": "10"
},
{
"input": "30 5\n991 997 996 967 977 999 991 986 1000 965 984 997 998 1000 958 983 974 1000 991 999 1000 978 961 992 990 998 998 978 998 1000",
"output": "0"
},
{
"input": "50 20\n-815 -947 -946 -993 -992 -846 -884 -954 -963 -733 -940 -746 -766 -930 -821 -937 -937 -999 -914 -938 -936 -975 -939 -981 -977 -952 -925 -901 -952 -978 -994 -957 -946 -896 -905 -836 -994 -951 -887 -939 -859 -953 -985 -988 -946 -829 -956 -842 -799 -886",
"output": "19441"
},
{
"input": "88 64\n999 999 1000 1000 999 996 995 1000 1000 999 1000 997 998 1000 999 1000 997 1000 993 998 994 999 998 996 1000 997 1000 1000 1000 997 1000 998 997 1000 1000 998 1000 998 999 1000 996 999 999 999 996 995 999 1000 998 999 1000 999 999 1000 1000 1000 996 1000 1000 1000 997 1000 1000 997 999 1000 1000 1000 1000 1000 999 999 1000 1000 996 999 1000 1000 995 999 1000 996 1000 998 999 999 1000 999",
"output": "0"
},
{
"input": "99 17\n-993 -994 -959 -989 -991 -995 -976 -997 -990 -1000 -996 -994 -999 -995 -1000 -983 -979 -1000 -989 -968 -994 -992 -962 -993 -999 -983 -991 -979 -995 -993 -973 -999 -995 -995 -999 -993 -995 -992 -947 -1000 -999 -998 -982 -988 -979 -993 -963 -988 -980 -990 -979 -976 -995 -999 -981 -988 -998 -999 -970 -1000 -983 -994 -943 -975 -998 -977 -973 -997 -959 -999 -983 -985 -950 -977 -977 -991 -998 -973 -987 -985 -985 -986 -984 -994 -978 -998 -989 -989 -988 -970 -985 -974 -997 -981 -962 -972 -995 -988 -993",
"output": "16984"
},
{
"input": "100 37\n205 19 -501 404 912 -435 -322 -469 -655 880 -804 -470 793 312 -108 586 -642 -928 906 605 -353 -800 745 -440 -207 752 -50 -28 498 -800 -62 -195 602 -833 489 352 536 404 -775 23 145 -512 524 759 651 -461 -427 -557 684 -366 62 592 -563 -811 64 418 -881 -308 591 -318 -145 -261 -321 -216 -18 595 -202 960 -4 219 226 -238 -882 -963 425 970 -434 -160 243 -672 -4 873 8 -633 904 -298 -151 -377 -61 -72 -677 -66 197 -716 3 -870 -30 152 -469 981",
"output": "21743"
},
{
"input": "100 99\n-931 -806 -830 -828 -916 -962 -660 -867 -952 -966 -820 -906 -724 -982 -680 -717 -488 -741 -897 -613 -986 -797 -964 -939 -808 -932 -810 -860 -641 -916 -858 -628 -821 -929 -917 -976 -664 -985 -778 -665 -624 -928 -940 -958 -884 -757 -878 -896 -634 -526 -514 -873 -990 -919 -988 -878 -650 -973 -774 -783 -733 -648 -756 -895 -833 -974 -832 -725 -841 -748 -806 -613 -924 -867 -881 -943 -864 -991 -809 -926 -777 -817 -998 -682 -910 -996 -241 -722 -964 -904 -821 -920 -835 -699 -805 -632 -779 -317 -915 -654",
"output": "81283"
},
{
"input": "100 14\n995 994 745 684 510 737 984 690 979 977 542 933 871 603 758 653 962 997 747 974 773 766 975 770 527 960 841 989 963 865 974 967 950 984 757 685 986 809 982 959 931 880 978 867 805 562 970 900 834 782 616 885 910 608 974 918 576 700 871 980 656 941 978 759 767 840 573 859 841 928 693 853 716 927 976 851 962 962 627 797 707 873 869 988 993 533 665 887 962 880 929 980 877 887 572 790 721 883 848 782",
"output": "0"
},
{
"input": "100 84\n768 946 998 752 931 912 826 1000 991 910 875 962 901 952 958 733 959 908 872 840 923 826 952 980 974 980 947 955 959 822 997 963 966 933 829 923 971 999 926 932 865 984 974 858 994 855 949 941 992 861 951 949 991 711 763 728 935 485 716 907 869 952 960 859 909 963 978 942 968 933 923 909 997 962 687 764 924 774 875 1000 961 951 987 974 848 921 966 859 995 997 974 931 886 941 974 986 906 978 998 823",
"output": "0"
},
{
"input": "100 80\n-795 -994 -833 -930 -974 -980 -950 -940 -788 -927 -583 -956 -945 -949 -809 -974 -957 -736 -967 -908 -975 -961 -986 -983 -963 -771 -952 -847 -751 -741 -982 -959 -925 -931 -839 -937 -880 -914 -858 -998 -812 -911 -862 -965 -943 -984 -738 -920 -950 -998 -909 -998 -781 -901 -677 -940 -985 -951 -675 -952 -967 -949 -882 -641 -969 -937 -975 -993 -913 -941 -807 -851 -832 -960 -939 -943 -895 -929 -528 -880 -823 -930 -888 -862 -948 -966 -962 -857 -799 -969 -833 -998 -952 -878 -946 -971 -976 -974 -723 -992",
"output": "75068"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 1\n555",
"output": "0"
},
{
"input": "1 1\n-1",
"output": "1"
},
{
"input": "1 1\n-24",
"output": "24"
}
] | 1,586,773,213
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 218
| 0
|
n,m=map(int,input().split())
l=list(map(int,input().split()))
l.sort()
i=0
cost=0
while(i<m and l[i]<0):
cost-=l[i]
i+=1
print(cost)
|
Title: Sale
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
Output Specification:
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
Demo Input:
['5 3\n-6 0 35 -2 4\n', '4 2\n7 0 0 -7\n']
Demo Output:
['8\n', '7\n']
Note:
none
|
```python
n,m=map(int,input().split())
l=list(map(int,input().split()))
l.sort()
i=0
cost=0
while(i<m and l[i]<0):
cost-=l[i]
i+=1
print(cost)
```
| 3.9455
|
155
|
A
|
I_love_\%username\%
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
|
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
|
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
|
[
"5\n100 50 200 150 200\n",
"10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n"
] |
[
"2\n",
"4\n"
] |
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing.
| 500
|
[
{
"input": "5\n100 50 200 150 200",
"output": "2"
},
{
"input": "10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242",
"output": "4"
},
{
"input": "1\n6",
"output": "0"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n100 36 53 7 81",
"output": "2"
},
{
"input": "5\n7 36 53 81 100",
"output": "4"
},
{
"input": "5\n100 81 53 36 7",
"output": "4"
},
{
"input": "10\n8 6 3 4 9 10 7 7 1 3",
"output": "5"
},
{
"input": "10\n1627 1675 1488 1390 1812 1137 1746 1324 1952 1862",
"output": "6"
},
{
"input": "10\n1 3 3 4 6 7 7 8 9 10",
"output": "7"
},
{
"input": "10\n1952 1862 1812 1746 1675 1627 1488 1390 1324 1137",
"output": "9"
},
{
"input": "25\n1448 4549 2310 2725 2091 3509 1565 2475 2232 3989 4231 779 2967 2702 608 3739 721 1552 2767 530 3114 665 1940 48 4198",
"output": "5"
},
{
"input": "33\n1097 1132 1091 1104 1049 1038 1023 1080 1104 1029 1035 1061 1049 1060 1088 1106 1105 1087 1063 1076 1054 1103 1047 1041 1028 1120 1126 1063 1117 1110 1044 1093 1101",
"output": "5"
},
{
"input": "34\n821 5536 2491 6074 7216 9885 764 1603 778 8736 8987 771 617 1587 8943 7922 439 7367 4115 8886 7878 6899 8811 5752 3184 3401 9760 9400 8995 4681 1323 6637 6554 6498",
"output": "7"
},
{
"input": "68\n6764 6877 6950 6768 6839 6755 6726 6778 6699 6805 6777 6985 6821 6801 6791 6805 6940 6761 6677 6999 6911 6699 6959 6933 6903 6843 6972 6717 6997 6756 6789 6668 6735 6852 6735 6880 6723 6834 6810 6694 6780 6679 6698 6857 6826 6896 6979 6968 6957 6988 6960 6700 6919 6892 6984 6685 6813 6678 6715 6857 6976 6902 6780 6686 6777 6686 6842 6679",
"output": "9"
},
{
"input": "60\n9000 9014 9034 9081 9131 9162 9174 9199 9202 9220 9221 9223 9229 9235 9251 9260 9268 9269 9270 9298 9307 9309 9313 9323 9386 9399 9407 9495 9497 9529 9531 9544 9614 9615 9627 9627 9643 9654 9656 9657 9685 9699 9701 9736 9745 9758 9799 9827 9843 9845 9854 9854 9885 9891 9896 9913 9942 9963 9986 9992",
"output": "57"
},
{
"input": "100\n7 61 12 52 41 16 34 99 30 44 48 89 31 54 21 1 48 52 61 15 35 87 21 76 64 92 44 81 16 93 84 92 32 15 68 76 53 39 26 4 11 26 7 4 99 99 61 65 55 85 65 67 47 39 2 74 63 49 98 87 5 94 22 30 25 42 31 84 49 23 89 60 16 26 92 27 9 57 75 61 94 35 83 47 99 100 63 24 91 88 79 10 15 45 22 64 3 11 89 83",
"output": "4"
},
{
"input": "100\n9999 9999 9999 9998 9998 9998 9997 9996 9996 9995 9993 9993 9991 9990 9989 9986 9984 9984 9983 9981 9981 9980 9980 9980 9979 9977 9977 9977 9977 9977 9976 9976 9975 9975 9973 9972 9972 9972 9972 9971 9969 9969 9969 9968 9967 9965 9962 9962 9962 9962 9960 9958 9958 9955 9954 9954 9954 9954 9950 9949 9949 9947 9943 9943 9940 9940 9939 9937 9937 9937 9936 9935 9932 9932 9931 9929 9927 9927 9926 9923 9919 9919 9918 9918 9918 9917 9917 9916 9916 9915 9914 9911 9910 9907 9907 9906 9905 9905 9904 9901",
"output": "57"
},
{
"input": "100\n158 159 157 156 155 154 160 153 161 152 162 163 151 164 150 165 149 148 147 166 146 167 145 144 143 142 168 141 169 170 140 139 138 137 171 136 135 134 172 173 174 133 175 132 177 178 131 179 180 130 129 181 128 127 182 126 183 125 124 184 123 122 121 120 119 118 117 185 186 187 188 189 116 190 115 191 192 193 114 113 112 111 110 109 108 194 195 107 106 105 196 197 104 198 199 103 102 200 101 100",
"output": "99"
},
{
"input": "2\n0 10000",
"output": "1"
},
{
"input": "2\n5 5",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n10 10",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
}
] | 1,674,386,525
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 92
| 0
|
n=int(input())
l=list(map(int,input().split()))
mn=mx=l[0]
c=0
for i in range(1,len(l)):
if l[i]>mx or l[i]<mn:
if l[i]>mx:
mx=l[i]
if l[i]<mn:
mn=l[i]
c+=1
print(c)
|
Title: I_love_\%username\%
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
Output Specification:
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
Demo Input:
['5\n100 50 200 150 200\n', '10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n']
Demo Output:
['2\n', '4\n']
Note:
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing.
|
```python
n=int(input())
l=list(map(int,input().split()))
mn=mx=l[0]
c=0
for i in range(1,len(l)):
if l[i]>mx or l[i]<mn:
if l[i]>mx:
mx=l[i]
if l[i]<mn:
mn=l[i]
c+=1
print(c)
```
| 3
|
|
873
|
A
|
Chores
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Luba has to do *n* chores today. *i*-th chore takes *a**i* units of time to complete. It is guaranteed that for every the condition *a**i*<=≥<=*a**i*<=-<=1 is met, so the sequence is sorted.
Also Luba can work really hard on some chores. She can choose not more than *k* any chores and do each of them in *x* units of time instead of *a**i* ().
Luba is very responsible, so she has to do all *n* chores, and now she wants to know the minimum time she needs to do everything. Luba cannot do two chores simultaneously.
|
The first line contains three integers *n*,<=*k*,<=*x* (1<=≤<=*k*<=≤<=*n*<=≤<=100,<=1<=≤<=*x*<=≤<=99) — the number of chores Luba has to do, the number of chores she can do in *x* units of time, and the number *x* itself.
The second line contains *n* integer numbers *a**i* (2<=≤<=*a**i*<=≤<=100) — the time Luba has to spend to do *i*-th chore.
It is guaranteed that , and for each *a**i*<=≥<=*a**i*<=-<=1.
|
Print one number — minimum time Luba needs to do all *n* chores.
|
[
"4 2 2\n3 6 7 10\n",
"5 2 1\n100 100 100 100 100\n"
] |
[
"13\n",
"302\n"
] |
In the first example the best option would be to do the third and the fourth chore, spending *x* = 2 time on each instead of *a*<sub class="lower-index">3</sub> and *a*<sub class="lower-index">4</sub>, respectively. Then the answer is 3 + 6 + 2 + 2 = 13.
In the second example Luba can choose any two chores to spend *x* time on them instead of *a*<sub class="lower-index">*i*</sub>. So the answer is 100·3 + 2·1 = 302.
| 0
|
[
{
"input": "4 2 2\n3 6 7 10",
"output": "13"
},
{
"input": "5 2 1\n100 100 100 100 100",
"output": "302"
},
{
"input": "1 1 1\n100",
"output": "1"
},
{
"input": "100 1 99\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "9999"
},
{
"input": "100 100 1\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "100"
},
{
"input": "100 50 50\n51 51 52 53 55 55 55 55 56 56 56 57 57 58 58 59 59 59 60 60 61 61 62 62 63 64 64 64 64 65 65 65 65 66 66 66 67 68 68 68 69 69 70 70 70 70 71 71 71 71 71 71 72 72 76 76 76 76 77 79 79 81 81 81 81 82 82 82 82 83 84 85 86 87 87 88 88 88 89 89 89 90 90 90 91 91 91 92 92 93 95 95 96 96 96 97 97 98 99 100",
"output": "5618"
},
{
"input": "100 100 1\n2 4 4 4 5 5 5 6 10 10 11 11 12 12 13 13 13 14 17 18 20 20 21 21 22 22 23 24 24 25 26 29 29 32 32 34 34 35 38 39 39 40 40 42 42 43 45 47 48 49 51 52 52 54 57 59 59 60 61 61 62 63 63 64 65 65 68 70 70 72 74 75 75 76 76 77 77 78 78 78 79 80 81 82 82 83 83 83 84 89 90 92 92 93 94 96 96 97 98 99",
"output": "100"
},
{
"input": "100 1 1\n3 3 5 7 8 8 8 9 9 9 11 13 14 15 18 18 19 20 21 22 22 25 27 27 29 31 32 33 33 34 36 37 37 38 40 42 44 44 46 47 47 48 48 48 50 50 51 51 54 54 54 55 55 56 56 56 60 61 62 62 63 64 65 65 68 70 70 71 71 71 71 75 75 76 76 79 79 79 79 81 81 82 82 86 86 86 86 88 90 90 92 96 97 97 98 98 98 98 100 100",
"output": "5202"
},
{
"input": "100 50 49\n50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51",
"output": "4950"
},
{
"input": "100 50 1\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "151"
},
{
"input": "100 1 1\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "199"
}
] | 1,507,817,314
| 214
|
Python 3
|
OK
|
TESTS
| 11
| 46
| 0
|
n, k, x = map(int, input().split())
times = list(map(int, input().split()))
for i in range(n - 1, n - k - 1, -1):
times[i] = x
print(sum(times))
|
Title: Chores
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Luba has to do *n* chores today. *i*-th chore takes *a**i* units of time to complete. It is guaranteed that for every the condition *a**i*<=≥<=*a**i*<=-<=1 is met, so the sequence is sorted.
Also Luba can work really hard on some chores. She can choose not more than *k* any chores and do each of them in *x* units of time instead of *a**i* ().
Luba is very responsible, so she has to do all *n* chores, and now she wants to know the minimum time she needs to do everything. Luba cannot do two chores simultaneously.
Input Specification:
The first line contains three integers *n*,<=*k*,<=*x* (1<=≤<=*k*<=≤<=*n*<=≤<=100,<=1<=≤<=*x*<=≤<=99) — the number of chores Luba has to do, the number of chores she can do in *x* units of time, and the number *x* itself.
The second line contains *n* integer numbers *a**i* (2<=≤<=*a**i*<=≤<=100) — the time Luba has to spend to do *i*-th chore.
It is guaranteed that , and for each *a**i*<=≥<=*a**i*<=-<=1.
Output Specification:
Print one number — minimum time Luba needs to do all *n* chores.
Demo Input:
['4 2 2\n3 6 7 10\n', '5 2 1\n100 100 100 100 100\n']
Demo Output:
['13\n', '302\n']
Note:
In the first example the best option would be to do the third and the fourth chore, spending *x* = 2 time on each instead of *a*<sub class="lower-index">3</sub> and *a*<sub class="lower-index">4</sub>, respectively. Then the answer is 3 + 6 + 2 + 2 = 13.
In the second example Luba can choose any two chores to spend *x* time on them instead of *a*<sub class="lower-index">*i*</sub>. So the answer is 100·3 + 2·1 = 302.
|
```python
n, k, x = map(int, input().split())
times = list(map(int, input().split()))
for i in range(n - 1, n - k - 1, -1):
times[i] = x
print(sum(times))
```
| 3
|
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,683,722,541
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 92
| 0
|
a = input().split(" ")
num1 = int(a[0])
num2 = int(a[1])
b = (num1 * num2) // 2
print(b)
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
a = input().split(" ")
num1 = int(a[0])
num2 = int(a[1])
b = (num1 * num2) // 2
print(b)
```
| 3.977
|
263
|
A
|
Beautiful Matrix
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix:
1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=<<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=<<=5).
You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
|
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
|
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
|
[
"0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n",
"0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n"
] |
[
"3\n",
"1\n"
] |
none
| 500
|
[
{
"input": "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "0"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1",
"output": "4"
},
{
"input": "0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0",
"output": "4"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0",
"output": "3"
}
] | 1,695,539,819
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 92
| 0
|
m = 0
for i in range(5):
r = list(map(int, input().split()))
if 1 in r:
m += abs(i - 2)
m += abs(r.index(1) - 2)
print(m)
|
Title: Beautiful Matrix
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix:
1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=<<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=<<=5).
You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
Input Specification:
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
Output Specification:
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
Demo Input:
['0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n', '0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n']
Demo Output:
['3\n', '1\n']
Note:
none
|
```python
m = 0
for i in range(5):
r = list(map(int, input().split()))
if 1 in r:
m += abs(i - 2)
m += abs(r.index(1) - 2)
print(m)
```
| 3
|
|
659
|
A
|
Round House
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] | null | null |
Vasya lives in a round building, whose entrances are numbered sequentially by integers from 1 to *n*. Entrance *n* and entrance 1 are adjacent.
Today Vasya got bored and decided to take a walk in the yard. Vasya lives in entrance *a* and he decided that during his walk he will move around the house *b* entrances in the direction of increasing numbers (in this order entrance *n* should be followed by entrance 1). The negative value of *b* corresponds to moving |*b*| entrances in the order of decreasing numbers (in this order entrance 1 is followed by entrance *n*). If *b*<==<=0, then Vasya prefers to walk beside his entrance.
Help Vasya to determine the number of the entrance, near which he will be at the end of his walk.
|
The single line of the input contains three space-separated integers *n*, *a* and *b* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*a*<=≤<=*n*,<=<=-<=100<=≤<=*b*<=≤<=100) — the number of entrances at Vasya's place, the number of his entrance and the length of his walk, respectively.
|
Print a single integer *k* (1<=≤<=*k*<=≤<=*n*) — the number of the entrance where Vasya will be at the end of his walk.
|
[
"6 2 -5\n",
"5 1 3\n",
"3 2 7\n"
] |
[
"3\n",
"4\n",
"3\n"
] |
The first example is illustrated by the picture in the statements.
| 500
|
[
{
"input": "6 2 -5",
"output": "3"
},
{
"input": "5 1 3",
"output": "4"
},
{
"input": "3 2 7",
"output": "3"
},
{
"input": "1 1 0",
"output": "1"
},
{
"input": "1 1 -1",
"output": "1"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "100 1 -1",
"output": "100"
},
{
"input": "100 54 100",
"output": "54"
},
{
"input": "100 37 -100",
"output": "37"
},
{
"input": "99 41 0",
"output": "41"
},
{
"input": "97 37 -92",
"output": "42"
},
{
"input": "99 38 59",
"output": "97"
},
{
"input": "35 34 1",
"output": "35"
},
{
"input": "48 1 -1",
"output": "48"
},
{
"input": "87 65 -76",
"output": "76"
},
{
"input": "76 26 29",
"output": "55"
},
{
"input": "100 65 0",
"output": "65"
},
{
"input": "2 1 100",
"output": "1"
},
{
"input": "3 2 -100",
"output": "1"
},
{
"input": "1 1 100",
"output": "1"
},
{
"input": "1 1 -100",
"output": "1"
},
{
"input": "3 1 -100",
"output": "3"
},
{
"input": "4 3 -100",
"output": "3"
},
{
"input": "3 2 -12",
"output": "2"
},
{
"input": "2 2 -100",
"output": "2"
},
{
"input": "3 2 -90",
"output": "2"
},
{
"input": "6 2 -10",
"output": "4"
},
{
"input": "3 3 -100",
"output": "2"
},
{
"input": "5 2 4",
"output": "1"
},
{
"input": "6 4 5",
"output": "3"
},
{
"input": "3 2 -6",
"output": "2"
},
{
"input": "5 1 -99",
"output": "2"
},
{
"input": "6 2 5",
"output": "1"
},
{
"input": "10 1 -100",
"output": "1"
},
{
"input": "2 2 1",
"output": "1"
},
{
"input": "3 3 1",
"output": "1"
},
{
"input": "6 4 4",
"output": "2"
},
{
"input": "17 17 2",
"output": "2"
},
{
"input": "6 6 1",
"output": "1"
},
{
"input": "5 3 -2",
"output": "1"
},
{
"input": "6 2 -100",
"output": "4"
},
{
"input": "5 3 -100",
"output": "3"
},
{
"input": "5 4 3",
"output": "2"
},
{
"input": "3 2 2",
"output": "1"
},
{
"input": "5 5 2",
"output": "2"
},
{
"input": "3 2 5",
"output": "1"
},
{
"input": "5 5 -1",
"output": "4"
},
{
"input": "5 3 3",
"output": "1"
},
{
"input": "4 2 3",
"output": "1"
},
{
"input": "88 76 74",
"output": "62"
}
] | 1,575,098,978
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 50
| 109
| 0
|
n,a,b=map(int,input().split())
if b<0:
b=abs(b)
if b<a:
print(a-b)
else:
b=b-a
t=b%n
print(n-t)
else:
if b<n-a:
print(a+b)
else:
b=b-(n-a)
t=b%n
if t==0:
t=n
print(t)
|
Title: Round House
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya lives in a round building, whose entrances are numbered sequentially by integers from 1 to *n*. Entrance *n* and entrance 1 are adjacent.
Today Vasya got bored and decided to take a walk in the yard. Vasya lives in entrance *a* and he decided that during his walk he will move around the house *b* entrances in the direction of increasing numbers (in this order entrance *n* should be followed by entrance 1). The negative value of *b* corresponds to moving |*b*| entrances in the order of decreasing numbers (in this order entrance 1 is followed by entrance *n*). If *b*<==<=0, then Vasya prefers to walk beside his entrance.
Help Vasya to determine the number of the entrance, near which he will be at the end of his walk.
Input Specification:
The single line of the input contains three space-separated integers *n*, *a* and *b* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*a*<=≤<=*n*,<=<=-<=100<=≤<=*b*<=≤<=100) — the number of entrances at Vasya's place, the number of his entrance and the length of his walk, respectively.
Output Specification:
Print a single integer *k* (1<=≤<=*k*<=≤<=*n*) — the number of the entrance where Vasya will be at the end of his walk.
Demo Input:
['6 2 -5\n', '5 1 3\n', '3 2 7\n']
Demo Output:
['3\n', '4\n', '3\n']
Note:
The first example is illustrated by the picture in the statements.
|
```python
n,a,b=map(int,input().split())
if b<0:
b=abs(b)
if b<a:
print(a-b)
else:
b=b-a
t=b%n
print(n-t)
else:
if b<n-a:
print(a+b)
else:
b=b-(n-a)
t=b%n
if t==0:
t=n
print(t)
```
| 3
|
|
41
|
A
|
Translation
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Translation
|
2
|
256
|
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
|
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
|
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
|
[
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,578,200,414
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 218
| 0
|
ber_code = input()
bir_code = input()
print("YES" if ber_code==bir_code[::-1] else "NO")
|
Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
ber_code = input()
bir_code = input()
print("YES" if ber_code==bir_code[::-1] else "NO")
```
| 3.9455
|
252
|
A
|
Little Xor
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation"
] | null | null |
Little Petya likes arrays that consist of non-negative integers a lot. Recently his mom has presented him one such array consisting of *n* elements. Petya immediately decided to find there a segment of consecutive elements, such that the *xor* of all numbers from this segment was maximal possible. Help him with that.
The *xor* operation is the bitwise exclusive "OR", that is denoted as "xor" in Pascal and "^" in C/C++/Java.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in the array. The second line contains the space-separated integers from the array. All numbers are non-negative integers strictly less than 230.
|
Print a single integer — the required maximal *xor* of a segment of consecutive elements.
|
[
"5\n1 2 1 1 2\n",
"3\n1 2 7\n",
"4\n4 2 4 8\n"
] |
[
"3\n",
"7\n",
"14\n"
] |
In the first sample one of the optimal segments is the segment that consists of the first and the second array elements, if we consider the array elements indexed starting from one.
The second sample contains only one optimal segment, which contains exactly one array element (element with index three).
| 500
|
[
{
"input": "5\n1 2 1 1 2",
"output": "3"
},
{
"input": "3\n1 2 7",
"output": "7"
},
{
"input": "4\n4 2 4 8",
"output": "14"
},
{
"input": "5\n1 1 1 1 1",
"output": "1"
},
{
"input": "16\n0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15",
"output": "15"
},
{
"input": "20\n1 1 2 2 3 3 4 4 5 5 6 6 7 7 8 8 9 9 10 10",
"output": "15"
},
{
"input": "100\n28 20 67 103 72 81 82 83 7 109 122 30 50 118 83 89 108 82 92 17 97 3 62 12 9 100 14 11 99 106 10 8 60 101 88 119 104 62 76 6 5 57 32 94 60 50 58 97 1 97 107 108 80 24 45 20 112 1 98 106 49 98 25 57 47 90 74 68 14 35 22 10 61 80 10 4 53 13 90 99 57 100 40 84 22 116 60 61 98 57 74 127 61 73 49 51 20 19 56 111",
"output": "127"
},
{
"input": "99\n87 67 4 84 13 20 35 7 11 86 25 1 58 1 74 64 74 86 98 74 72 46 63 78 84 13 60 38 30 45 45 60 9 44 36 70 33 22 82 15 71 7 43 47 23 2 20 49 42 43 54 27 51 51 53 23 27 37 17 66 90 89 61 0 18 20 49 30 84 20 13 32 64 69 56 68 59 10 91 96 43 64 19 10 2 57 62 23 100 39 32 19 95 55 77 19 24 4 77",
"output": "127"
},
{
"input": "1\n100",
"output": "100"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n4 10",
"output": "14"
},
{
"input": "99\n3511 2076 9314 3598 7737 271 4110 4454 5830 8661 8584 8227 2236 2626 1025 3806 3162 2837 6071 9627 1836 7729 6629 4054 9377 3261 1325 8859 3610 7616 5052 9736 1249 6224 7031 6074 4196 8075 4005 5419 5664 8214 4391 731 8714 8622 6122 6976 4057 1770 8025 3778 2792 994 5204 1826 6083 5438 8409 8029 1962 3133 9836 8884 1234 1776 824 1630 6523 2869 9950 8609 5397 1472 7120 5012 6490 5958 8030 7741 5077 2771 7925 9784 9456 8596 6288 8939 4779 4415 3743 5188 5574 9686 1483 4245 4769 4917 1887",
"output": "16383"
},
{
"input": "27\n78 918 443 3900 591 12 4 10 1 24 70 88 429 2 3257 65 275 2 258 62 587 625 25 26 853 728 765",
"output": "4027"
},
{
"input": "2\n3 1",
"output": "3"
},
{
"input": "2\n3 2",
"output": "3"
},
{
"input": "3\n7 3 1",
"output": "7"
},
{
"input": "3\n1 7 2",
"output": "7"
},
{
"input": "2\n7 1",
"output": "7"
},
{
"input": "4\n1 2 7 1",
"output": "7"
},
{
"input": "3\n10 5 1",
"output": "15"
}
] | 1,554,386,749
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 56
| 310
| 409,600
|
from functools import reduce
n = int(input())
sequencia = list(map(int, input().split(' ')))
maximo = 0
for i in range(len(sequencia)):
for j in range(i, len(sequencia)):
valor = reduce(lambda x, y: x^y, sequencia[i:j+1])
if valor > maximo:
maximo = valor
print(maximo)
|
Title: Little Xor
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Petya likes arrays that consist of non-negative integers a lot. Recently his mom has presented him one such array consisting of *n* elements. Petya immediately decided to find there a segment of consecutive elements, such that the *xor* of all numbers from this segment was maximal possible. Help him with that.
The *xor* operation is the bitwise exclusive "OR", that is denoted as "xor" in Pascal and "^" in C/C++/Java.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in the array. The second line contains the space-separated integers from the array. All numbers are non-negative integers strictly less than 230.
Output Specification:
Print a single integer — the required maximal *xor* of a segment of consecutive elements.
Demo Input:
['5\n1 2 1 1 2\n', '3\n1 2 7\n', '4\n4 2 4 8\n']
Demo Output:
['3\n', '7\n', '14\n']
Note:
In the first sample one of the optimal segments is the segment that consists of the first and the second array elements, if we consider the array elements indexed starting from one.
The second sample contains only one optimal segment, which contains exactly one array element (element with index three).
|
```python
from functools import reduce
n = int(input())
sequencia = list(map(int, input().split(' ')))
maximo = 0
for i in range(len(sequencia)):
for j in range(i, len(sequencia)):
valor = reduce(lambda x, y: x^y, sequencia[i:j+1])
if valor > maximo:
maximo = valor
print(maximo)
```
| 3
|
|
270
|
A
|
Fancy Fence
|
PROGRAMMING
| 1,100
|
[
"geometry",
"implementation",
"math"
] | null | null |
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
|
The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees.
|
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
|
[
"3\n30\n60\n90\n"
] |
[
"NO\nYES\nYES\n"
] |
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square.
| 500
|
[
{
"input": "3\n30\n60\n90",
"output": "NO\nYES\nYES"
},
{
"input": "6\n1\n2\n3\n170\n179\n25",
"output": "NO\nNO\nNO\nYES\nYES\nNO"
}
] | 1,680,809,913
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 3
| 92
| 0
|
# -*- coding: utf-8 -*-
"""
Created on Fri Apr 7 00:54:05 2023
@author: Srusty Sahoo
"""
t=int(input())
res=[]
for i in range(t):
a=int(input())
x=360/(180-a)
if x==int(x):
res.append("YES")
else:
res.append("NO")
[print(r) for r in res]
|
Title: Fancy Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
Input Specification:
The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees.
Output Specification:
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
Demo Input:
['3\n30\n60\n90\n']
Demo Output:
['NO\nYES\nYES\n']
Note:
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square.
|
```python
# -*- coding: utf-8 -*-
"""
Created on Fri Apr 7 00:54:05 2023
@author: Srusty Sahoo
"""
t=int(input())
res=[]
for i in range(t):
a=int(input())
x=360/(180-a)
if x==int(x):
res.append("YES")
else:
res.append("NO")
[print(r) for r in res]
```
| 3
|
|
730
|
G
|
Car Repair Shop
|
PROGRAMMING
| 1,600
|
[
"implementation"
] | null | null |
Polycarp starts his own business. Tomorrow will be the first working day of his car repair shop. For now the car repair shop is very small and only one car can be repaired at a given time.
Polycarp is good at marketing, so he has already collected *n* requests from clients. The requests are numbered from 1 to *n* in order they came.
The *i*-th request is characterized by two values: *s**i* — the day when a client wants to start the repair of his car, *d**i* — duration (in days) to repair the car. The days are enumerated from 1, the first day is tomorrow, the second day is the day after tomorrow and so on.
Polycarp is making schedule by processing requests in the order from the first to the *n*-th request. He schedules the *i*-th request as follows:
- If the car repair shop is idle for *d**i* days starting from *s**i* (*s**i*,<=*s**i*<=+<=1,<=...,<=*s**i*<=+<=*d**i*<=-<=1), then these days are used to repair a car of the *i*-th client. - Otherwise, Polycarp finds the first day *x* (from 1 and further) that there are *d**i* subsequent days when no repair is scheduled starting from *x*. In other words he chooses the smallest positive *x* that all days *x*,<=*x*<=+<=1,<=...,<=*x*<=+<=*d**i*<=-<=1 are not scheduled for repair of any car. So, the car of the *i*-th client will be repaired in the range [*x*,<=*x*<=+<=*d**i*<=-<=1]. It is possible that the day *x* when repair is scheduled to start will be less than *s**i*.
Given *n* requests, you are asked to help Polycarp schedule all of them according to the rules above.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=200) — the number of requests from clients.
The following *n* lines contain requests, one request per line. The *i*-th request is given as the pair of integers *s**i*,<=*d**i* (1<=≤<=*s**i*<=≤<=109, 1<=≤<=*d**i*<=≤<=5·106), where *s**i* is the preferred time to start repairing the *i*-th car, *d**i* is the number of days to repair the *i*-th car.
The requests should be processed in the order they are given in the input.
|
Print *n* lines. The *i*-th line should contain two integers — the start day to repair the *i*-th car and the finish day to repair the *i*-th car.
|
[
"3\n9 2\n7 3\n2 4\n",
"4\n1000000000 1000000\n1000000000 1000000\n100000000 1000000\n1000000000 1000000\n"
] |
[
"9 10\n1 3\n4 7\n",
"1000000000 1000999999\n1 1000000\n100000000 100999999\n1000001 2000000\n"
] |
none
| 0
|
[
{
"input": "3\n9 2\n7 3\n2 4",
"output": "9 10\n1 3\n4 7"
},
{
"input": "4\n1000000000 1000000\n1000000000 1000000\n100000000 1000000\n1000000000 1000000",
"output": "1000000000 1000999999\n1 1000000\n100000000 100999999\n1000001 2000000"
},
{
"input": "1\n1 1",
"output": "1 1"
},
{
"input": "1\n1000000000 1",
"output": "1000000000 1000000000"
},
{
"input": "1\n1000000000 5000000",
"output": "1000000000 1004999999"
},
{
"input": "5\n6 2\n10 1\n10 2\n9 2\n5 1",
"output": "6 7\n10 10\n1 2\n3 4\n5 5"
},
{
"input": "10\n1 3\n77 8\n46 5\n83 4\n61 7\n8 4\n54 7\n80 7\n33 7\n13 4",
"output": "1 3\n77 84\n46 50\n4 7\n61 67\n8 11\n54 60\n12 18\n33 39\n19 22"
},
{
"input": "10\n588 12\n560 10\n593 14\n438 15\n761 11\n984 6\n503 2\n855 19\n538 2\n650 7",
"output": "588 599\n560 569\n1 14\n438 452\n761 771\n984 989\n503 504\n855 873\n538 539\n650 656"
},
{
"input": "20\n360 26\n475 17\n826 12\n815 23\n567 28\n897 26\n707 20\n1000 9\n576 5\n16 5\n714 16\n630 17\n426 26\n406 23\n899 25\n102 22\n896 8\n320 27\n964 25\n932 18",
"output": "360 385\n475 491\n826 837\n1 23\n567 594\n897 922\n707 726\n1000 1008\n24 28\n29 33\n34 49\n630 646\n426 451\n50 72\n73 97\n102 123\n124 131\n320 346\n964 988\n932 949"
},
{
"input": "30\n522692116 84\n589719489 488\n662495181 961\n915956552 470\n683572975 271\n498400137 480\n327010963 181\n200704287 367\n810826488 54\n978100746 208\n345455616 986\n106372142 876\n446972337 42\n309349333 200\n93462198 543\n167946793 318\n325598940 427\n121873339 459\n174934933 598\n279521023 655\n739750520 3\n870850765 192\n622303167 400\n471234786 63\n805952711 18\n349834333 857\n804873364 302\n512746562 39\n533285962 561\n996718586 494",
"output": "522692116 522692199\n589719489 589719976\n662495181 662496141\n915956552 915957021\n683572975 683573245\n498400137 498400616\n327010963 327011143\n200704287 200704653\n810826488 810826541\n978100746 978100953\n345455616 345456601\n106372142 106373017\n446972337 446972378\n309349333 309349532\n93462198 93462740\n167946793 167947110\n325598940 325599366\n121873339 121873797\n174934933 174935530\n279521023 279521677\n739750520 739750522\n870850765 870850956\n622303167 622303566\n471234786 471234848\n805952711..."
},
{
"input": "2\n10 3\n9 2",
"output": "10 12\n1 2"
},
{
"input": "1\n1 5000000",
"output": "1 5000000"
}
] | 1,585,897,013
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 28
| 124
| 307,200
|
def dotwointervals(l1,r1,l2,r2):
if(l1<l2 and r1<l2):
return 0
elif(l1>r2 and r1>r2):
return 0
return 1
n=int(input())
lofdays=[]
for you in range(n):
l=input().split()
si=int(l[0])
di=int(l[1])
if(you==0):
lofdays.append((si,si+di-1))
print(si,si+di-1)
else:
nowint=(si,si+di-1)
done=1
for i in lofdays:
if(dotwointervals(nowint[0],nowint[1],i[0],i[1])):
done=0
break
if(done==1):
lofdays.append(nowint)
print(si,si+di-1)
else:
mina=min(lofdays)
if(mina[0]-di>0):
print(1,di)
lofdays.append((1,di))
else:
lofdays.sort()
done=0
for i in range(1,len(lofdays)):
if(lofdays[i][0]-lofdays[i-1][1]-1>=di):
done=1
print(lofdays[i-1][1]+1,lofdays[i-1][1]+di)
lofdays.append((lofdays[i-1][1]+1,lofdays[i-1][1]+di))
break
if(done==0):
print(lofdays[-1][1]+1,lofdays[-1][1]+di)
lofdays.append((lofdays[-1][1]+1,lofdays[-1][1]+di))
|
Title: Car Repair Shop
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp starts his own business. Tomorrow will be the first working day of his car repair shop. For now the car repair shop is very small and only one car can be repaired at a given time.
Polycarp is good at marketing, so he has already collected *n* requests from clients. The requests are numbered from 1 to *n* in order they came.
The *i*-th request is characterized by two values: *s**i* — the day when a client wants to start the repair of his car, *d**i* — duration (in days) to repair the car. The days are enumerated from 1, the first day is tomorrow, the second day is the day after tomorrow and so on.
Polycarp is making schedule by processing requests in the order from the first to the *n*-th request. He schedules the *i*-th request as follows:
- If the car repair shop is idle for *d**i* days starting from *s**i* (*s**i*,<=*s**i*<=+<=1,<=...,<=*s**i*<=+<=*d**i*<=-<=1), then these days are used to repair a car of the *i*-th client. - Otherwise, Polycarp finds the first day *x* (from 1 and further) that there are *d**i* subsequent days when no repair is scheduled starting from *x*. In other words he chooses the smallest positive *x* that all days *x*,<=*x*<=+<=1,<=...,<=*x*<=+<=*d**i*<=-<=1 are not scheduled for repair of any car. So, the car of the *i*-th client will be repaired in the range [*x*,<=*x*<=+<=*d**i*<=-<=1]. It is possible that the day *x* when repair is scheduled to start will be less than *s**i*.
Given *n* requests, you are asked to help Polycarp schedule all of them according to the rules above.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=200) — the number of requests from clients.
The following *n* lines contain requests, one request per line. The *i*-th request is given as the pair of integers *s**i*,<=*d**i* (1<=≤<=*s**i*<=≤<=109, 1<=≤<=*d**i*<=≤<=5·106), where *s**i* is the preferred time to start repairing the *i*-th car, *d**i* is the number of days to repair the *i*-th car.
The requests should be processed in the order they are given in the input.
Output Specification:
Print *n* lines. The *i*-th line should contain two integers — the start day to repair the *i*-th car and the finish day to repair the *i*-th car.
Demo Input:
['3\n9 2\n7 3\n2 4\n', '4\n1000000000 1000000\n1000000000 1000000\n100000000 1000000\n1000000000 1000000\n']
Demo Output:
['9 10\n1 3\n4 7\n', '1000000000 1000999999\n1 1000000\n100000000 100999999\n1000001 2000000\n']
Note:
none
|
```python
def dotwointervals(l1,r1,l2,r2):
if(l1<l2 and r1<l2):
return 0
elif(l1>r2 and r1>r2):
return 0
return 1
n=int(input())
lofdays=[]
for you in range(n):
l=input().split()
si=int(l[0])
di=int(l[1])
if(you==0):
lofdays.append((si,si+di-1))
print(si,si+di-1)
else:
nowint=(si,si+di-1)
done=1
for i in lofdays:
if(dotwointervals(nowint[0],nowint[1],i[0],i[1])):
done=0
break
if(done==1):
lofdays.append(nowint)
print(si,si+di-1)
else:
mina=min(lofdays)
if(mina[0]-di>0):
print(1,di)
lofdays.append((1,di))
else:
lofdays.sort()
done=0
for i in range(1,len(lofdays)):
if(lofdays[i][0]-lofdays[i-1][1]-1>=di):
done=1
print(lofdays[i-1][1]+1,lofdays[i-1][1]+di)
lofdays.append((lofdays[i-1][1]+1,lofdays[i-1][1]+di))
break
if(done==0):
print(lofdays[-1][1]+1,lofdays[-1][1]+di)
lofdays.append((lofdays[-1][1]+1,lofdays[-1][1]+di))
```
| 3
|
|
401
|
A
|
Vanya and Cards
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Vanya loves playing. He even has a special set of cards to play with. Each card has a single integer. The number on the card can be positive, negative and can even be equal to zero. The only limit is, the number on each card doesn't exceed *x* in the absolute value.
Natasha doesn't like when Vanya spends a long time playing, so she hid all of his cards. Vanya became sad and started looking for the cards but he only found *n* of them. Vanya loves the balance, so he wants the sum of all numbers on found cards equal to zero. On the other hand, he got very tired of looking for cards. Help the boy and say what is the minimum number of cards does he need to find to make the sum equal to zero?
You can assume that initially Vanya had infinitely many cards with each integer number from <=-<=*x* to *x*.
|
The first line contains two integers: *n* (1<=≤<=*n*<=≤<=1000) — the number of found cards and *x* (1<=≤<=*x*<=≤<=1000) — the maximum absolute value of the number on a card. The second line contains *n* space-separated integers — the numbers on found cards. It is guaranteed that the numbers do not exceed *x* in their absolute value.
|
Print a single number — the answer to the problem.
|
[
"3 2\n-1 1 2\n",
"2 3\n-2 -2\n"
] |
[
"1\n",
"2\n"
] |
In the first sample, Vanya needs to find a single card with number -2.
In the second sample, Vanya needs to find two cards with number 2. He can't find a single card with the required number as the numbers on the lost cards do not exceed 3 in their absolute value.
| 500
|
[
{
"input": "3 2\n-1 1 2",
"output": "1"
},
{
"input": "2 3\n-2 -2",
"output": "2"
},
{
"input": "4 4\n1 2 3 4",
"output": "3"
},
{
"input": "2 2\n-1 -1",
"output": "1"
},
{
"input": "15 5\n-2 -1 2 -4 -3 4 -4 -2 -2 2 -2 -1 1 -4 -2",
"output": "4"
},
{
"input": "15 16\n-15 -5 -15 -14 -8 15 -15 -12 -5 -3 5 -7 3 8 -15",
"output": "6"
},
{
"input": "1 4\n-3",
"output": "1"
},
{
"input": "10 7\n6 4 6 6 -3 4 -1 2 3 3",
"output": "5"
},
{
"input": "2 1\n1 -1",
"output": "0"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "8 13\n-11 -1 -11 12 -2 -2 -10 -11",
"output": "3"
},
{
"input": "16 11\n3 -7 7 -9 -2 -3 -4 -2 -6 8 10 7 1 4 6 7",
"output": "2"
},
{
"input": "67 15\n-2 -2 6 -4 -7 4 3 13 -9 -4 11 -7 -6 -11 1 11 -1 11 14 10 -8 7 5 11 -13 1 -1 7 -14 9 -11 -11 13 -4 12 -11 -8 -5 -11 6 10 -2 6 9 9 6 -11 -2 7 -10 -1 9 -8 -5 1 -7 -2 3 -1 -13 -6 -9 -8 10 13 -3 9",
"output": "1"
},
{
"input": "123 222\n44 -190 -188 -185 -55 17 190 176 157 176 -24 -113 -54 -61 -53 53 -77 68 -12 -114 -217 163 -122 37 -37 20 -108 17 -140 -210 218 19 -89 54 18 197 111 -150 -36 -131 -172 36 67 16 -202 72 169 -137 -34 -122 137 -72 196 -17 -104 180 -102 96 -69 -184 21 -15 217 -61 175 -221 62 173 -93 -106 122 -135 58 7 -110 -108 156 -141 -102 -50 29 -204 -46 -76 101 -33 -190 99 52 -197 175 -71 161 -140 155 10 189 -217 -97 -170 183 -88 83 -149 157 -208 154 -3 77 90 74 165 198 -181 -166 -4 -200 -89 -200 131 100 -61 -149",
"output": "8"
},
{
"input": "130 142\n58 -50 43 -126 84 -92 -108 -92 57 127 12 -135 -49 89 141 -112 -31 47 75 -19 80 81 -5 17 10 4 -26 68 -102 -10 7 -62 -135 -123 -16 55 -72 -97 -34 21 21 137 130 97 40 -18 110 -52 73 52 85 103 -134 -107 88 30 66 97 126 82 13 125 127 -87 81 22 45 102 13 95 4 10 -35 39 -43 -112 -5 14 -46 19 61 -44 -116 137 -116 -80 -39 92 -75 29 -65 -15 5 -108 -114 -129 -5 52 -21 118 -41 35 -62 -125 130 -95 -11 -75 19 108 108 127 141 2 -130 54 96 -81 -102 140 -58 -102 132 50 -126 82 6 45 -114 -42",
"output": "5"
},
{
"input": "7 12\n2 5 -1 -4 -7 4 3",
"output": "1"
},
{
"input": "57 53\n-49 7 -41 7 38 -51 -23 8 45 1 -24 26 37 28 -31 -40 38 25 -32 -47 -3 20 -40 -32 -44 -36 5 33 -16 -5 28 10 -22 3 -10 -51 -32 -51 27 -50 -22 -12 41 3 15 24 30 -12 -34 -15 -29 38 -10 -35 -9 6 -51",
"output": "8"
},
{
"input": "93 273\n-268 -170 -163 19 -69 18 -244 35 -34 125 -224 -48 179 -247 127 -150 271 -49 -102 201 84 -151 -70 -46 -16 216 240 127 3 218 -209 223 -227 -201 228 -8 203 46 -100 -207 126 255 40 -58 -217 93 172 -97 23 183 102 -92 -157 -117 173 47 144 -235 -227 -62 -128 13 -151 158 110 -116 68 -2 -148 -206 -52 79 -152 -223 74 -149 -69 232 38 -70 -256 -213 -236 132 -189 -200 199 -57 -108 -53 269 -101 -134",
"output": "8"
},
{
"input": "1 1000\n997",
"output": "1"
},
{
"input": "4 3\n2 -1 -2 -1",
"output": "1"
},
{
"input": "1 1\n-1",
"output": "1"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "2 2\n1 -1",
"output": "0"
},
{
"input": "2 2\n-1 1",
"output": "0"
},
{
"input": "2 3\n-1 1",
"output": "0"
},
{
"input": "2 2\n-2 2",
"output": "0"
},
{
"input": "2 2\n2 2",
"output": "2"
},
{
"input": "4 2\n-1 -1 -1 -1",
"output": "2"
},
{
"input": "4 1\n-1 -1 -1 1",
"output": "2"
},
{
"input": "3 2\n2 2 2",
"output": "3"
},
{
"input": "10 300\n300 300 300 300 300 300 300 300 300 300",
"output": "10"
}
] | 1,588,520,242
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 47
| 108
| 307,200
|
n,x=map(int,input().split())
a=list(map(int,input().split()))
k=abs(sum(a))
if(k%x==0):
print(int(k/x))
else:
print(int(k/x)+1)
|
Title: Vanya and Cards
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya loves playing. He even has a special set of cards to play with. Each card has a single integer. The number on the card can be positive, negative and can even be equal to zero. The only limit is, the number on each card doesn't exceed *x* in the absolute value.
Natasha doesn't like when Vanya spends a long time playing, so she hid all of his cards. Vanya became sad and started looking for the cards but he only found *n* of them. Vanya loves the balance, so he wants the sum of all numbers on found cards equal to zero. On the other hand, he got very tired of looking for cards. Help the boy and say what is the minimum number of cards does he need to find to make the sum equal to zero?
You can assume that initially Vanya had infinitely many cards with each integer number from <=-<=*x* to *x*.
Input Specification:
The first line contains two integers: *n* (1<=≤<=*n*<=≤<=1000) — the number of found cards and *x* (1<=≤<=*x*<=≤<=1000) — the maximum absolute value of the number on a card. The second line contains *n* space-separated integers — the numbers on found cards. It is guaranteed that the numbers do not exceed *x* in their absolute value.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['3 2\n-1 1 2\n', '2 3\n-2 -2\n']
Demo Output:
['1\n', '2\n']
Note:
In the first sample, Vanya needs to find a single card with number -2.
In the second sample, Vanya needs to find two cards with number 2. He can't find a single card with the required number as the numbers on the lost cards do not exceed 3 in their absolute value.
|
```python
n,x=map(int,input().split())
a=list(map(int,input().split()))
k=abs(sum(a))
if(k%x==0):
print(int(k/x))
else:
print(int(k/x)+1)
```
| 3
|
|
602
|
A
|
Two Bases
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation"
] | null | null |
After seeing the "ALL YOUR BASE ARE BELONG TO US" meme for the first time, numbers *X* and *Y* realised that they have different bases, which complicated their relations.
You're given a number *X* represented in base *b**x* and a number *Y* represented in base *b**y*. Compare those two numbers.
|
The first line of the input contains two space-separated integers *n* and *b**x* (1<=≤<=*n*<=≤<=10, 2<=≤<=*b**x*<=≤<=40), where *n* is the number of digits in the *b**x*-based representation of *X*.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=<<=*b**x*) — the digits of *X*. They are given in the order from the most significant digit to the least significant one.
The following two lines describe *Y* in the same way: the third line contains two space-separated integers *m* and *b**y* (1<=≤<=*m*<=≤<=10, 2<=≤<=*b**y*<=≤<=40, *b**x*<=≠<=*b**y*), where *m* is the number of digits in the *b**y*-based representation of *Y*, and the fourth line contains *m* space-separated integers *y*1,<=*y*2,<=...,<=*y**m* (0<=≤<=*y**i*<=<<=*b**y*) — the digits of *Y*.
There will be no leading zeroes. Both *X* and *Y* will be positive. All digits of both numbers are given in the standard decimal numeral system.
|
Output a single character (quotes for clarity):
- '<' if *X*<=<<=*Y* - '>' if *X*<=><=*Y* - '=' if *X*<==<=*Y*
|
[
"6 2\n1 0 1 1 1 1\n2 10\n4 7\n",
"3 3\n1 0 2\n2 5\n2 4\n",
"7 16\n15 15 4 0 0 7 10\n7 9\n4 8 0 3 1 5 0\n"
] |
[
"=\n",
"<\n",
">\n"
] |
In the first sample, *X* = 101111<sub class="lower-index">2</sub> = 47<sub class="lower-index">10</sub> = *Y*.
In the second sample, *X* = 102<sub class="lower-index">3</sub> = 21<sub class="lower-index">5</sub> and *Y* = 24<sub class="lower-index">5</sub> = 112<sub class="lower-index">3</sub>, thus *X* < *Y*.
In the third sample, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/603a342b0ae3e56fed542d1c50c0a5ff6ce2cbaa.png" style="max-width: 100.0%;max-height: 100.0%;"/> and *Y* = 4803150<sub class="lower-index">9</sub>. We may notice that *X* starts with much larger digits and *b*<sub class="lower-index">*x*</sub> is much larger than *b*<sub class="lower-index">*y*</sub>, so *X* is clearly larger than *Y*.
| 500
|
[
{
"input": "6 2\n1 0 1 1 1 1\n2 10\n4 7",
"output": "="
},
{
"input": "3 3\n1 0 2\n2 5\n2 4",
"output": "<"
},
{
"input": "7 16\n15 15 4 0 0 7 10\n7 9\n4 8 0 3 1 5 0",
"output": ">"
},
{
"input": "2 2\n1 0\n2 3\n1 0",
"output": "<"
},
{
"input": "2 2\n1 0\n1 3\n1",
"output": ">"
},
{
"input": "10 2\n1 0 1 0 1 0 1 0 1 0\n10 3\n2 2 2 2 2 2 2 2 2 2",
"output": "<"
},
{
"input": "10 16\n15 15 4 0 0 0 0 7 10 9\n7 9\n4 8 0 3 1 5 0",
"output": ">"
},
{
"input": "5 5\n4 4 4 4 4\n4 6\n5 5 5 5",
"output": ">"
},
{
"input": "2 8\n1 0\n4 2\n1 0 0 0",
"output": "="
},
{
"input": "5 2\n1 0 0 0 1\n6 8\n1 4 7 2 0 0",
"output": "<"
},
{
"input": "6 7\n1 1 2 1 2 1\n6 6\n2 3 2 2 2 2",
"output": "="
},
{
"input": "9 35\n34 3 20 29 27 30 2 8 5\n7 33\n17 3 22 31 1 11 6",
"output": ">"
},
{
"input": "1 8\n5\n9 27\n23 23 23 23 23 23 23 23 23",
"output": "<"
},
{
"input": "4 7\n3 0 6 6\n3 11\n7 10 10",
"output": ">"
},
{
"input": "1 40\n1\n2 5\n1 0",
"output": "<"
},
{
"input": "1 36\n35\n4 5\n2 4 4 1",
"output": "<"
},
{
"input": "1 30\n1\n1 31\n1",
"output": "="
},
{
"input": "1 3\n1\n1 2\n1",
"output": "="
},
{
"input": "1 2\n1\n1 40\n1",
"output": "="
},
{
"input": "6 29\n1 1 1 1 1 1\n10 21\n1 1 1 1 1 1 1 1 1 1",
"output": "<"
},
{
"input": "3 5\n1 0 0\n3 3\n2 2 2",
"output": "<"
},
{
"input": "2 8\n1 0\n2 3\n2 2",
"output": "="
},
{
"input": "2 4\n3 3\n2 15\n1 0",
"output": "="
},
{
"input": "2 35\n1 0\n2 6\n5 5",
"output": "="
},
{
"input": "2 6\n5 5\n2 34\n1 0",
"output": ">"
},
{
"input": "2 7\n1 0\n2 3\n2 2",
"output": "<"
},
{
"input": "2 2\n1 0\n1 3\n2",
"output": "="
},
{
"input": "2 9\n5 5\n4 3\n1 0 0 0",
"output": ">"
},
{
"input": "1 24\n6\n3 9\n1 1 1",
"output": "<"
},
{
"input": "5 37\n9 9 9 9 9\n6 27\n13 0 0 0 0 0",
"output": "<"
},
{
"input": "10 2\n1 1 1 1 1 1 1 1 1 1\n10 34\n14 14 14 14 14 14 14 14 14 14",
"output": "<"
},
{
"input": "7 26\n8 0 0 0 0 0 0\n9 9\n3 3 3 3 3 3 3 3 3",
"output": ">"
},
{
"input": "2 40\n2 0\n5 13\n4 0 0 0 0",
"output": "<"
},
{
"input": "1 22\n15\n10 14\n3 3 3 3 3 3 3 3 3 3",
"output": "<"
},
{
"input": "10 22\n3 3 3 3 3 3 3 3 3 3\n3 40\n19 19 19",
"output": ">"
},
{
"input": "2 29\n11 11\n6 26\n11 11 11 11 11 11",
"output": "<"
},
{
"input": "5 3\n1 0 0 0 0\n4 27\n1 0 0 0",
"output": "<"
},
{
"input": "10 3\n1 0 0 0 0 0 0 0 0 0\n8 13\n1 0 0 0 0 0 0 0",
"output": "<"
},
{
"input": "4 20\n1 1 1 1\n5 22\n1 1 1 1 1",
"output": "<"
},
{
"input": "10 39\n34 2 24 34 11 6 33 12 22 21\n10 36\n25 35 17 24 30 0 1 32 14 35",
"output": ">"
},
{
"input": "10 39\n35 12 31 35 28 27 25 8 22 25\n10 40\n23 21 18 12 15 29 38 32 4 8",
"output": ">"
},
{
"input": "10 38\n16 19 37 32 16 7 14 33 16 11\n10 39\n10 27 35 15 31 15 17 16 38 35",
"output": ">"
},
{
"input": "10 39\n20 12 10 32 24 14 37 35 10 38\n9 40\n1 13 0 10 22 20 1 5 35",
"output": ">"
},
{
"input": "10 40\n18 1 2 25 28 2 10 2 17 37\n10 39\n37 8 12 8 21 11 23 11 25 21",
"output": "<"
},
{
"input": "9 39\n10 20 16 36 30 29 28 9 8\n9 38\n12 36 10 22 6 3 19 12 34",
"output": "="
},
{
"input": "7 39\n28 16 13 25 19 23 4\n7 38\n33 8 2 19 3 21 14",
"output": "="
},
{
"input": "10 16\n15 15 4 0 0 0 0 7 10 9\n10 9\n4 8 0 3 1 5 4 8 1 0",
"output": ">"
},
{
"input": "7 22\n1 13 9 16 7 13 3\n4 4\n3 0 2 1",
"output": ">"
},
{
"input": "10 29\n10 19 8 27 1 24 13 15 13 26\n2 28\n20 14",
"output": ">"
},
{
"input": "6 16\n2 13 7 13 15 6\n10 22\n17 17 21 9 16 11 4 4 13 17",
"output": "<"
},
{
"input": "8 26\n6 6 17 25 24 8 8 25\n4 27\n24 7 5 24",
"output": ">"
},
{
"input": "10 23\n5 21 4 15 12 7 10 7 16 21\n4 17\n3 11 1 14",
"output": ">"
},
{
"input": "10 21\n4 7 7 2 13 7 19 19 18 19\n3 31\n6 11 28",
"output": ">"
},
{
"input": "1 30\n9\n7 37\n20 11 18 14 0 36 27",
"output": "<"
},
{
"input": "5 35\n22 18 28 29 11\n2 3\n2 0",
"output": ">"
},
{
"input": "7 29\n14 26 14 22 11 11 8\n6 28\n2 12 10 17 0 14",
"output": ">"
},
{
"input": "2 37\n25 2\n3 26\n13 13 12",
"output": "<"
},
{
"input": "8 8\n4 0 4 3 4 1 5 6\n8 24\n19 8 15 6 10 7 2 18",
"output": "<"
},
{
"input": "4 22\n18 16 1 2\n10 26\n23 0 12 24 16 2 24 25 1 11",
"output": "<"
},
{
"input": "7 31\n14 6 16 6 26 18 17\n7 24\n22 10 4 5 14 6 9",
"output": ">"
},
{
"input": "10 29\n15 22 0 5 11 12 17 22 4 27\n4 22\n9 2 8 14",
"output": ">"
},
{
"input": "2 10\n6 0\n10 26\n16 14 8 18 24 4 9 5 22 25",
"output": "<"
},
{
"input": "7 2\n1 0 0 0 1 0 1\n9 6\n1 1 5 1 2 5 3 5 3",
"output": "<"
},
{
"input": "3 9\n2 5 4\n1 19\n15",
"output": ">"
},
{
"input": "6 16\n4 9 13 4 2 8\n4 10\n3 5 2 4",
"output": ">"
},
{
"input": "2 12\n1 4\n8 16\n4 4 10 6 15 10 8 15",
"output": "<"
},
{
"input": "3 19\n9 18 16\n4 10\n4 3 5 4",
"output": "<"
},
{
"input": "7 3\n1 1 2 1 2 0 2\n2 2\n1 0",
"output": ">"
},
{
"input": "3 2\n1 1 1\n1 3\n1",
"output": ">"
},
{
"input": "4 4\n1 3 1 3\n9 3\n1 1 0 1 2 2 2 2 1",
"output": "<"
},
{
"input": "9 3\n1 0 0 1 1 0 0 1 2\n6 4\n1 2 0 1 3 2",
"output": ">"
},
{
"input": "3 5\n1 1 3\n10 4\n3 3 2 3 0 0 0 3 1 1",
"output": "<"
},
{
"input": "6 4\n3 3 2 2 0 2\n6 5\n1 1 1 1 0 3",
"output": ">"
},
{
"input": "6 5\n4 4 4 3 1 3\n7 6\n4 2 2 2 5 0 4",
"output": "<"
},
{
"input": "2 5\n3 3\n6 6\n4 2 0 1 1 0",
"output": "<"
},
{
"input": "10 6\n3 5 4 2 4 2 3 5 4 2\n10 7\n3 2 1 1 3 1 0 3 4 5",
"output": "<"
},
{
"input": "9 7\n2 0 3 2 6 6 1 4 3\n9 6\n4 4 1 1 4 5 5 0 2",
"output": ">"
},
{
"input": "1 7\n2\n4 8\n3 2 3 2",
"output": "<"
},
{
"input": "2 8\n4 1\n1 7\n1",
"output": ">"
},
{
"input": "1 10\n7\n3 9\n2 1 7",
"output": "<"
},
{
"input": "9 9\n2 2 3 6 3 6 3 8 4\n6 10\n4 7 7 0 3 8",
"output": ">"
},
{
"input": "3 11\n6 5 2\n8 10\n5 0 1 8 3 5 1 4",
"output": "<"
},
{
"input": "6 11\n10 6 1 0 2 2\n9 10\n4 3 4 1 1 6 3 4 1",
"output": "<"
},
{
"input": "2 19\n4 8\n8 18\n7 8 6 8 4 11 9 1",
"output": "<"
},
{
"input": "2 24\n20 9\n10 23\n21 10 15 11 6 8 20 16 14 11",
"output": "<"
},
{
"input": "8 36\n23 5 27 1 10 7 26 27\n10 35\n28 33 9 22 10 28 26 4 27 29",
"output": "<"
},
{
"input": "6 37\n22 15 14 10 1 8\n6 36\n18 5 28 10 1 17",
"output": ">"
},
{
"input": "5 38\n1 31 2 21 21\n9 37\n8 36 32 30 13 9 24 2 35",
"output": "<"
},
{
"input": "3 39\n27 4 3\n8 38\n32 15 11 34 35 27 30 15",
"output": "<"
},
{
"input": "2 40\n22 38\n5 39\n8 9 32 4 1",
"output": "<"
},
{
"input": "9 37\n1 35 7 33 20 21 26 24 5\n10 40\n39 4 11 9 33 12 26 32 11 8",
"output": "<"
},
{
"input": "4 39\n13 25 23 35\n6 38\n19 36 20 4 12 33",
"output": "<"
},
{
"input": "5 37\n29 29 5 7 27\n3 39\n13 1 10",
"output": ">"
},
{
"input": "7 28\n1 10 7 0 13 14 11\n6 38\n8 11 27 5 14 35",
"output": "="
},
{
"input": "2 34\n1 32\n2 33\n2 0",
"output": "="
},
{
"input": "7 5\n4 0 4 1 3 0 4\n4 35\n1 18 7 34",
"output": "="
},
{
"input": "9 34\n5 8 4 4 26 1 30 5 24\n10 27\n1 6 3 10 8 13 22 3 12 8",
"output": "="
},
{
"input": "10 36\n1 13 13 23 31 35 5 32 18 21\n9 38\n32 1 20 14 12 37 13 15 23",
"output": "="
},
{
"input": "10 40\n1 1 14 5 6 3 3 11 3 25\n10 39\n1 11 24 33 25 34 38 29 27 33",
"output": "="
},
{
"input": "9 37\n2 6 1 9 19 6 11 28 35\n9 40\n1 6 14 37 1 8 31 4 9",
"output": "="
},
{
"input": "4 5\n1 4 2 0\n4 4\n3 2 2 3",
"output": "="
},
{
"input": "6 4\n1 1 1 2 2 2\n7 3\n1 2 2 0 1 0 0",
"output": "="
},
{
"input": "2 5\n3 3\n5 2\n1 0 0 1 0",
"output": "="
},
{
"input": "1 9\n2\n1 10\n2",
"output": "="
},
{
"input": "6 19\n4 9 14 1 3 1\n8 10\n1 1 1 7 3 7 3 0",
"output": "="
},
{
"input": "7 15\n8 5 8 10 13 6 13\n8 13\n1 6 9 10 12 3 12 8",
"output": "="
},
{
"input": "8 18\n1 1 4 15 7 4 9 3\n8 17\n1 10 2 10 3 11 14 10",
"output": "="
},
{
"input": "8 21\n5 19 0 14 13 13 10 5\n10 13\n1 0 0 6 11 10 8 2 8 1",
"output": "="
},
{
"input": "8 28\n3 1 10 19 10 14 21 15\n8 21\n14 0 18 13 2 1 18 6",
"output": ">"
},
{
"input": "7 34\n21 22 28 16 30 4 27\n7 26\n5 13 21 10 8 12 10",
"output": ">"
},
{
"input": "6 26\n7 6 4 18 6 1\n6 25\n5 3 11 1 8 15",
"output": ">"
},
{
"input": "10 31\n6 27 17 22 14 16 25 9 13 26\n10 39\n6 1 3 26 12 32 28 19 9 19",
"output": "<"
},
{
"input": "3 5\n2 2 3\n3 6\n4 3 5",
"output": "<"
},
{
"input": "2 24\n4 18\n2 40\n29 24",
"output": "<"
},
{
"input": "5 38\n2 24 34 14 17\n8 34\n4 24 31 2 14 15 8 15",
"output": "<"
},
{
"input": "9 40\n39 39 39 39 39 39 39 39 39\n6 35\n34 34 34 34 34 34",
"output": ">"
},
{
"input": "10 40\n39 39 39 39 39 39 39 39 39 39\n10 8\n7 7 7 7 7 7 7 7 7 7",
"output": ">"
},
{
"input": "10 40\n39 39 39 39 39 39 39 39 39 39\n10 39\n38 38 38 38 38 38 38 38 38 38",
"output": ">"
}
] | 1,448,385,380
| 2,480
|
Python 3
|
OK
|
TESTS
| 118
| 62
| 0
|
n, bx = map(int, input().split())
summa1 = 0
s = list(map(int, input().split()))
for i in range(n):
a = s[i]
summa1 += bx ** (n - i - 1) * a
m, by = map(int, input().split())
summa2 = 0
s = list(map(int, input().split()))
for i in range(m):
a = s[i]
summa2 += by ** (m - i - 1) * a
if summa1 > summa2:
print('>')
elif summa2 == summa1:
print('=')
else:
print('<')
|
Title: Two Bases
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After seeing the "ALL YOUR BASE ARE BELONG TO US" meme for the first time, numbers *X* and *Y* realised that they have different bases, which complicated their relations.
You're given a number *X* represented in base *b**x* and a number *Y* represented in base *b**y*. Compare those two numbers.
Input Specification:
The first line of the input contains two space-separated integers *n* and *b**x* (1<=≤<=*n*<=≤<=10, 2<=≤<=*b**x*<=≤<=40), where *n* is the number of digits in the *b**x*-based representation of *X*.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=<<=*b**x*) — the digits of *X*. They are given in the order from the most significant digit to the least significant one.
The following two lines describe *Y* in the same way: the third line contains two space-separated integers *m* and *b**y* (1<=≤<=*m*<=≤<=10, 2<=≤<=*b**y*<=≤<=40, *b**x*<=≠<=*b**y*), where *m* is the number of digits in the *b**y*-based representation of *Y*, and the fourth line contains *m* space-separated integers *y*1,<=*y*2,<=...,<=*y**m* (0<=≤<=*y**i*<=<<=*b**y*) — the digits of *Y*.
There will be no leading zeroes. Both *X* and *Y* will be positive. All digits of both numbers are given in the standard decimal numeral system.
Output Specification:
Output a single character (quotes for clarity):
- '<' if *X*<=<<=*Y* - '>' if *X*<=><=*Y* - '=' if *X*<==<=*Y*
Demo Input:
['6 2\n1 0 1 1 1 1\n2 10\n4 7\n', '3 3\n1 0 2\n2 5\n2 4\n', '7 16\n15 15 4 0 0 7 10\n7 9\n4 8 0 3 1 5 0\n']
Demo Output:
['=\n', '<\n', '>\n']
Note:
In the first sample, *X* = 101111<sub class="lower-index">2</sub> = 47<sub class="lower-index">10</sub> = *Y*.
In the second sample, *X* = 102<sub class="lower-index">3</sub> = 21<sub class="lower-index">5</sub> and *Y* = 24<sub class="lower-index">5</sub> = 112<sub class="lower-index">3</sub>, thus *X* < *Y*.
In the third sample, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/603a342b0ae3e56fed542d1c50c0a5ff6ce2cbaa.png" style="max-width: 100.0%;max-height: 100.0%;"/> and *Y* = 4803150<sub class="lower-index">9</sub>. We may notice that *X* starts with much larger digits and *b*<sub class="lower-index">*x*</sub> is much larger than *b*<sub class="lower-index">*y*</sub>, so *X* is clearly larger than *Y*.
|
```python
n, bx = map(int, input().split())
summa1 = 0
s = list(map(int, input().split()))
for i in range(n):
a = s[i]
summa1 += bx ** (n - i - 1) * a
m, by = map(int, input().split())
summa2 = 0
s = list(map(int, input().split()))
for i in range(m):
a = s[i]
summa2 += by ** (m - i - 1) * a
if summa1 > summa2:
print('>')
elif summa2 == summa1:
print('=')
else:
print('<')
```
| 3
|
|
721
|
A
|
One-dimensional Japanese Crossword
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=×<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)).
Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=×<=*n*), which he wants to encrypt in the same way as in japanese crossword.
Help Adaltik find the numbers encrypting the row he drew.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W' — to white square in the row that Adaltik drew).
|
The first line should contain a single integer *k* — the number of integers encrypting the row, e.g. the number of groups of black squares in the row.
The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right.
|
[
"3\nBBW\n",
"5\nBWBWB\n",
"4\nWWWW\n",
"4\nBBBB\n",
"13\nWBBBBWWBWBBBW\n"
] |
[
"1\n2 ",
"3\n1 1 1 ",
"0\n",
"1\n4 ",
"3\n4 1 3 "
] |
The last sample case correspond to the picture in the statement.
| 500
|
[
{
"input": "3\nBBW",
"output": "1\n2 "
},
{
"input": "5\nBWBWB",
"output": "3\n1 1 1 "
},
{
"input": "4\nWWWW",
"output": "0"
},
{
"input": "4\nBBBB",
"output": "1\n4 "
},
{
"input": "13\nWBBBBWWBWBBBW",
"output": "3\n4 1 3 "
},
{
"input": "1\nB",
"output": "1\n1 "
},
{
"input": "2\nBB",
"output": "1\n2 "
},
{
"input": "100\nWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWB",
"output": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "1\nW",
"output": "0"
},
{
"input": "2\nWW",
"output": "0"
},
{
"input": "2\nWB",
"output": "1\n1 "
},
{
"input": "2\nBW",
"output": "1\n1 "
},
{
"input": "3\nBBB",
"output": "1\n3 "
},
{
"input": "3\nBWB",
"output": "2\n1 1 "
},
{
"input": "3\nWBB",
"output": "1\n2 "
},
{
"input": "3\nWWB",
"output": "1\n1 "
},
{
"input": "3\nWBW",
"output": "1\n1 "
},
{
"input": "3\nBWW",
"output": "1\n1 "
},
{
"input": "3\nWWW",
"output": "0"
},
{
"input": "100\nBBBWWWWWWBBWWBBWWWBBWBBBBBBBBBBBWBBBWBBWWWBBWWBBBWBWWBBBWWBBBWBBBBBWWWBWWBBWWWWWWBWBBWWBWWWBWBWWWWWB",
"output": "21\n3 2 2 2 11 3 2 2 3 1 3 3 5 1 2 1 2 1 1 1 1 "
},
{
"input": "5\nBBBWB",
"output": "2\n3 1 "
},
{
"input": "5\nBWWWB",
"output": "2\n1 1 "
},
{
"input": "5\nWWWWB",
"output": "1\n1 "
},
{
"input": "5\nBWWWW",
"output": "1\n1 "
},
{
"input": "5\nBBBWW",
"output": "1\n3 "
},
{
"input": "5\nWWBBB",
"output": "1\n3 "
},
{
"input": "10\nBBBBBWWBBB",
"output": "2\n5 3 "
},
{
"input": "10\nBBBBWBBWBB",
"output": "3\n4 2 2 "
},
{
"input": "20\nBBBBBWWBWBBWBWWBWBBB",
"output": "6\n5 1 2 1 1 3 "
},
{
"input": "20\nBBBWWWWBBWWWBWBWWBBB",
"output": "5\n3 2 1 1 3 "
},
{
"input": "20\nBBBBBBBBWBBBWBWBWBBB",
"output": "5\n8 3 1 1 3 "
},
{
"input": "20\nBBBWBWBWWWBBWWWWBWBB",
"output": "6\n3 1 1 2 1 2 "
},
{
"input": "40\nBBBBBBWWWWBWBWWWBWWWWWWWWWWWBBBBBBBBBBBB",
"output": "5\n6 1 1 1 12 "
},
{
"input": "40\nBBBBBWBWWWBBWWWBWBWWBBBBWWWWBWBWBBBBBBBB",
"output": "9\n5 1 2 1 1 4 1 1 8 "
},
{
"input": "50\nBBBBBBBBBBBWWWWBWBWWWWBBBBBBBBWWWWWWWBWWWWBWBBBBBB",
"output": "7\n11 1 1 8 1 1 6 "
},
{
"input": "50\nWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW",
"output": "0"
},
{
"input": "50\nBBBBBWWWWWBWWWBWWWWWBWWWBWWWWWWBBWBBWWWWBWWWWWWWBW",
"output": "9\n5 1 1 1 1 2 2 1 1 "
},
{
"input": "50\nWWWWBWWBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWBWWWWWWWBBBBB",
"output": "6\n1 1 1 1 1 5 "
},
{
"input": "50\nBBBBBWBWBWWBWBWWWWWWBWBWBWWWWWWWWWWWWWBWBWWWWBWWWB",
"output": "12\n5 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n50 "
},
{
"input": "100\nBBBBBBBBBBBWBWWWWBWWBBWBBWWWWWWWWWWBWBWWBWWWWWWWWWWWBBBWWBBWWWWWBWBWWWWBWWWWWWWWWWWBWWWWWBBBBBBBBBBB",
"output": "15\n11 1 1 2 2 1 1 1 3 2 1 1 1 1 11 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n100 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBWBWBWWWWWBWWWWWWWWWWWWWWBBWWWBWWWWBWWBWWWWWWBWWWWWWWWWWWWWBWBBBBBBBBBBBBBBBBBBBB",
"output": "11\n20 1 1 1 2 1 1 1 1 1 20 "
},
{
"input": "100\nBBBBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWWWWWBWBWWWWWWBBWWWWWWWWWWWWBWWWWBWWWWWWWWWWWWBWWWWWWWBWWWWWWWBBBBBB",
"output": "11\n4 1 1 1 1 2 1 1 1 1 6 "
},
{
"input": "5\nBWBWB",
"output": "3\n1 1 1 "
},
{
"input": "10\nWWBWWWBWBB",
"output": "3\n1 1 2 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n50 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "2\n17 31 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "2\n24 42 "
},
{
"input": "90\nWWBWWBWBBWBBWWBWBWBBBWBWBBBWBWBWBWBWBWBWBWBBBBBWBBWWWWBWBBWBWWBBBWBWBWWBWBWBWBWWWWWWBWBBBB",
"output": "30\n1 1 2 2 1 1 3 1 3 1 1 1 1 1 1 1 5 2 1 2 1 3 1 1 1 1 1 1 1 4 "
},
{
"input": "100\nBWWWBWBWBBBBBWBWWBWBWWWBWBWBWWBBWWBBBWBBBWWBWBWWBBBBWBWBBBWBWBBWWWWWWBWWBBBBWBWBWWBWBWWWBWBWWBWBWWWB",
"output": "31\n1 1 1 5 1 1 1 1 1 1 2 3 3 1 1 4 1 3 1 2 1 4 1 1 1 1 1 1 1 1 1 "
},
{
"input": "90\nWBWBBBBBBWWWBBWWBWWWBBWWBWWWBWBBWBWBBWWWWBWBWBBWBBWBWWWBBWBBWWWWBWBBWWWBBBWBBWBWBBBBWWBWWB",
"output": "25\n1 6 2 1 2 1 1 2 1 2 1 1 2 2 1 2 2 1 2 3 2 1 4 1 1 "
},
{
"input": "80\nBBWWBBBWBBWWWWBBWBWBBWWWWWBWBBWWBWBWBWBWBWWBWWBWWWBWBBWBBWBBWBBBWWBBBBBBBWBBBWBB",
"output": "23\n2 3 2 2 1 2 1 2 1 1 1 1 1 1 1 1 2 2 2 3 7 3 2 "
},
{
"input": "65\nWWWWBWWWBBBBBWWWWWWBBBWWBBBBWWWWWWWWBBBWWWWBWBWWBBWWWWBWWWBBWBBBB",
"output": "11\n1 5 3 4 3 1 1 2 1 2 4 "
}
] | 1,682,141,317
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 54
| 124
| 0
|
input()
s = [len(i) for i in input().split('W') if len(i) != 0]
if len(s) == 0:
print(len(s))
else:
print(len(s))
print(*s)
|
Title: One-dimensional Japanese Crossword
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=×<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)).
Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=×<=*n*), which he wants to encrypt in the same way as in japanese crossword.
Help Adaltik find the numbers encrypting the row he drew.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W' — to white square in the row that Adaltik drew).
Output Specification:
The first line should contain a single integer *k* — the number of integers encrypting the row, e.g. the number of groups of black squares in the row.
The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right.
Demo Input:
['3\nBBW\n', '5\nBWBWB\n', '4\nWWWW\n', '4\nBBBB\n', '13\nWBBBBWWBWBBBW\n']
Demo Output:
['1\n2 ', '3\n1 1 1 ', '0\n', '1\n4 ', '3\n4 1 3 ']
Note:
The last sample case correspond to the picture in the statement.
|
```python
input()
s = [len(i) for i in input().split('W') if len(i) != 0]
if len(s) == 0:
print(len(s))
else:
print(len(s))
print(*s)
```
| 3
|
|
208
|
A
|
Dubstep
|
PROGRAMMING
| 900
|
[
"strings"
] | null | null |
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
|
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
|
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
|
[
"WUBWUBABCWUB\n",
"WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n"
] |
[
"ABC ",
"WE ARE THE CHAMPIONS MY FRIEND "
] |
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
| 500
|
[
{
"input": "WUBWUBABCWUB",
"output": "ABC "
},
{
"input": "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB",
"output": "WE ARE THE CHAMPIONS MY FRIEND "
},
{
"input": "WUBWUBWUBSR",
"output": "SR "
},
{
"input": "RWUBWUBWUBLWUB",
"output": "R L "
},
{
"input": "ZJWUBWUBWUBJWUBWUBWUBL",
"output": "ZJ J L "
},
{
"input": "CWUBBWUBWUBWUBEWUBWUBWUBQWUBWUBWUB",
"output": "C B E Q "
},
{
"input": "WUBJKDWUBWUBWBIRAQKFWUBWUBYEWUBWUBWUBWVWUBWUB",
"output": "JKD WBIRAQKF YE WV "
},
{
"input": "WUBKSDHEMIXUJWUBWUBRWUBWUBWUBSWUBWUBWUBHWUBWUBWUB",
"output": "KSDHEMIXUJ R S H "
},
{
"input": "OGWUBWUBWUBXWUBWUBWUBIWUBWUBWUBKOWUBWUB",
"output": "OG X I KO "
},
{
"input": "QWUBQQWUBWUBWUBIWUBWUBWWWUBWUBWUBJOPJPBRH",
"output": "Q QQ I WW JOPJPBRH "
},
{
"input": "VSRNVEATZTLGQRFEGBFPWUBWUBWUBAJWUBWUBWUBPQCHNWUBCWUB",
"output": "VSRNVEATZTLGQRFEGBFP AJ PQCHN C "
},
{
"input": "WUBWUBEWUBWUBWUBIQMJNIQWUBWUBWUBGZZBQZAUHYPWUBWUBWUBPMRWUBWUBWUBDCV",
"output": "E IQMJNIQ GZZBQZAUHYP PMR DCV "
},
{
"input": "WUBWUBWUBFVWUBWUBWUBBPSWUBWUBWUBRXNETCJWUBWUBWUBJDMBHWUBWUBWUBBWUBWUBVWUBWUBB",
"output": "FV BPS RXNETCJ JDMBH B V B "
},
{
"input": "WUBWUBWUBFBQWUBWUBWUBIDFSYWUBWUBWUBCTWDMWUBWUBWUBSXOWUBWUBWUBQIWUBWUBWUBL",
"output": "FBQ IDFSY CTWDM SXO QI L "
},
{
"input": "IWUBWUBQLHDWUBYIIKZDFQWUBWUBWUBCXWUBWUBUWUBWUBWUBKWUBWUBWUBNL",
"output": "I QLHD YIIKZDFQ CX U K NL "
},
{
"input": "KWUBUPDYXGOKUWUBWUBWUBAGOAHWUBIZDWUBWUBWUBIYWUBWUBWUBVWUBWUBWUBPWUBWUBWUBE",
"output": "K UPDYXGOKU AGOAH IZD IY V P E "
},
{
"input": "WUBWUBOWUBWUBWUBIPVCQAFWYWUBWUBWUBQWUBWUBWUBXHDKCPYKCTWWYWUBWUBWUBVWUBWUBWUBFZWUBWUB",
"output": "O IPVCQAFWY Q XHDKCPYKCTWWY V FZ "
},
{
"input": "PAMJGYWUBWUBWUBXGPQMWUBWUBWUBTKGSXUYWUBWUBWUBEWUBWUBWUBNWUBWUBWUBHWUBWUBWUBEWUBWUB",
"output": "PAMJGY XGPQM TKGSXUY E N H E "
},
{
"input": "WUBYYRTSMNWUWUBWUBWUBCWUBWUBWUBCWUBWUBWUBFSYUINDWOBVWUBWUBWUBFWUBWUBWUBAUWUBWUBWUBVWUBWUBWUBJB",
"output": "YYRTSMNWU C C FSYUINDWOBV F AU V JB "
},
{
"input": "WUBWUBYGPYEYBNRTFKOQCWUBWUBWUBUYGRTQEGWLFYWUBWUBWUBFVWUBHPWUBWUBWUBXZQWUBWUBWUBZDWUBWUBWUBM",
"output": "YGPYEYBNRTFKOQC UYGRTQEGWLFY FV HP XZQ ZD M "
},
{
"input": "WUBZVMJWUBWUBWUBFOIMJQWKNZUBOFOFYCCWUBWUBWUBAUWWUBRDRADWUBWUBWUBCHQVWUBWUBWUBKFTWUBWUBWUBW",
"output": "ZVMJ FOIMJQWKNZUBOFOFYCC AUW RDRAD CHQV KFT W "
},
{
"input": "WUBWUBZBKOKHQLGKRVIMZQMQNRWUBWUBWUBDACWUBWUBNZHFJMPEYKRVSWUBWUBWUBPPHGAVVPRZWUBWUBWUBQWUBWUBAWUBG",
"output": "ZBKOKHQLGKRVIMZQMQNR DAC NZHFJMPEYKRVS PPHGAVVPRZ Q A G "
},
{
"input": "WUBWUBJWUBWUBWUBNFLWUBWUBWUBGECAWUBYFKBYJWTGBYHVSSNTINKWSINWSMAWUBWUBWUBFWUBWUBWUBOVWUBWUBLPWUBWUBWUBN",
"output": "J NFL GECA YFKBYJWTGBYHVSSNTINKWSINWSMA F OV LP N "
},
{
"input": "WUBWUBLCWUBWUBWUBZGEQUEATJVIXETVTWUBWUBWUBEXMGWUBWUBWUBRSWUBWUBWUBVWUBWUBWUBTAWUBWUBWUBCWUBWUBWUBQG",
"output": "LC ZGEQUEATJVIXETVT EXMG RS V TA C QG "
},
{
"input": "WUBMPWUBWUBWUBORWUBWUBDLGKWUBWUBWUBVVZQCAAKVJTIKWUBWUBWUBTJLUBZJCILQDIFVZWUBWUBYXWUBWUBWUBQWUBWUBWUBLWUB",
"output": "MP OR DLGK VVZQCAAKVJTIK TJLUBZJCILQDIFVZ YX Q L "
},
{
"input": "WUBNXOLIBKEGXNWUBWUBWUBUWUBGITCNMDQFUAOVLWUBWUBWUBAIJDJZJHFMPVTPOXHPWUBWUBWUBISCIOWUBWUBWUBGWUBWUBWUBUWUB",
"output": "NXOLIBKEGXN U GITCNMDQFUAOVL AIJDJZJHFMPVTPOXHP ISCIO G U "
},
{
"input": "WUBWUBNMMWCZOLYPNBELIYVDNHJUNINWUBWUBWUBDXLHYOWUBWUBWUBOJXUWUBWUBWUBRFHTGJCEFHCGWARGWUBWUBWUBJKWUBWUBSJWUBWUB",
"output": "NMMWCZOLYPNBELIYVDNHJUNIN DXLHYO OJXU RFHTGJCEFHCGWARG JK SJ "
},
{
"input": "SGWLYSAUJOJBNOXNWUBWUBWUBBOSSFWKXPDPDCQEWUBWUBWUBDIRZINODWUBWUBWUBWWUBWUBWUBPPHWUBWUBWUBRWUBWUBWUBQWUBWUBWUBJWUB",
"output": "SGWLYSAUJOJBNOXN BOSSFWKXPDPDCQE DIRZINOD W PPH R Q J "
},
{
"input": "TOWUBWUBWUBGBTBNWUBWUBWUBJVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSAWUBWUBWUBSWUBWUBWUBTOLVXWUBWUBWUBNHWUBWUBWUBO",
"output": "TO GBTBN JVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSA S TOLVX NH O "
},
{
"input": "WUBWUBWSPLAYSZSAUDSWUBWUBWUBUWUBWUBWUBKRWUBWUBWUBRSOKQMZFIYZQUWUBWUBWUBELSHUWUBWUBWUBUKHWUBWUBWUBQXEUHQWUBWUBWUBBWUBWUBWUBR",
"output": "WSPLAYSZSAUDS U KR RSOKQMZFIYZQU ELSHU UKH QXEUHQ B R "
},
{
"input": "WUBXEMWWVUHLSUUGRWUBWUBWUBAWUBXEGILZUNKWUBWUBWUBJDHHKSWUBWUBWUBDTSUYSJHWUBWUBWUBPXFWUBMOHNJWUBWUBWUBZFXVMDWUBWUBWUBZMWUBWUB",
"output": "XEMWWVUHLSUUGR A XEGILZUNK JDHHKS DTSUYSJH PXF MOHNJ ZFXVMD ZM "
},
{
"input": "BMBWUBWUBWUBOQKWUBWUBWUBPITCIHXHCKLRQRUGXJWUBWUBWUBVWUBWUBWUBJCWUBWUBWUBQJPWUBWUBWUBBWUBWUBWUBBMYGIZOOXWUBWUBWUBTAGWUBWUBHWUB",
"output": "BMB OQK PITCIHXHCKLRQRUGXJ V JC QJP B BMYGIZOOX TAG H "
},
{
"input": "CBZNWUBWUBWUBNHWUBWUBWUBYQSYWUBWUBWUBMWUBWUBWUBXRHBTMWUBWUBWUBPCRCWUBWUBWUBTZUYLYOWUBWUBWUBCYGCWUBWUBWUBCLJWUBWUBWUBSWUBWUBWUB",
"output": "CBZN NH YQSY M XRHBTM PCRC TZUYLYO CYGC CLJ S "
},
{
"input": "DPDWUBWUBWUBEUQKWPUHLTLNXHAEKGWUBRRFYCAYZFJDCJLXBAWUBWUBWUBHJWUBOJWUBWUBWUBNHBJEYFWUBWUBWUBRWUBWUBWUBSWUBWWUBWUBWUBXDWUBWUBWUBJWUB",
"output": "DPD EUQKWPUHLTLNXHAEKG RRFYCAYZFJDCJLXBA HJ OJ NHBJEYF R S W XD J "
},
{
"input": "WUBWUBWUBISERPQITVIYERSCNWUBWUBWUBQWUBWUBWUBDGSDIPWUBWUBWUBCAHKDZWEXBIBJVVSKKVQJWUBWUBWUBKIWUBWUBWUBCWUBWUBWUBAWUBWUBWUBPWUBWUBWUBHWUBWUBWUBF",
"output": "ISERPQITVIYERSCN Q DGSDIP CAHKDZWEXBIBJVVSKKVQJ KI C A P H F "
},
{
"input": "WUBWUBWUBIWUBWUBLIKNQVWUBWUBWUBPWUBWUBWUBHWUBWUBWUBMWUBWUBWUBDPRSWUBWUBWUBBSAGYLQEENWXXVWUBWUBWUBXMHOWUBWUBWUBUWUBWUBWUBYRYWUBWUBWUBCWUBWUBWUBY",
"output": "I LIKNQV P H M DPRS BSAGYLQEENWXXV XMHO U YRY C Y "
},
{
"input": "WUBWUBWUBMWUBWUBWUBQWUBWUBWUBITCFEYEWUBWUBWUBHEUWGNDFNZGWKLJWUBWUBWUBMZPWUBWUBWUBUWUBWUBWUBBWUBWUBWUBDTJWUBHZVIWUBWUBWUBPWUBFNHHWUBWUBWUBVTOWUB",
"output": "M Q ITCFEYE HEUWGNDFNZGWKLJ MZP U B DTJ HZVI P FNHH VTO "
},
{
"input": "WUBWUBNDNRFHYJAAUULLHRRDEDHYFSRXJWUBWUBWUBMUJVDTIRSGYZAVWKRGIFWUBWUBWUBHMZWUBWUBWUBVAIWUBWUBWUBDDKJXPZRGWUBWUBWUBSGXWUBWUBWUBIFKWUBWUBWUBUWUBWUBWUBW",
"output": "NDNRFHYJAAUULLHRRDEDHYFSRXJ MUJVDTIRSGYZAVWKRGIF HMZ VAI DDKJXPZRG SGX IFK U W "
},
{
"input": "WUBOJMWRSLAXXHQRTPMJNCMPGWUBWUBWUBNYGMZIXNLAKSQYWDWUBWUBWUBXNIWUBWUBWUBFWUBWUBWUBXMBWUBWUBWUBIWUBWUBWUBINWUBWUBWUBWDWUBWUBWUBDDWUBWUBWUBD",
"output": "OJMWRSLAXXHQRTPMJNCMPG NYGMZIXNLAKSQYWD XNI F XMB I IN WD DD D "
},
{
"input": "WUBWUBWUBREHMWUBWUBWUBXWUBWUBWUBQASNWUBWUBWUBNLSMHLCMTICWUBWUBWUBVAWUBWUBWUBHNWUBWUBWUBNWUBWUBWUBUEXLSFOEULBWUBWUBWUBXWUBWUBWUBJWUBWUBWUBQWUBWUBWUBAWUBWUB",
"output": "REHM X QASN NLSMHLCMTIC VA HN N UEXLSFOEULB X J Q A "
},
{
"input": "WUBWUBWUBSTEZTZEFFIWUBWUBWUBSWUBWUBWUBCWUBFWUBHRJPVWUBWUBWUBDYJUWUBWUBWUBPWYDKCWUBWUBWUBCWUBWUBWUBUUEOGCVHHBWUBWUBWUBEXLWUBWUBWUBVCYWUBWUBWUBMWUBWUBWUBYWUB",
"output": "STEZTZEFFI S C F HRJPV DYJU PWYDKC C UUEOGCVHHB EXL VCY M Y "
},
{
"input": "WPPNMSQOQIWUBWUBWUBPNQXWUBWUBWUBHWUBWUBWUBNFLWUBWUBWUBGWSGAHVJFNUWUBWUBWUBFWUBWUBWUBWCMLRICFSCQQQTNBWUBWUBWUBSWUBWUBWUBKGWUBWUBWUBCWUBWUBWUBBMWUBWUBWUBRWUBWUB",
"output": "WPPNMSQOQI PNQX H NFL GWSGAHVJFNU F WCMLRICFSCQQQTNB S KG C BM R "
},
{
"input": "YZJOOYITZRARKVFYWUBWUBRZQGWUBWUBWUBUOQWUBWUBWUBIWUBWUBWUBNKVDTBOLETKZISTWUBWUBWUBWLWUBQQFMMGSONZMAWUBZWUBWUBWUBQZUXGCWUBWUBWUBIRZWUBWUBWUBLTTVTLCWUBWUBWUBY",
"output": "YZJOOYITZRARKVFY RZQG UOQ I NKVDTBOLETKZIST WL QQFMMGSONZMA Z QZUXGC IRZ LTTVTLC Y "
},
{
"input": "WUBCAXNCKFBVZLGCBWCOAWVWOFKZVQYLVTWUBWUBWUBNLGWUBWUBWUBAMGDZBDHZMRMQMDLIRMIWUBWUBWUBGAJSHTBSWUBWUBWUBCXWUBWUBWUBYWUBZLXAWWUBWUBWUBOHWUBWUBWUBZWUBWUBWUBGBWUBWUBWUBE",
"output": "CAXNCKFBVZLGCBWCOAWVWOFKZVQYLVT NLG AMGDZBDHZMRMQMDLIRMI GAJSHTBS CX Y ZLXAW OH Z GB E "
},
{
"input": "WUBWUBCHXSOWTSQWUBWUBWUBCYUZBPBWUBWUBWUBSGWUBWUBWKWORLRRLQYUUFDNWUBWUBWUBYYGOJNEVEMWUBWUBWUBRWUBWUBWUBQWUBWUBWUBIHCKWUBWUBWUBKTWUBWUBWUBRGSNTGGWUBWUBWUBXCXWUBWUBWUBS",
"output": "CHXSOWTSQ CYUZBPB SG WKWORLRRLQYUUFDN YYGOJNEVEM R Q IHCK KT RGSNTGG XCX S "
},
{
"input": "WUBWUBWUBHJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQWUBWUBWUBXTZKGIITWUBWUBWUBAWUBWUBWUBVNCXPUBCQWUBWUBWUBIDPNAWUBWUBWUBOWUBWUBWUBYGFWUBWUBWUBMQOWUBWUBWUBKWUBWUBWUBAZVWUBWUBWUBEP",
"output": "HJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQ XTZKGIIT A VNCXPUBCQ IDPNA O YGF MQO K AZV EP "
},
{
"input": "WUBKYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTVWUBWUBWUBLRMIIWUBWUBWUBGWUBWUBWUBADPSWUBWUBWUBANBWUBWUBPCWUBWUBWUBPWUBWUBWUBGPVNLSWIRFORYGAABUXMWUBWUBWUBOWUBWUBWUBNWUBWUBWUBYWUBWUB",
"output": "KYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTV LRMII G ADPS ANB PC P GPVNLSWIRFORYGAABUXM O N Y "
},
{
"input": "REWUBWUBWUBJDWUBWUBWUBNWUBWUBWUBTWWUBWUBWUBWZDOCKKWUBWUBWUBLDPOVBFRCFWUBWUBAKZIBQKEUAZEEWUBWUBWUBLQYPNPFWUBYEWUBWUBWUBFWUBWUBWUBBPWUBWUBWUBAWWUBWUBWUBQWUBWUBWUBBRWUBWUBWUBXJL",
"output": "RE JD N TW WZDOCKK LDPOVBFRCF AKZIBQKEUAZEE LQYPNPF YE F BP AW Q BR XJL "
},
{
"input": "CUFGJDXGMWUBWUBWUBOMWUBWUBWUBSIEWUBWUBWUBJJWKNOWUBWUBWUBYBHVNRNORGYWUBWUBWUBOAGCAWUBWUBWUBSBLBKTPFKPBIWUBWUBWUBJBWUBWUBWUBRMFCJPGWUBWUBWUBDWUBWUBWUBOJOWUBWUBWUBZPWUBWUBWUBMWUBRWUBWUBWUBFXWWUBWUBWUBO",
"output": "CUFGJDXGM OM SIE JJWKNO YBHVNRNORGY OAGCA SBLBKTPFKPBI JB RMFCJPG D OJO ZP M R FXW O "
},
{
"input": "WUBJZGAEXFMFEWMAKGQLUWUBWUBWUBICYTPQWGENELVYWANKUOJYWUBWUBWUBGWUBWUBWUBHYCJVLPHTUPNEGKCDGQWUBWUBWUBOFWUBWUBWUBCPGSOGZBRPRPVJJEWUBWUBWUBDQBCWUBWUBWUBHWUBWUBWUBMHOHYBMATWUBWUBWUBVWUBWUBWUBSWUBWUBWUBKOWU",
"output": "JZGAEXFMFEWMAKGQLU ICYTPQWGENELVYWANKUOJY G HYCJVLPHTUPNEGKCDGQ OF CPGSOGZBRPRPVJJE DQBC H MHOHYBMAT V S KOWU "
},
{
"input": "A",
"output": "A "
},
{
"input": "WUBA",
"output": "A "
},
{
"input": "WUBWUBA",
"output": "A "
},
{
"input": "AWUBWUBWUB",
"output": "A "
},
{
"input": "AWUBBWUBCWUBD",
"output": "A B C D "
},
{
"input": "WUBWWUBWUBWUBUWUBWUBBWUB",
"output": "W U B "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAWUBAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "WUWUBBWWUBUB",
"output": "WU BW UB "
},
{
"input": "WUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUABWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUB",
"output": "WUAB "
},
{
"input": "ZWUB",
"output": "Z "
},
{
"input": "WU",
"output": "WU "
},
{
"input": "UB",
"output": "UB "
},
{
"input": "U",
"output": "U "
},
{
"input": "WUBW",
"output": "W "
},
{
"input": "WUBWU",
"output": "WU "
},
{
"input": "WUWUB",
"output": "WU "
},
{
"input": "UBWUB",
"output": "UB "
},
{
"input": "WUWUBUBWUBUWUB",
"output": "WU UB U "
},
{
"input": "WUBWWUBAWUB",
"output": "W A "
},
{
"input": "WUUUUU",
"output": "WUUUUU "
}
] | 1,699,546,369
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 71
| 184
| 0
|
s=input()
l=s.split("WUB")
print(" ".join(l).strip())
|
Title: Dubstep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
Input Specification:
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
Output Specification:
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
Demo Input:
['WUBWUBABCWUB\n', 'WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n']
Demo Output:
['ABC ', 'WE ARE THE CHAMPIONS MY FRIEND ']
Note:
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
|
```python
s=input()
l=s.split("WUB")
print(" ".join(l).strip())
```
| 3
|
|
271
|
A
|
Beautiful Year
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
It seems like the year of 2013 came only yesterday. Do you know a curious fact? The year of 2013 is the first year after the old 1987 with only distinct digits.
Now you are suggested to solve the following problem: given a year number, find the minimum year number which is strictly larger than the given one and has only distinct digits.
|
The single line contains integer *y* (1000<=≤<=*y*<=≤<=9000) — the year number.
|
Print a single integer — the minimum year number that is strictly larger than *y* and all it's digits are distinct. It is guaranteed that the answer exists.
|
[
"1987\n",
"2013\n"
] |
[
"2013\n",
"2014\n"
] |
none
| 500
|
[
{
"input": "1987",
"output": "2013"
},
{
"input": "2013",
"output": "2014"
},
{
"input": "1000",
"output": "1023"
},
{
"input": "1001",
"output": "1023"
},
{
"input": "1234",
"output": "1235"
},
{
"input": "5555",
"output": "5601"
},
{
"input": "9000",
"output": "9012"
},
{
"input": "1111",
"output": "1203"
},
{
"input": "8999",
"output": "9012"
},
{
"input": "4572",
"output": "4573"
},
{
"input": "6666",
"output": "6701"
},
{
"input": "2001",
"output": "2013"
},
{
"input": "3000",
"output": "3012"
},
{
"input": "7712",
"output": "7801"
},
{
"input": "8088",
"output": "8091"
},
{
"input": "1594",
"output": "1596"
},
{
"input": "6016",
"output": "6017"
},
{
"input": "8800",
"output": "8901"
},
{
"input": "3331",
"output": "3401"
},
{
"input": "5090",
"output": "5091"
},
{
"input": "2342",
"output": "2345"
},
{
"input": "2334",
"output": "2340"
},
{
"input": "1123",
"output": "1203"
},
{
"input": "8989",
"output": "9012"
},
{
"input": "8977",
"output": "9012"
},
{
"input": "6869",
"output": "6870"
},
{
"input": "8999",
"output": "9012"
}
] | 1,694,836,338
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 27
| 92
| 0
|
y = int(input())
while True:
y += 1
s = str(y)
flag = True
for i in range(len(s)):
for j in range(i+1, len(s)):
if s[i] == s[j]:
flag = False
break
if not flag:
break
if flag:
print(y)
break
|
Title: Beautiful Year
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It seems like the year of 2013 came only yesterday. Do you know a curious fact? The year of 2013 is the first year after the old 1987 with only distinct digits.
Now you are suggested to solve the following problem: given a year number, find the minimum year number which is strictly larger than the given one and has only distinct digits.
Input Specification:
The single line contains integer *y* (1000<=≤<=*y*<=≤<=9000) — the year number.
Output Specification:
Print a single integer — the minimum year number that is strictly larger than *y* and all it's digits are distinct. It is guaranteed that the answer exists.
Demo Input:
['1987\n', '2013\n']
Demo Output:
['2013\n', '2014\n']
Note:
none
|
```python
y = int(input())
while True:
y += 1
s = str(y)
flag = True
for i in range(len(s)):
for j in range(i+1, len(s)):
if s[i] == s[j]:
flag = False
break
if not flag:
break
if flag:
print(y)
break
```
| 3
|
|
387
|
A
|
George and Sleep
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
George woke up and saw the current time *s* on the digital clock. Besides, George knows that he has slept for time *t*.
Help George! Write a program that will, given time *s* and *t*, determine the time *p* when George went to bed. Note that George could have gone to bed yesterday relatively to the current time (see the second test sample).
|
The first line contains current time *s* as a string in the format "hh:mm". The second line contains time *t* in the format "hh:mm" — the duration of George's sleep. It is guaranteed that the input contains the correct time in the 24-hour format, that is, 00<=≤<=*hh*<=≤<=23, 00<=≤<=*mm*<=≤<=59.
|
In the single line print time *p* — the time George went to bed in the format similar to the format of the time in the input.
|
[
"05:50\n05:44\n",
"00:00\n01:00\n",
"00:01\n00:00\n"
] |
[
"00:06\n",
"23:00\n",
"00:01\n"
] |
In the first sample George went to bed at "00:06". Note that you should print the time only in the format "00:06". That's why answers "0:06", "00:6" and others will be considered incorrect.
In the second sample, George went to bed yesterday.
In the third sample, George didn't do to bed at all.
| 500
|
[
{
"input": "05:50\n05:44",
"output": "00:06"
},
{
"input": "00:00\n01:00",
"output": "23:00"
},
{
"input": "00:01\n00:00",
"output": "00:01"
},
{
"input": "23:59\n23:59",
"output": "00:00"
},
{
"input": "23:44\n23:55",
"output": "23:49"
},
{
"input": "00:00\n13:12",
"output": "10:48"
},
{
"input": "12:00\n23:59",
"output": "12:01"
},
{
"input": "12:44\n12:44",
"output": "00:00"
},
{
"input": "05:55\n07:12",
"output": "22:43"
},
{
"input": "07:12\n05:55",
"output": "01:17"
},
{
"input": "22:22\n22:22",
"output": "00:00"
},
{
"input": "22:22\n22:23",
"output": "23:59"
},
{
"input": "23:24\n23:23",
"output": "00:01"
},
{
"input": "00:00\n00:00",
"output": "00:00"
},
{
"input": "23:30\n00:00",
"output": "23:30"
},
{
"input": "01:00\n00:00",
"output": "01:00"
},
{
"input": "05:44\n06:00",
"output": "23:44"
},
{
"input": "00:00\n23:59",
"output": "00:01"
},
{
"input": "21:00\n01:00",
"output": "20:00"
},
{
"input": "21:21\n12:21",
"output": "09:00"
},
{
"input": "12:21\n21:12",
"output": "15:09"
},
{
"input": "12:33\n23:33",
"output": "13:00"
},
{
"input": "07:55\n05:53",
"output": "02:02"
},
{
"input": "19:30\n02:00",
"output": "17:30"
},
{
"input": "21:30\n02:00",
"output": "19:30"
},
{
"input": "19:30\n09:30",
"output": "10:00"
},
{
"input": "13:08\n00:42",
"output": "12:26"
},
{
"input": "13:04\n09:58",
"output": "03:06"
},
{
"input": "21:21\n23:06",
"output": "22:15"
},
{
"input": "20:53\n10:23",
"output": "10:30"
},
{
"input": "12:59\n00:45",
"output": "12:14"
},
{
"input": "12:39\n22:21",
"output": "14:18"
},
{
"input": "21:10\n13:50",
"output": "07:20"
},
{
"input": "03:38\n23:46",
"output": "03:52"
},
{
"input": "03:48\n00:41",
"output": "03:07"
},
{
"input": "07:43\n12:27",
"output": "19:16"
},
{
"input": "03:23\n08:52",
"output": "18:31"
},
{
"input": "16:04\n10:28",
"output": "05:36"
},
{
"input": "12:53\n08:37",
"output": "04:16"
},
{
"input": "13:43\n17:23",
"output": "20:20"
},
{
"input": "00:00\n00:01",
"output": "23:59"
},
{
"input": "10:10\n01:01",
"output": "09:09"
},
{
"input": "10:05\n00:00",
"output": "10:05"
},
{
"input": "09:09\n00:00",
"output": "09:09"
},
{
"input": "09:10\n00:01",
"output": "09:09"
},
{
"input": "23:24\n00:28",
"output": "22:56"
},
{
"input": "10:00\n01:00",
"output": "09:00"
}
] | 1,445,198,580
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 47
| 108
| 307,200
|
s = [int(x) for x in input().split(":")]
t = [int(x) for x in input().split(":")]
s1 = s[0] * 60 + s[1] + 1440
t1 = t[0] * 60 + t[1]
p = (s1 - t1) % 1440
print("0" * (2 - len(str(p // 60))) + str(p // 60) + ":" + "0" * (2 - len(str(p % 60))) + str(p % 60))
|
Title: George and Sleep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
George woke up and saw the current time *s* on the digital clock. Besides, George knows that he has slept for time *t*.
Help George! Write a program that will, given time *s* and *t*, determine the time *p* when George went to bed. Note that George could have gone to bed yesterday relatively to the current time (see the second test sample).
Input Specification:
The first line contains current time *s* as a string in the format "hh:mm". The second line contains time *t* in the format "hh:mm" — the duration of George's sleep. It is guaranteed that the input contains the correct time in the 24-hour format, that is, 00<=≤<=*hh*<=≤<=23, 00<=≤<=*mm*<=≤<=59.
Output Specification:
In the single line print time *p* — the time George went to bed in the format similar to the format of the time in the input.
Demo Input:
['05:50\n05:44\n', '00:00\n01:00\n', '00:01\n00:00\n']
Demo Output:
['00:06\n', '23:00\n', '00:01\n']
Note:
In the first sample George went to bed at "00:06". Note that you should print the time only in the format "00:06". That's why answers "0:06", "00:6" and others will be considered incorrect.
In the second sample, George went to bed yesterday.
In the third sample, George didn't do to bed at all.
|
```python
s = [int(x) for x in input().split(":")]
t = [int(x) for x in input().split(":")]
s1 = s[0] * 60 + s[1] + 1440
t1 = t[0] * 60 + t[1]
p = (s1 - t1) % 1440
print("0" * (2 - len(str(p // 60))) + str(p // 60) + ":" + "0" * (2 - len(str(p % 60))) + str(p % 60))
```
| 3
|
|
660
|
A
|
Co-prime Array
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation",
"math",
"number theory"
] | null | null |
You are given an array of *n* elements, you must make it a co-prime array in as few moves as possible.
In each move you can insert any positive integral number you want not greater than 109 in any place in the array.
An array is co-prime if any two adjacent numbers of it are co-prime.
In the number theory, two integers *a* and *b* are said to be co-prime if the only positive integer that divides both of them is 1.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of elements in the given array.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the elements of the array *a*.
|
Print integer *k* on the first line — the least number of elements needed to add to the array *a* to make it co-prime.
The second line should contain *n*<=+<=*k* integers *a**j* — the elements of the array *a* after adding *k* elements to it. Note that the new array should be co-prime, so any two adjacent values should be co-prime. Also the new array should be got from the original array *a* by adding *k* elements to it.
If there are multiple answers you can print any one of them.
|
[
"3\n2 7 28\n"
] |
[
"1\n2 7 9 28\n"
] |
none
| 0
|
[
{
"input": "3\n2 7 28",
"output": "1\n2 7 1 28"
},
{
"input": "1\n1",
"output": "0\n1"
},
{
"input": "1\n548",
"output": "0\n548"
},
{
"input": "1\n963837006",
"output": "0\n963837006"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "0\n1 1 1 1 1 1 1 1 1 1"
},
{
"input": "10\n26 723 970 13 422 968 875 329 234 983",
"output": "2\n26 723 970 13 422 1 968 875 1 329 234 983"
},
{
"input": "10\n319645572 758298525 812547177 459359946 355467212 304450522 807957797 916787906 239781206 242840396",
"output": "7\n319645572 1 758298525 1 812547177 1 459359946 1 355467212 1 304450522 807957797 916787906 1 239781206 1 242840396"
},
{
"input": "100\n1 1 1 1 2 1 1 1 1 1 2 2 1 1 2 1 2 1 1 1 2 1 1 2 1 2 1 1 2 2 2 1 1 2 1 1 1 2 2 2 1 1 1 2 1 2 2 1 2 1 1 2 2 1 2 1 2 1 2 2 1 1 1 2 1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 1 1 1 1 2 2 2 2 2 2 2 1 1 1 2 1 2 1",
"output": "19\n1 1 1 1 2 1 1 1 1 1 2 1 2 1 1 2 1 2 1 1 1 2 1 1 2 1 2 1 1 2 1 2 1 2 1 1 2 1 1 1 2 1 2 1 2 1 1 1 2 1 2 1 2 1 2 1 1 2 1 2 1 2 1 2 1 2 1 2 1 1 1 2 1 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 1 1 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 1 1 2 1 2 1"
},
{
"input": "100\n591 417 888 251 792 847 685 3 182 461 102 348 555 956 771 901 712 878 580 631 342 333 285 899 525 725 537 718 929 653 84 788 104 355 624 803 253 853 201 995 536 184 65 205 540 652 549 777 248 405 677 950 431 580 600 846 328 429 134 983 526 103 500 963 400 23 276 704 570 757 410 658 507 620 984 244 486 454 802 411 985 303 635 283 96 597 855 775 139 839 839 61 219 986 776 72 729 69 20 917",
"output": "38\n591 1 417 1 888 251 792 1 847 685 3 182 461 102 1 348 1 555 956 771 901 712 1 878 1 580 631 342 1 333 1 285 899 525 1 725 537 718 929 653 84 1 788 1 104 355 624 803 1 253 853 201 995 536 1 184 65 1 205 1 540 1 652 549 1 777 248 405 677 950 431 580 1 600 1 846 1 328 429 134 983 526 103 500 963 400 23 1 276 1 704 1 570 757 410 1 658 507 620 1 984 1 244 1 486 1 454 1 802 411 985 303 635 283 96 1 597 1 855 1 775 139 839 1 839 61 219 986 1 776 1 72 1 729 1 69 20 917"
},
{
"input": "5\n472882027 472882027 472882027 472882027 472882027",
"output": "4\n472882027 1 472882027 1 472882027 1 472882027 1 472882027"
},
{
"input": "2\n1000000000 1000000000",
"output": "1\n1000000000 1 1000000000"
},
{
"input": "2\n8 6",
"output": "1\n8 1 6"
},
{
"input": "3\n100000000 1000000000 1000000000",
"output": "2\n100000000 1 1000000000 1 1000000000"
},
{
"input": "5\n1 2 3 4 5",
"output": "0\n1 2 3 4 5"
},
{
"input": "20\n2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000",
"output": "19\n2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000"
},
{
"input": "2\n223092870 23",
"output": "1\n223092870 1 23"
},
{
"input": "2\n100000003 100000003",
"output": "1\n100000003 1 100000003"
},
{
"input": "2\n999999937 999999937",
"output": "1\n999999937 1 999999937"
},
{
"input": "4\n999 999999937 999999937 999",
"output": "1\n999 999999937 1 999999937 999"
},
{
"input": "2\n999999929 999999929",
"output": "1\n999999929 1 999999929"
},
{
"input": "2\n1049459 2098918",
"output": "1\n1049459 1 2098918"
},
{
"input": "2\n352229 704458",
"output": "1\n352229 1 704458"
},
{
"input": "2\n7293 4011",
"output": "1\n7293 1 4011"
},
{
"input": "2\n5565651 3999930",
"output": "1\n5565651 1 3999930"
},
{
"input": "2\n997 997",
"output": "1\n997 1 997"
},
{
"input": "3\n9994223 9994223 9994223",
"output": "2\n9994223 1 9994223 1 9994223"
},
{
"input": "2\n99999998 1000000000",
"output": "1\n99999998 1 1000000000"
},
{
"input": "3\n1000000000 1000000000 1000000000",
"output": "2\n1000000000 1 1000000000 1 1000000000"
},
{
"input": "2\n130471 130471",
"output": "1\n130471 1 130471"
},
{
"input": "3\n1000000000 2 2",
"output": "2\n1000000000 1 2 1 2"
},
{
"input": "2\n223092870 66526",
"output": "1\n223092870 1 66526"
},
{
"input": "14\n1000000000 1000000000 223092870 223092870 6 105 2 2 510510 510510 999999491 999999491 436077930 570018449",
"output": "10\n1000000000 1 1000000000 1 223092870 1 223092870 1 6 1 105 2 1 2 1 510510 1 510510 999999491 1 999999491 436077930 1 570018449"
},
{
"input": "2\n3996017 3996017",
"output": "1\n3996017 1 3996017"
},
{
"input": "2\n999983 999983",
"output": "1\n999983 1 999983"
},
{
"input": "2\n618575685 773990454",
"output": "1\n618575685 1 773990454"
},
{
"input": "3\n9699690 3 7",
"output": "1\n9699690 1 3 7"
},
{
"input": "2\n999999999 999999996",
"output": "1\n999999999 1 999999996"
},
{
"input": "2\n99999910 99999910",
"output": "1\n99999910 1 99999910"
},
{
"input": "12\n1000000000 1000000000 223092870 223092870 6 105 2 2 510510 510510 999999491 999999491",
"output": "9\n1000000000 1 1000000000 1 223092870 1 223092870 1 6 1 105 2 1 2 1 510510 1 510510 999999491 1 999999491"
},
{
"input": "3\n999999937 999999937 999999937",
"output": "2\n999999937 1 999999937 1 999999937"
},
{
"input": "2\n99839 99839",
"output": "1\n99839 1 99839"
},
{
"input": "3\n19999909 19999909 19999909",
"output": "2\n19999909 1 19999909 1 19999909"
},
{
"input": "4\n1 1000000000 1 1000000000",
"output": "0\n1 1000000000 1 1000000000"
},
{
"input": "2\n64006 64006",
"output": "1\n64006 1 64006"
},
{
"input": "2\n1956955 1956955",
"output": "1\n1956955 1 1956955"
},
{
"input": "3\n1 1000000000 1000000000",
"output": "1\n1 1000000000 1 1000000000"
},
{
"input": "2\n982451707 982451707",
"output": "1\n982451707 1 982451707"
},
{
"input": "2\n999999733 999999733",
"output": "1\n999999733 1 999999733"
},
{
"input": "3\n999999733 999999733 999999733",
"output": "2\n999999733 1 999999733 1 999999733"
},
{
"input": "2\n3257 3257",
"output": "1\n3257 1 3257"
},
{
"input": "2\n223092870 181598",
"output": "1\n223092870 1 181598"
},
{
"input": "3\n959919409 105935 105935",
"output": "2\n959919409 1 105935 1 105935"
},
{
"input": "2\n510510 510510",
"output": "1\n510510 1 510510"
},
{
"input": "3\n223092870 1000000000 1000000000",
"output": "2\n223092870 1 1000000000 1 1000000000"
},
{
"input": "14\n1000000000 2 1000000000 3 1000000000 6 1000000000 1000000000 15 1000000000 1000000000 1000000000 100000000 1000",
"output": "11\n1000000000 1 2 1 1000000000 3 1000000000 1 6 1 1000000000 1 1000000000 1 15 1 1000000000 1 1000000000 1 1000000000 1 100000000 1 1000"
},
{
"input": "7\n1 982451653 982451653 1 982451653 982451653 982451653",
"output": "3\n1 982451653 1 982451653 1 982451653 1 982451653 1 982451653"
},
{
"input": "2\n100000007 100000007",
"output": "1\n100000007 1 100000007"
},
{
"input": "3\n999999757 999999757 999999757",
"output": "2\n999999757 1 999999757 1 999999757"
},
{
"input": "3\n99999989 99999989 99999989",
"output": "2\n99999989 1 99999989 1 99999989"
},
{
"input": "5\n2 4 982451707 982451707 3",
"output": "2\n2 1 4 982451707 1 982451707 3"
},
{
"input": "2\n20000014 20000014",
"output": "1\n20000014 1 20000014"
},
{
"input": "2\n99999989 99999989",
"output": "1\n99999989 1 99999989"
},
{
"input": "2\n111546435 111546435",
"output": "1\n111546435 1 111546435"
},
{
"input": "2\n55288874 33538046",
"output": "1\n55288874 1 33538046"
},
{
"input": "5\n179424673 179424673 179424673 179424673 179424673",
"output": "4\n179424673 1 179424673 1 179424673 1 179424673 1 179424673"
},
{
"input": "2\n199999978 199999978",
"output": "1\n199999978 1 199999978"
},
{
"input": "2\n1000000000 2",
"output": "1\n1000000000 1 2"
},
{
"input": "3\n19999897 19999897 19999897",
"output": "2\n19999897 1 19999897 1 19999897"
},
{
"input": "2\n19999982 19999982",
"output": "1\n19999982 1 19999982"
},
{
"input": "2\n10000007 10000007",
"output": "1\n10000007 1 10000007"
},
{
"input": "3\n999999937 999999937 2",
"output": "1\n999999937 1 999999937 2"
},
{
"input": "5\n2017 2017 2017 2017 2017",
"output": "4\n2017 1 2017 1 2017 1 2017 1 2017"
},
{
"input": "2\n19999909 39999818",
"output": "1\n19999909 1 39999818"
},
{
"input": "2\n62615533 7919",
"output": "1\n62615533 1 7919"
},
{
"input": "5\n39989 39989 33 31 29",
"output": "1\n39989 1 39989 33 31 29"
},
{
"input": "2\n1000000000 100000",
"output": "1\n1000000000 1 100000"
},
{
"input": "2\n1938 10010",
"output": "1\n1938 1 10010"
},
{
"input": "2\n199999 199999",
"output": "1\n199999 1 199999"
},
{
"input": "2\n107273 107273",
"output": "1\n107273 1 107273"
},
{
"input": "3\n49999 49999 49999",
"output": "2\n49999 1 49999 1 49999"
},
{
"input": "2\n1999966 1999958",
"output": "1\n1999966 1 1999958"
},
{
"input": "2\n86020 300846",
"output": "1\n86020 1 300846"
},
{
"input": "2\n999999997 213",
"output": "1\n999999997 1 213"
},
{
"input": "2\n200000014 200000434",
"output": "1\n200000014 1 200000434"
}
] | 1,682,119,731
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 93
| 77
| 0
|
from math import gcd
n = int(input())
arr = [int(num) for num in input().split(' ')]
i, j = 0, 1
while j < len(arr):
if gcd(arr[i], arr[i+1]) != 1:
arr.insert(i+1, 1)
i += 1
j += 1
print(len(arr) - n)
print(*arr)
|
Title: Co-prime Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an array of *n* elements, you must make it a co-prime array in as few moves as possible.
In each move you can insert any positive integral number you want not greater than 109 in any place in the array.
An array is co-prime if any two adjacent numbers of it are co-prime.
In the number theory, two integers *a* and *b* are said to be co-prime if the only positive integer that divides both of them is 1.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of elements in the given array.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the elements of the array *a*.
Output Specification:
Print integer *k* on the first line — the least number of elements needed to add to the array *a* to make it co-prime.
The second line should contain *n*<=+<=*k* integers *a**j* — the elements of the array *a* after adding *k* elements to it. Note that the new array should be co-prime, so any two adjacent values should be co-prime. Also the new array should be got from the original array *a* by adding *k* elements to it.
If there are multiple answers you can print any one of them.
Demo Input:
['3\n2 7 28\n']
Demo Output:
['1\n2 7 9 28\n']
Note:
none
|
```python
from math import gcd
n = int(input())
arr = [int(num) for num in input().split(' ')]
i, j = 0, 1
while j < len(arr):
if gcd(arr[i], arr[i+1]) != 1:
arr.insert(i+1, 1)
i += 1
j += 1
print(len(arr) - n)
print(*arr)
```
| 3
|
|
255
|
A
|
Greg's Workout
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises.
|
Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous.
|
[
"2\n2 8\n",
"3\n5 1 10\n",
"7\n3 3 2 7 9 6 8\n"
] |
[
"biceps\n",
"back\n",
"chest\n"
] |
In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise.
| 500
|
[
{
"input": "2\n2 8",
"output": "biceps"
},
{
"input": "3\n5 1 10",
"output": "back"
},
{
"input": "7\n3 3 2 7 9 6 8",
"output": "chest"
},
{
"input": "4\n5 6 6 2",
"output": "chest"
},
{
"input": "5\n8 2 2 6 3",
"output": "chest"
},
{
"input": "6\n8 7 2 5 3 4",
"output": "chest"
},
{
"input": "8\n7 2 9 10 3 8 10 6",
"output": "chest"
},
{
"input": "9\n5 4 2 3 4 4 5 2 2",
"output": "chest"
},
{
"input": "10\n4 9 8 5 3 8 8 10 4 2",
"output": "biceps"
},
{
"input": "11\n10 9 7 6 1 3 9 7 1 3 5",
"output": "chest"
},
{
"input": "12\n24 22 6 16 5 21 1 7 2 19 24 5",
"output": "chest"
},
{
"input": "13\n24 10 5 7 16 17 2 7 9 20 15 2 24",
"output": "chest"
},
{
"input": "14\n13 14 19 8 5 17 9 16 15 9 5 6 3 7",
"output": "back"
},
{
"input": "15\n24 12 22 21 25 23 21 5 3 24 23 13 12 16 12",
"output": "chest"
},
{
"input": "16\n12 6 18 6 25 7 3 1 1 17 25 17 6 8 17 8",
"output": "biceps"
},
{
"input": "17\n13 8 13 4 9 21 10 10 9 22 14 23 22 7 6 14 19",
"output": "chest"
},
{
"input": "18\n1 17 13 6 11 10 25 13 24 9 21 17 3 1 17 12 25 21",
"output": "back"
},
{
"input": "19\n22 22 24 25 19 10 7 10 4 25 19 14 1 14 3 18 4 19 24",
"output": "chest"
},
{
"input": "20\n9 8 22 11 18 14 15 10 17 11 2 1 25 20 7 24 4 25 9 20",
"output": "chest"
},
{
"input": "1\n10",
"output": "chest"
},
{
"input": "2\n15 3",
"output": "chest"
},
{
"input": "3\n21 11 19",
"output": "chest"
},
{
"input": "4\n19 24 13 15",
"output": "chest"
},
{
"input": "5\n4 24 1 9 19",
"output": "biceps"
},
{
"input": "6\n6 22 24 7 15 24",
"output": "back"
},
{
"input": "7\n10 8 23 23 14 18 14",
"output": "chest"
},
{
"input": "8\n5 16 8 9 17 16 14 7",
"output": "biceps"
},
{
"input": "9\n12 3 10 23 6 4 22 13 12",
"output": "chest"
},
{
"input": "10\n1 9 20 18 20 17 7 24 23 2",
"output": "back"
},
{
"input": "11\n22 25 8 2 18 15 1 13 1 11 4",
"output": "biceps"
},
{
"input": "12\n20 12 14 2 15 6 24 3 11 8 11 14",
"output": "chest"
},
{
"input": "13\n2 18 8 8 8 20 5 22 15 2 5 19 18",
"output": "back"
},
{
"input": "14\n1 6 10 25 17 13 21 11 19 4 15 24 5 22",
"output": "biceps"
},
{
"input": "15\n13 5 25 13 17 25 19 21 23 17 12 6 14 8 6",
"output": "back"
},
{
"input": "16\n10 15 2 17 22 12 14 14 6 11 4 13 9 8 21 14",
"output": "chest"
},
{
"input": "17\n7 22 9 22 8 7 20 22 23 5 12 11 1 24 17 20 10",
"output": "biceps"
},
{
"input": "18\n18 15 4 25 5 11 21 25 12 14 25 23 19 19 13 6 9 17",
"output": "chest"
},
{
"input": "19\n3 1 3 15 15 25 10 25 23 10 9 21 13 23 19 3 24 21 14",
"output": "back"
},
{
"input": "20\n19 18 11 3 6 14 3 3 25 3 1 19 25 24 23 12 7 4 8 6",
"output": "back"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "2\n1 7",
"output": "biceps"
},
{
"input": "3\n18 18 23",
"output": "back"
},
{
"input": "4\n12 15 1 13",
"output": "chest"
},
{
"input": "5\n11 14 25 21 21",
"output": "biceps"
},
{
"input": "6\n11 9 12 11 22 18",
"output": "biceps"
},
{
"input": "7\n11 1 16 20 21 25 20",
"output": "chest"
},
{
"input": "8\n1 2 20 9 3 22 17 4",
"output": "back"
},
{
"input": "9\n19 2 10 19 15 20 3 1 13",
"output": "back"
},
{
"input": "10\n11 2 11 8 21 16 2 3 19 9",
"output": "back"
},
{
"input": "20\n25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 24",
"output": "chest"
},
{
"input": "12\n4 24 21 3 13 24 22 13 12 21 1 15",
"output": "back"
},
{
"input": "13\n14 14 16 2 13 5 1 14 9 4 16 8 3",
"output": "biceps"
},
{
"input": "14\n1 9 15 4 11 8 25 3 9 14 13 2 1 11",
"output": "biceps"
},
{
"input": "15\n4 19 10 6 16 12 5 11 7 23 1 24 11 7 17",
"output": "back"
},
{
"input": "16\n2 8 2 8 13 22 20 12 22 23 18 13 18 22 11 17",
"output": "chest"
},
{
"input": "17\n24 5 5 16 10 8 22 6 4 13 10 10 5 23 8 20 8",
"output": "chest"
},
{
"input": "18\n14 8 9 12 11 18 24 1 14 24 18 5 12 17 1 10 1 22",
"output": "chest"
},
{
"input": "19\n21 2 10 6 9 1 24 5 2 19 10 13 10 7 19 2 6 13 24",
"output": "chest"
},
{
"input": "20\n7 1 14 17 6 6 18 13 12 3 25 4 3 19 22 24 16 14 1 23",
"output": "biceps"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "20\n2 1 2 2 1 2 2 1 2 1 1 1 1 1 1 1 1 1 1 22",
"output": "biceps"
}
] | 1,694,526,218
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 61
| 92
| 0
|
a = int(input(""))
b = input("").split()
c = 0
d = 0
e = 0
for i in range(0, a):
if i % 3 == 0:
c += int(b[i])
elif i % 3 == 1:
d += int(b[i])
else:
e += int(b[i])
if e < c > d:
print("chest")
elif e < d > c:
print("biceps")
else:
print("back")
|
Title: Greg's Workout
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises.
Output Specification:
Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous.
Demo Input:
['2\n2 8\n', '3\n5 1 10\n', '7\n3 3 2 7 9 6 8\n']
Demo Output:
['biceps\n', 'back\n', 'chest\n']
Note:
In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise.
|
```python
a = int(input(""))
b = input("").split()
c = 0
d = 0
e = 0
for i in range(0, a):
if i % 3 == 0:
c += int(b[i])
elif i % 3 == 1:
d += int(b[i])
else:
e += int(b[i])
if e < c > d:
print("chest")
elif e < d > c:
print("biceps")
else:
print("back")
```
| 3
|
|
750
|
A
|
New Year and Hurry
|
PROGRAMMING
| 800
|
[
"binary search",
"brute force",
"implementation",
"math"
] | null | null |
Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5·*i* minutes to solve the *i*-th problem.
Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first.
How many problems can Limak solve if he wants to make it to the party?
|
The only line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=10, 1<=≤<=*k*<=≤<=240) — the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house.
|
Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier.
|
[
"3 222\n",
"4 190\n",
"7 1\n"
] |
[
"2\n",
"4\n",
"7\n"
] |
In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5 + 10 = 15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2.
In the second sample, Limak can solve all 4 problems in 5 + 10 + 15 + 20 = 50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight.
In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems.
| 500
|
[
{
"input": "3 222",
"output": "2"
},
{
"input": "4 190",
"output": "4"
},
{
"input": "7 1",
"output": "7"
},
{
"input": "10 135",
"output": "6"
},
{
"input": "10 136",
"output": "5"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 240",
"output": "0"
},
{
"input": "10 1",
"output": "9"
},
{
"input": "10 240",
"output": "0"
},
{
"input": "9 240",
"output": "0"
},
{
"input": "9 1",
"output": "9"
},
{
"input": "9 235",
"output": "1"
},
{
"input": "9 236",
"output": "0"
},
{
"input": "5 225",
"output": "2"
},
{
"input": "5 226",
"output": "1"
},
{
"input": "4 210",
"output": "3"
},
{
"input": "4 211",
"output": "2"
},
{
"input": "4 191",
"output": "3"
},
{
"input": "10 165",
"output": "5"
},
{
"input": "10 166",
"output": "4"
},
{
"input": "8 100",
"output": "7"
},
{
"input": "8 101",
"output": "6"
},
{
"input": "8 60",
"output": "8"
},
{
"input": "8 61",
"output": "7"
},
{
"input": "10 15",
"output": "9"
},
{
"input": "10 16",
"output": "8"
},
{
"input": "4 100",
"output": "4"
},
{
"input": "4 101",
"output": "4"
},
{
"input": "7 167",
"output": "4"
},
{
"input": "10 164",
"output": "5"
},
{
"input": "9 170",
"output": "4"
},
{
"input": "8 160",
"output": "5"
},
{
"input": "1 100",
"output": "1"
},
{
"input": "8 123",
"output": "6"
},
{
"input": "2 99",
"output": "2"
},
{
"input": "10 88",
"output": "7"
},
{
"input": "1 235",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "4 240",
"output": "0"
},
{
"input": "1 55",
"output": "1"
},
{
"input": "1 240",
"output": "0"
},
{
"input": "3 240",
"output": "0"
},
{
"input": "10 240",
"output": "0"
},
{
"input": "2 240",
"output": "0"
},
{
"input": "10 1",
"output": "9"
},
{
"input": "9 1",
"output": "9"
},
{
"input": "2 236",
"output": "0"
},
{
"input": "10 2",
"output": "9"
},
{
"input": "3 239",
"output": "0"
},
{
"input": "1 237",
"output": "0"
},
{
"input": "7 8",
"output": "7"
},
{
"input": "10 235",
"output": "1"
}
] | 1,678,776,730
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 52
| 62
| 0
|
n, k = map(int, input().split())
curr = 240 - k
ans = 0
for i in range(1, n + 1):
if curr - 5 * i >= 0:
ans += 1
curr -= 5 * i
print(ans)
|
Title: New Year and Hurry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5·*i* minutes to solve the *i*-th problem.
Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first.
How many problems can Limak solve if he wants to make it to the party?
Input Specification:
The only line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=10, 1<=≤<=*k*<=≤<=240) — the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house.
Output Specification:
Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier.
Demo Input:
['3 222\n', '4 190\n', '7 1\n']
Demo Output:
['2\n', '4\n', '7\n']
Note:
In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5 + 10 = 15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2.
In the second sample, Limak can solve all 4 problems in 5 + 10 + 15 + 20 = 50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight.
In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems.
|
```python
n, k = map(int, input().split())
curr = 240 - k
ans = 0
for i in range(1, n + 1):
if curr - 5 * i >= 0:
ans += 1
curr -= 5 * i
print(ans)
```
| 3
|
|
32
|
B
|
Borze
|
PROGRAMMING
| 800
|
[
"expression parsing",
"implementation"
] |
B. Borze
|
2
|
256
|
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
|
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
|
Output the decoded ternary number. It can have leading zeroes.
|
[
".-.--\n",
"--.\n",
"-..-.--\n"
] |
[
"012",
"20",
"1012"
] |
none
| 1,000
|
[
{
"input": ".-.--",
"output": "012"
},
{
"input": "--.",
"output": "20"
},
{
"input": "-..-.--",
"output": "1012"
},
{
"input": "---..",
"output": "210"
},
{
"input": "..--.---..",
"output": "0020210"
},
{
"input": "-.....----.",
"output": "10000220"
},
{
"input": ".",
"output": "0"
},
{
"input": "-.",
"output": "1"
},
{
"input": "--",
"output": "2"
},
{
"input": "..",
"output": "00"
},
{
"input": "--.",
"output": "20"
},
{
"input": ".--.",
"output": "020"
},
{
"input": ".-.-..",
"output": "0110"
},
{
"input": "----.-.",
"output": "2201"
},
{
"input": "-..--.-.",
"output": "10201"
},
{
"input": "..--..--.",
"output": "0020020"
},
{
"input": "-.-.---.--..-..-.-.-..-..-.--.",
"output": "112120010111010120"
},
{
"input": "---.-.-.------..-..-..-..-.-..-.--.-.-..-.-.-----..-.-.",
"output": "21112220010101011012011011221011"
},
{
"input": "-.-..--.-.-.-.-.-..-.-.-.---------.--.---..--...--.-----.-.-.-...--.-.-.---.------.--..-.--.-----.-...-..------",
"output": "11020111110111222212021020002022111100201121222020012022110010222"
},
{
"input": "-.-..-.--.---..---.-..---.-...-.-.----..-.---.-.---..-.--.---.-.-------.---.--....----.-.---.---.---.----.-----..---.-.-.-.-----.--.-------.-..",
"output": "110120210211021100112200121121012021122212120000220121212122022102111122120222110"
},
{
"input": ".-..-.-.---.-----.--.---...-.--.-.-....-..",
"output": "01011212212021001201100010"
},
{
"input": ".------.-.---..--...-..-..-.-.-.--.--.-..-.--...-.-.---.-.-.------..--..-.---..----.-..-.--.---.-.----.-.---...-.-.-.-----.-.-.---.---.-.....-.-...-----.-...-.---.-..-.-----.--...---.-.-..-.--.-.---..",
"output": "022201210200010101112020101200011211122200200121022010120211220121001112211121211000011002211001211012212000211101201210"
},
{
"input": ".-.--.---.-----.-.-----.-.-..-----..-..----..--.-.--.----..---.---..-.-.-----..-------.----..----.-..---...-----..-..-----...-..-.-.-----....---..---..-.-----...-.--...--.-.---.-.-.-.-.-...---..----.",
"output": "01202122112211102210102200201202200212101122102221220022010210022101022100101122100021021012210012000201211111100210220"
},
{
"input": "..-.-.-.---.-.-.-..-.-..-.-.---.-------.---..-----.---....-.---.--.--.-.---.---------.-..---.-.-.--..---.---.-.---.-.-..-.-..-.-.-.----.--.-....--------.-.---..----.------.-.-.--.--.-----.-----.----",
"output": "0011121111011011212221210221210001212020121222211021112002121121110110111220201000222201210220222011202022122122"
},
{
"input": "-..-------.------.-..--.-.-..--.-.-..-----..-.-.-..-..-..--.---..-----..---..-..--.-..-.-.---...-.....-------.---.-----.-...-.-...-.-.---.---.-----.--.--...-.--..-.-..-...-.-.-.-.---..---.-..-.-.-.-..",
"output": "102221222010201102011022101110101020210221021010201011210010000222121221100110011212122120200012001101001111210211011110"
},
{
"input": ".-.----.-.--..-.-.-.-..----..-.-...--.-.---.---.-------..-.--..-......--.------.--.----.--...-.--.--..-----..-.....--.--.-.-.------..--------.----------..-.---.----.---.-..--..-.....-..------.--.",
"output": "012201200111102200110020121212221012001000002022202022020001202002210100002020112220022220222220012122021102001000010222020"
},
{
"input": "------.-----.-....--.-.----.-.---.-.-..---.-.---.-----..-...-.-.---..-.-.-..-.-.-...-.-.-.----..--.------.----.-..-.--...-.-------...-.-..-.-.--.--.---..--..--------.--.-.-.---.-.-.-...----.--..-.--..",
"output": "222022110002012201211102112122101001121011101110011122002022202201012000122210011011202021020022220201121111002202001200"
},
{
"input": "-.---...----...--.--...-.--.----",
"output": "121002200020200012022"
},
{
"input": "--.--.--.---.--.-.---.-.-..-..--.-..---.-.....-..---.-----.--...-.-.-------.-.--.-.----.-..-.------.",
"output": "202020212012111010201021100001021221200011222112012201012220"
}
] | 1,598,043,637
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 30
| 310
| 20,172,800
|
x=input()
s=""
i=0
while i<len(x):
if x[i]=='.':
s+='0'
elif x[i]=='-':
if x[i+1]=='.':
s+='1'
else:
s+='2'
i+=1
i+=1
print(s)
|
Title: Borze
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
Input Specification:
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
Output Specification:
Output the decoded ternary number. It can have leading zeroes.
Demo Input:
['.-.--\n', '--.\n', '-..-.--\n']
Demo Output:
['012', '20', '1012']
Note:
none
|
```python
x=input()
s=""
i=0
while i<len(x):
if x[i]=='.':
s+='0'
elif x[i]=='-':
if x[i+1]=='.':
s+='1'
else:
s+='2'
i+=1
i+=1
print(s)
```
| 3.884925
|
1,006
|
A
|
Adjacent Replacements
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Mishka got an integer array $a$ of length $n$ as a birthday present (what a surprise!).
Mishka doesn't like this present and wants to change it somehow. He has invented an algorithm and called it "Mishka's Adjacent Replacements Algorithm". This algorithm can be represented as a sequence of steps:
- Replace each occurrence of $1$ in the array $a$ with $2$; - Replace each occurrence of $2$ in the array $a$ with $1$; - Replace each occurrence of $3$ in the array $a$ with $4$; - Replace each occurrence of $4$ in the array $a$ with $3$; - Replace each occurrence of $5$ in the array $a$ with $6$; - Replace each occurrence of $6$ in the array $a$ with $5$; - $\dots$ - Replace each occurrence of $10^9 - 1$ in the array $a$ with $10^9$; - Replace each occurrence of $10^9$ in the array $a$ with $10^9 - 1$.
Note that the dots in the middle of this algorithm mean that Mishka applies these replacements for each pair of adjacent integers ($2i - 1, 2i$) for each $i \in\{1, 2, \ldots, 5 \cdot 10^8\}$ as described above.
For example, for the array $a = [1, 2, 4, 5, 10]$, the following sequence of arrays represents the algorithm:
$[1, 2, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $1$ with $2$) $\rightarrow$ $[2, 2, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $2$ with $1$) $\rightarrow$ $[1, 1, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $3$ with $4$) $\rightarrow$ $[1, 1, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $4$ with $3$) $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ (replace all occurrences of $5$ with $6$) $\rightarrow$ $[1, 1, 3, 6, 10]$ $\rightarrow$ (replace all occurrences of $6$ with $5$) $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ $\dots$ $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ (replace all occurrences of $10$ with $9$) $\rightarrow$ $[1, 1, 3, 5, 9]$. The later steps of the algorithm do not change the array.
Mishka is very lazy and he doesn't want to apply these changes by himself. But he is very interested in their result. Help him find it.
|
The first line of the input contains one integer number $n$ ($1 \le n \le 1000$) — the number of elements in Mishka's birthday present (surprisingly, an array).
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10^9$) — the elements of the array.
|
Print $n$ integers — $b_1, b_2, \dots, b_n$, where $b_i$ is the final value of the $i$-th element of the array after applying "Mishka's Adjacent Replacements Algorithm" to the array $a$. Note that you cannot change the order of elements in the array.
|
[
"5\n1 2 4 5 10\n",
"10\n10000 10 50605065 1 5 89 5 999999999 60506056 1000000000\n"
] |
[
"1 1 3 5 9\n",
"9999 9 50605065 1 5 89 5 999999999 60506055 999999999\n"
] |
The first example is described in the problem statement.
| 0
|
[
{
"input": "5\n1 2 4 5 10",
"output": "1 1 3 5 9"
},
{
"input": "10\n10000 10 50605065 1 5 89 5 999999999 60506056 1000000000",
"output": "9999 9 50605065 1 5 89 5 999999999 60506055 999999999"
},
{
"input": "1\n999999999",
"output": "999999999"
},
{
"input": "1\n1000000000",
"output": "999999999"
},
{
"input": "1\n210400",
"output": "210399"
},
{
"input": "5\n100000000 100000000 100000000 100000000 100000000",
"output": "99999999 99999999 99999999 99999999 99999999"
},
{
"input": "1\n2441139",
"output": "2441139"
},
{
"input": "2\n2 2",
"output": "1 1"
},
{
"input": "3\n2 2 2",
"output": "1 1 1"
},
{
"input": "2\n4 4",
"output": "3 3"
}
] | 1,595,422,126
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 18
| 108
| 6,963,200
|
query = int(input())
a = list(map(int, input().split()))
for i in range(query):
if not a[i]%2:
a[i]-=1
print(" ".join(map(str, a[:query])))
|
Title: Adjacent Replacements
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mishka got an integer array $a$ of length $n$ as a birthday present (what a surprise!).
Mishka doesn't like this present and wants to change it somehow. He has invented an algorithm and called it "Mishka's Adjacent Replacements Algorithm". This algorithm can be represented as a sequence of steps:
- Replace each occurrence of $1$ in the array $a$ with $2$; - Replace each occurrence of $2$ in the array $a$ with $1$; - Replace each occurrence of $3$ in the array $a$ with $4$; - Replace each occurrence of $4$ in the array $a$ with $3$; - Replace each occurrence of $5$ in the array $a$ with $6$; - Replace each occurrence of $6$ in the array $a$ with $5$; - $\dots$ - Replace each occurrence of $10^9 - 1$ in the array $a$ with $10^9$; - Replace each occurrence of $10^9$ in the array $a$ with $10^9 - 1$.
Note that the dots in the middle of this algorithm mean that Mishka applies these replacements for each pair of adjacent integers ($2i - 1, 2i$) for each $i \in\{1, 2, \ldots, 5 \cdot 10^8\}$ as described above.
For example, for the array $a = [1, 2, 4, 5, 10]$, the following sequence of arrays represents the algorithm:
$[1, 2, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $1$ with $2$) $\rightarrow$ $[2, 2, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $2$ with $1$) $\rightarrow$ $[1, 1, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $3$ with $4$) $\rightarrow$ $[1, 1, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $4$ with $3$) $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ (replace all occurrences of $5$ with $6$) $\rightarrow$ $[1, 1, 3, 6, 10]$ $\rightarrow$ (replace all occurrences of $6$ with $5$) $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ $\dots$ $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ (replace all occurrences of $10$ with $9$) $\rightarrow$ $[1, 1, 3, 5, 9]$. The later steps of the algorithm do not change the array.
Mishka is very lazy and he doesn't want to apply these changes by himself. But he is very interested in their result. Help him find it.
Input Specification:
The first line of the input contains one integer number $n$ ($1 \le n \le 1000$) — the number of elements in Mishka's birthday present (surprisingly, an array).
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10^9$) — the elements of the array.
Output Specification:
Print $n$ integers — $b_1, b_2, \dots, b_n$, where $b_i$ is the final value of the $i$-th element of the array after applying "Mishka's Adjacent Replacements Algorithm" to the array $a$. Note that you cannot change the order of elements in the array.
Demo Input:
['5\n1 2 4 5 10\n', '10\n10000 10 50605065 1 5 89 5 999999999 60506056 1000000000\n']
Demo Output:
['1 1 3 5 9\n', '9999 9 50605065 1 5 89 5 999999999 60506055 999999999\n']
Note:
The first example is described in the problem statement.
|
```python
query = int(input())
a = list(map(int, input().split()))
for i in range(query):
if not a[i]%2:
a[i]-=1
print(" ".join(map(str, a[:query])))
```
| 3
|
|
312
|
A
|
Whose sentence is it?
|
PROGRAMMING
| 1,100
|
[
"implementation",
"strings"
] | null | null |
One day, liouzhou_101 got a chat record of Freda and Rainbow. Out of curiosity, he wanted to know which sentences were said by Freda, and which were said by Rainbow. According to his experience, he thought that Freda always said "lala." at the end of her sentences, while Rainbow always said "miao." at the beginning of his sentences. For each sentence in the chat record, help liouzhou_101 find whose sentence it is.
|
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=10), number of sentences in the chat record. Each of the next *n* lines contains a sentence. A sentence is a string that contains only Latin letters (A-Z, a-z), underline (_), comma (,), point (.) and space ( ). Its length doesn’t exceed 100.
|
For each sentence, output "Freda's" if the sentence was said by Freda, "Rainbow's" if the sentence was said by Rainbow, or "OMG>.< I don't know!" if liouzhou_101 can’t recognize whose sentence it is. He can’t recognize a sentence if it begins with "miao." and ends with "lala.", or satisfies neither of the conditions.
|
[
"5\nI will go to play with you lala.\nwow, welcome.\nmiao.lala.\nmiao.\nmiao .\n"
] |
[
"Freda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\n"
] |
none
| 500
|
[
{
"input": "5\nI will go to play with you lala.\nwow, welcome.\nmiao.lala.\nmiao.\nmiao .",
"output": "Freda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!"
},
{
"input": "10\nLpAEKiHVJrzSZqBVSSyY\nYECGBlala.\nUZeGpeM.UCwiHmmA\nqt_,.b_.LSwJtJ.\nFAnXZtHlala.\nmiao.iapelala.\nCFPlbUgObrXLejPNu.F\nZSUfvisiHyrIMjMlala.\nmiao. lala.\nd,IWSeumytrVlala.",
"output": "OMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nFreda's"
},
{
"input": "10\nmiao.,taUvXPVlala.\nmiao.txEeId.X_lala.\nLZIeAEd JaeBVlala.\ncKPIsWpwIlala.\nfYp.eSvn,g\nKMx,nFEslala.\nmiao.QtMyxYqiajjuM\nDutxNkCqywgcnCYskcd\ngFLKACjeqfD\n,Ss UmY.wJvcX",
"output": "OMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nFreda's\nOMG>.< I don't know!\nFreda's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nmiao.Plala.\nDVm,VYslala.\nmiao.rlala.\nmiao.,KQNL.fO_.QRc\nUBLCKEUePlala.\nIouS.Alala.\nmiao.lala.\nmiao.rlala.\nEJZwRJeKlala.\nmiao.Olala.",
"output": "OMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nRainbow's\nFreda's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!"
},
{
"input": "10\nmiao.grFTpju.jCLRnZ\ng.pVHYA_Usnm\nlloWONolcMFElala.\nAW,n.JJkOTe.Nd\n.bP.HvKlala.\nGziqPGQa,lala.\nmiao.,QkOCH.vFlala.\n.PUtOwImvUsoeh \nmiao.Z,KIds.R\nmiao.,_MDzoaAiJlala.",
"output": "Rainbow's\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nFreda's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!"
},
{
"input": "10\nmiao.xWfjV\nHFVrGCDQXyZ,Sbm\nLMDS.xVkTCAY.vm\nmiao.lLBglala.\nnl,jRPyClala.\nFYnHoXlala.\nmiao. oxaHE\n.WTrw_mNpOQCa\nHOk..wHYoyMhl\nQX,XpMuPIROM",
"output": "Rainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nFreda's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nJBQqiXlala.\npUNUWQRiMPCXv\nAiLnfNHWznwkC.lala.\nmiao.Dl_Oy\nxJJJkVkdfOzQBH_SmKh\nfgD_IHvdHiorE,W\nmiao.usBKixglala.\nwCpqPUzEtD\nmiao.rlala.\nmiao.JylcGvWlala.",
"output": "Freda's\nOMG>.< I don't know!\nFreda's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nmiao..FLhPl_Wjslala.\nmiao. tdEGtfdJlala.\nGAzEUlala.\nKCcmOa .aKBlZyYsdu.V\nmiao.lala.\njKylnM,FXK\nmiao.GBWqjGH.v\nmiao.RefxS Cni.\nOxaaEihuHQR_s,\nmiao.a,Axtlala.",
"output": "OMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nNo.I_aTXlala.\nmiao.JKSCoRZS\nnOBMIlala.\nmiao.nlala.\nmiao._xqxoHIIlala.\nmiao.NJPy SWyiUDWc\nmiao.cCnahFaqqj.Xqp\nnreSMDeXPPYAQxI,W\nAktPajWimdd_qRn\nmiao.QHwKCYlala.",
"output": "Freda's\nRainbow's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\n \n,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ \n \nmiao.miao.miao.\nlala.lala.lala.\nlala.miao.\nmiaolala. \nmiao.lala\nmiaolala_\n,.._ abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ",
"output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nduClyjMIPsEuWmx_Ce.byVoizYlTM,sF\nuZHsNip_,Mwtg,FZjM_LzPC,_pSvEOyTHfAOvoZXvxCZdgYDTCDdCAoSVZWyxXGcLgWlala.\nEGtJFPAvTEcqjkhaGxdduaQ_rmUzF.WaU, EIuX B,aVzFFpFrxpwADXuayRD azDfj \n_tJqYzXyqc.,u.F,mUYukveBPWnPq,f,dJnPHuBazdnbRHfzwNUdRbheAIjcoaPcnLvocrzcioxCapb R\n.YUBeb_zmwUt.QQuUdQIiOXtqshcsycEe,HLytHlala.\ndJndLqGBHt.GfpN.BgvsbXoLh_DIzAJOtFDmLSCYEztvPcS_GHPxivzV,NPMmSAtfk.Mg.w,A UcCt_lCD.csEzyJJBYtSMkzqiA\nmiao.qlala.\nmiao.FmDlY\nmiao.UQI.aJmnanNvRLskuVaMybDMsOlala.\nmiao.lala.",
"output": "OMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nmiao.vyscfysAtWcPkpFHdwZqAQ,UPPcjhKQTlala.\nmiao.KESqus DybUuYFoWVpo..LWZh.UqEdUsTHFlKfzqkThAUPklala.\nUNoE vfZIAdxkiWKhsHPfsqRPTNQoHgAxooVLYxRzugHjo jaEHWQFF\nCCmdIwr.UkoiYWK.Z,,ZesMpISTXNgnpYnJaWquCyL,gO\n.JvOayhXK_bgoYbfAtnXg\nbvdSzRrXoGxVgWvdXnsjEnEfxDzIQo_aZVGDGrzwuAMtzVAHioMBx_DHuTxyieGbGuSRNUojOREqxBBxvCgqAOMzwIWT\nMBuaWduZmRaOGyIPzWOsBVeqtDrblAbXxmM_uRfqMvnVlLEuhVKlhidN_aigiXyq,ZEDqQAx\nmiao.wCHVCuVKNePKmIUFLL_lala.\nmiao.iAqstXHUv\n pMO yvPkNtnNwmUCao W,wW.OvIMVaEeVYHmqaniWq.ivlala.",
"output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nFreda's"
},
{
"input": "10\nmiao.\nmiao.jrwLBCpNaDCjyoK.PFzbwWU.h.. wfQquG_P..lala.\nmiao.LGlYdKjw__.Chlala.\nW.wtr qG KDOHj.xWxPbXIXjD_,GJZDaAZ,JBHphsjWJwSKcZAIAi\nmiao.pHsGAZQDWPJQwKC.zHjJituLgp.eUrzObTI.wrpect.FMUJqu,Zuslala.\nmiao.YVlOpXccUA_YU igbsbZbhOVwyYTyOjnWqgiTmxwAuFa.flCHn.,MtVbqxZQl_BGHXWkwijGjuL, ,ezyNlala.\nmiao.xCrVSz.aMv UOSOroDlQxWeBmlWe.FA.ZfUmviMlala.\nxebAlala.\nmiao.qVSxqf vOTlala.\nD.oBUwsLQRgXAoNkQJhQN.w.oMhuvtujnmiwgQYMfjlNTSHh .lSKgI.OEp",
"output": "Rainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nZXXzYlTiQU\nkXE.DdcbOojSaSgjMcFBPubKHefEVAzbi,PDFgSZIz,lala.\nxEfrTCjKhhwBC.UNmJXgTGUdkQeVDlala.\nLfaEw.jvMmuOBWtfoiJNtDIlQAVWNU,xWK_efBBtfkM\nqtBpqKZMWZMX_NKrUAEKYyQcLZWQlqbM\nmiao.PrJEbUtInremuaKRItqXOrfQEjQcAak VQ\nMpGCq awvQaHRvDr uvtVMKsvZI\nmiao.A.RVGu.szCEp.pXQJwL EuTltlN.WradoTvWHJyhcNSoulala.\nmiao.rzlUHzUdxtDRpWRuc,QZwEBfsKKGHMLGtFymPPQdptLFlzZ_ORWqrlfOrlntuDkpXEvz.CxwAsFYUvpnOnFWG\nmiao.VXUoNBwlgBwcna_n.CgAAcKKUuiVA.doOJKHpMdwNwlHAcLpdfN.Awa SthrlEWpUcuOonUTxIQNszYcHDXxnhArrM..A",
"output": "OMG>.< I don't know!\nFreda's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's"
},
{
"input": "10\nmiao.qbxBFzrjtWv.yOk\nDBgi,loApO AACrGnwssCHN\nmiao.LV.wbQEE_V.BSAtdTIHTQOJVJ_nGOthbL,nJvQ.UeWFpsa.GGsK_Uv,HQxHS,AN_bkrolala.\nmiao.tBEqk rIQuByGKhfq_iP.BW,nySZEfrfySEcqnnIzxC,lrjIiivbxlkoVXJFiegGFRn NO,txGPhVBcv.CVhMmNO zlala.\nmiao.aBZWDWxk.wkR ,NyCzGxJnJDqBZpetdUPAmmBZDXl_Tbflala.\nmiao. XN,uMwWm. VqloYr..jTLszlala.\n.rshcgfZ.eZOdMu_RMh\nmiao.ahiwpECEe.lala.\nLeoUSroTekQAMSO__M L_ZEeRD_tUihYvQETFB,RzJmFtFiKrU\nBtygQG_OoFEFBL.KsVWTYbtqtalXoStFCZ RINHda.NuLmlkRB.vAQJFvelbsfoJ.T,M sJn",
"output": "Rainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nYoYBCcaqhXLfvKKf.UYMODTHyPZlala.\ncxgWn J.Q\nmiao.nwH.IHntgKYDhdsjU DMTHXEVRyeJP ZaAecCIBJXuv.YjhEmtbjvjKnK.U,oc,x\nmiao.EcQ.FDtRJgmpAzxhq.RwXBLxjyC,IeMqaFoheMPFCGWBcwUAFnbiwlbz_fcsEGPfJaeryCtFocBNEWTlala.\nmiao.W\nmiao. ZQpIeyCXJSnFgAIzu.THfrmyoogYWQzFqblala.\nmiao.ifzdCwnTDcxpvdr OTC.YqPv.MKDp..utICtAsbfYyGlala.\nmiao.\nmiao.tS.U.wH.s,CxORZJsBAHLi,fXeoDJWVBH\nrcUMpeupOVRKrcIRAvU.rP kgUEfoeXcrFPQOBYG.BNvAQPg.XHMWizhLpZNljXc .LQmVXCi",
"output": "Freda's\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!"
},
{
"input": "10\nlala.\nmiao.milalala.lmmialamiao.la.o.iao.a.ao.\nmialala.o.\nmiao.millala.allala.amiao..miao.miao.lala.ao.miammiao.iao.o.\nmiao.miaomiao..\nlalmiao.amiao..\nmiao.lala.lamiamiaolala..o.lalala.miao..\nmlala.iao.lalamiao..\nlmlala.iao.alalamiao.lmialala.lala.miao.o.alala..lala..lalmiaomiao..lalmiao.a.lalamiao..miao.alala..\nlalllamiao.la.lala.alamiao.lalalala.lala..miao.lamiao.la.lallalamiao..a..a.",
"output": "Freda's\nRainbow's\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nlalllala.ala.lala.a.mmimiao.aomiao.lllala.ala.amiao.la.mialalala.la.o..imiao.miao.amlala.iao.o.\nmilala.alllala.ala.amiao.lamiao..o.\nlala.lalalala..lalalala..\nlala.miao.\nmimiao.ao.lala.\nlalmiao.amlala.iamialala.o.o..\nlalammlala.iaolammiao.imiao.ao.la..iao..\nmiao.mialala.omiao..mlala.iaolala..\nmiamiao.o.llallala.ala.la.miao.ala.miao.mimialmiao.ala.o.alala.miaomiao..olala..\nmialala.lamiao.la.lala.miao.ollala.allala.ala.lmiaommiao.imiao.ao.lallallala.a.miao.a..a..",
"output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "10\nlamiao.lamiao.mimiao.ao..\nllala.almiaomiao..lala.miao.a.\nlalala.lala.lalala.lala.lalala..la.\nlalala.la.miao.\nmiao.llalallala.miao.a.la.lala.almimiao.ao.a.\nmiao.mlala.ilala.aomilala.ao..\nmilala.ao.\nmmiao.iao.\nmlala.lala.ialalmiao.alala..olala.lala..\nlala.lmlalalalalala...iao.milala.aommiao.iao..alamiaolallala.milala.ao.a..lalalmiao.a..llala.amiao..",
"output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "4\n \n miao. \n lala. \n ",
"output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
},
{
"input": "1\nMiao.",
"output": "OMG>.< I don't know!"
},
{
"input": "1\nm",
"output": "OMG>.< I don't know!"
},
{
"input": "1\nMiAo.sdsdlala.",
"output": "Freda's"
},
{
"input": "1\nLalA.",
"output": "OMG>.< I don't know!"
},
{
"input": "3\n.\nm\nl",
"output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!"
}
] | 1,654,411,794
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 46
| 0
|
for message in range(int(input())):
s = input()
if len(s)>=5:
if s[0:5] == 'miao.' and s[-5:] != 'lala.':
print("Rainbow's")
continue
if s[0:5] != 'miao.' and s[-5:] == 'lala.':
print("Freda's")
continue
print("OMG>.< I don't know!")
|
Title: Whose sentence is it?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day, liouzhou_101 got a chat record of Freda and Rainbow. Out of curiosity, he wanted to know which sentences were said by Freda, and which were said by Rainbow. According to his experience, he thought that Freda always said "lala." at the end of her sentences, while Rainbow always said "miao." at the beginning of his sentences. For each sentence in the chat record, help liouzhou_101 find whose sentence it is.
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=10), number of sentences in the chat record. Each of the next *n* lines contains a sentence. A sentence is a string that contains only Latin letters (A-Z, a-z), underline (_), comma (,), point (.) and space ( ). Its length doesn’t exceed 100.
Output Specification:
For each sentence, output "Freda's" if the sentence was said by Freda, "Rainbow's" if the sentence was said by Rainbow, or "OMG>.< I don't know!" if liouzhou_101 can’t recognize whose sentence it is. He can’t recognize a sentence if it begins with "miao." and ends with "lala.", or satisfies neither of the conditions.
Demo Input:
['5\nI will go to play with you lala.\nwow, welcome.\nmiao.lala.\nmiao.\nmiao .\n']
Demo Output:
["Freda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\n"]
Note:
none
|
```python
for message in range(int(input())):
s = input()
if len(s)>=5:
if s[0:5] == 'miao.' and s[-5:] != 'lala.':
print("Rainbow's")
continue
if s[0:5] != 'miao.' and s[-5:] == 'lala.':
print("Freda's")
continue
print("OMG>.< I don't know!")
```
| 3
|
|
583
|
A
|
Asphalting Roads
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
City X consists of *n* vertical and *n* horizontal infinite roads, forming *n*<=×<=*n* intersections. Roads (both vertical and horizontal) are numbered from 1 to *n*, and the intersections are indicated by the numbers of the roads that form them.
Sand roads have long been recognized out of date, so the decision was made to asphalt them. To do this, a team of workers was hired and a schedule of work was made, according to which the intersections should be asphalted.
Road repairs are planned for *n*2 days. On the *i*-th day of the team arrives at the *i*-th intersection in the list and if none of the two roads that form the intersection were already asphalted they asphalt both roads. Otherwise, the team leaves the intersection, without doing anything with the roads.
According to the schedule of road works tell in which days at least one road will be asphalted.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of vertical and horizontal roads in the city.
Next *n*2 lines contain the order of intersections in the schedule. The *i*-th of them contains two numbers *h**i*,<=*v**i* (1<=≤<=*h**i*,<=*v**i*<=≤<=*n*), separated by a space, and meaning that the intersection that goes *i*-th in the timetable is at the intersection of the *h**i*-th horizontal and *v**i*-th vertical roads. It is guaranteed that all the intersections in the timetable are distinct.
|
In the single line print the numbers of the days when road works will be in progress in ascending order. The days are numbered starting from 1.
|
[
"2\n1 1\n1 2\n2 1\n2 2\n",
"1\n1 1\n"
] |
[
"1 4 \n",
"1 \n"
] |
In the sample the brigade acts like that:
1. On the first day the brigade comes to the intersection of the 1-st horizontal and the 1-st vertical road. As none of them has been asphalted, the workers asphalt the 1-st vertical and the 1-st horizontal road; 1. On the second day the brigade of the workers comes to the intersection of the 1-st horizontal and the 2-nd vertical road. The 2-nd vertical road hasn't been asphalted, but as the 1-st horizontal road has been asphalted on the first day, the workers leave and do not asphalt anything; 1. On the third day the brigade of the workers come to the intersection of the 2-nd horizontal and the 1-st vertical road. The 2-nd horizontal road hasn't been asphalted but as the 1-st vertical road has been asphalted on the first day, the workers leave and do not asphalt anything; 1. On the fourth day the brigade come to the intersection formed by the intersection of the 2-nd horizontal and 2-nd vertical road. As none of them has been asphalted, the workers asphalt the 2-nd vertical and the 2-nd horizontal road.
| 500
|
[
{
"input": "2\n1 1\n1 2\n2 1\n2 2",
"output": "1 4 "
},
{
"input": "1\n1 1",
"output": "1 "
},
{
"input": "2\n1 1\n2 2\n1 2\n2 1",
"output": "1 2 "
},
{
"input": "2\n1 2\n2 2\n2 1\n1 1",
"output": "1 3 "
},
{
"input": "3\n2 2\n1 2\n3 2\n3 3\n1 1\n2 3\n1 3\n3 1\n2 1",
"output": "1 4 5 "
},
{
"input": "3\n1 3\n3 1\n2 1\n1 1\n1 2\n2 2\n3 2\n3 3\n2 3",
"output": "1 2 6 "
},
{
"input": "4\n1 3\n2 3\n2 4\n4 4\n3 1\n1 1\n3 4\n2 1\n1 4\n4 3\n4 1\n3 2\n1 2\n4 2\n2 2\n3 3",
"output": "1 3 5 14 "
},
{
"input": "4\n3 3\n4 2\n2 3\n3 4\n4 4\n1 2\n3 2\n2 2\n1 4\n3 1\n4 1\n2 1\n1 3\n1 1\n4 3\n2 4",
"output": "1 2 9 12 "
},
{
"input": "9\n4 5\n2 3\n8 3\n5 6\n9 3\n4 4\n5 4\n4 7\n1 7\n8 4\n1 4\n1 5\n5 7\n7 8\n7 1\n9 9\n8 7\n7 5\n3 7\n6 6\n7 3\n5 2\n3 6\n7 4\n9 6\n5 8\n9 7\n6 3\n7 9\n1 2\n1 1\n6 2\n5 3\n7 2\n1 6\n4 1\n6 1\n8 9\n2 2\n3 9\n2 9\n7 7\n2 8\n9 4\n2 5\n8 6\n3 4\n2 1\n2 7\n6 5\n9 1\n3 3\n3 8\n5 5\n4 3\n3 1\n1 9\n6 4\n3 2\n6 8\n2 6\n5 9\n8 5\n8 8\n9 5\n6 9\n9 2\n3 5\n4 9\n4 8\n2 4\n5 1\n4 6\n7 6\n9 8\n1 3\n4 2\n8 1\n8 2\n6 7\n1 8",
"output": "1 2 4 9 10 14 16 32 56 "
},
{
"input": "8\n1 1\n1 2\n1 3\n1 4\n1 5\n8 6\n1 7\n1 8\n2 1\n8 5\n2 3\n2 4\n2 5\n2 6\n4 3\n2 2\n3 1\n3 2\n3 3\n3 4\n3 5\n3 6\n5 6\n3 8\n4 1\n4 2\n2 7\n4 4\n8 8\n4 6\n4 7\n4 8\n5 1\n5 2\n5 3\n6 5\n5 5\n3 7\n5 7\n5 8\n6 1\n6 2\n6 3\n6 4\n5 4\n6 6\n6 7\n6 8\n7 1\n7 2\n7 3\n7 4\n7 5\n7 6\n7 7\n7 8\n8 1\n8 2\n8 3\n8 4\n2 8\n1 6\n8 7\n4 5",
"output": "1 6 11 18 28 36 39 56 "
},
{
"input": "9\n9 9\n5 5\n8 8\n3 3\n2 2\n6 6\n4 4\n1 1\n7 7\n8 4\n1 4\n1 5\n5 7\n7 8\n7 1\n1 7\n8 7\n7 5\n3 7\n5 6\n7 3\n5 2\n3 6\n7 4\n9 6\n5 8\n9 7\n6 3\n7 9\n1 2\n4 5\n6 2\n5 3\n7 2\n1 6\n4 1\n6 1\n8 9\n2 3\n3 9\n2 9\n5 4\n2 8\n9 4\n2 5\n8 6\n3 4\n2 1\n2 7\n6 5\n9 1\n8 3\n3 8\n9 3\n4 3\n3 1\n1 9\n6 4\n3 2\n6 8\n2 6\n5 9\n8 5\n4 7\n9 5\n6 9\n9 2\n3 5\n4 9\n4 8\n2 4\n5 1\n4 6\n7 6\n9 8\n1 3\n4 2\n8 1\n8 2\n6 7\n1 8",
"output": "1 2 3 4 5 6 7 8 9 "
}
] | 1,496,323,971
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 39
| 62
| 0
|
N = int(input())
hs = set([])
vs = set([])
ans = []
for i in range(N ** 2):
h, v = map(int, input().split())
if h in hs or v in vs:
continue
hs.add(h)
vs.add(v)
ans.append(i + 1)
print(" ".join(map(str, ans)))
|
Title: Asphalting Roads
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
City X consists of *n* vertical and *n* horizontal infinite roads, forming *n*<=×<=*n* intersections. Roads (both vertical and horizontal) are numbered from 1 to *n*, and the intersections are indicated by the numbers of the roads that form them.
Sand roads have long been recognized out of date, so the decision was made to asphalt them. To do this, a team of workers was hired and a schedule of work was made, according to which the intersections should be asphalted.
Road repairs are planned for *n*2 days. On the *i*-th day of the team arrives at the *i*-th intersection in the list and if none of the two roads that form the intersection were already asphalted they asphalt both roads. Otherwise, the team leaves the intersection, without doing anything with the roads.
According to the schedule of road works tell in which days at least one road will be asphalted.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of vertical and horizontal roads in the city.
Next *n*2 lines contain the order of intersections in the schedule. The *i*-th of them contains two numbers *h**i*,<=*v**i* (1<=≤<=*h**i*,<=*v**i*<=≤<=*n*), separated by a space, and meaning that the intersection that goes *i*-th in the timetable is at the intersection of the *h**i*-th horizontal and *v**i*-th vertical roads. It is guaranteed that all the intersections in the timetable are distinct.
Output Specification:
In the single line print the numbers of the days when road works will be in progress in ascending order. The days are numbered starting from 1.
Demo Input:
['2\n1 1\n1 2\n2 1\n2 2\n', '1\n1 1\n']
Demo Output:
['1 4 \n', '1 \n']
Note:
In the sample the brigade acts like that:
1. On the first day the brigade comes to the intersection of the 1-st horizontal and the 1-st vertical road. As none of them has been asphalted, the workers asphalt the 1-st vertical and the 1-st horizontal road; 1. On the second day the brigade of the workers comes to the intersection of the 1-st horizontal and the 2-nd vertical road. The 2-nd vertical road hasn't been asphalted, but as the 1-st horizontal road has been asphalted on the first day, the workers leave and do not asphalt anything; 1. On the third day the brigade of the workers come to the intersection of the 2-nd horizontal and the 1-st vertical road. The 2-nd horizontal road hasn't been asphalted but as the 1-st vertical road has been asphalted on the first day, the workers leave and do not asphalt anything; 1. On the fourth day the brigade come to the intersection formed by the intersection of the 2-nd horizontal and 2-nd vertical road. As none of them has been asphalted, the workers asphalt the 2-nd vertical and the 2-nd horizontal road.
|
```python
N = int(input())
hs = set([])
vs = set([])
ans = []
for i in range(N ** 2):
h, v = map(int, input().split())
if h in hs or v in vs:
continue
hs.add(h)
vs.add(v)
ans.append(i + 1)
print(" ".join(map(str, ans)))
```
| 3
|
|
935
|
A
|
Fafa and his Company
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
Fafa owns a company that works on huge projects. There are *n* employees in Fafa's company. Whenever the company has a new project to start working on, Fafa has to divide the tasks of this project among all the employees.
Fafa finds doing this every time is very tiring for him. So, he decided to choose the best *l* employees in his company as team leaders. Whenever there is a new project, Fafa will divide the tasks among only the team leaders and each team leader will be responsible of some positive number of employees to give them the tasks. To make this process fair for the team leaders, each one of them should be responsible for the same number of employees. Moreover, every employee, who is not a team leader, has to be under the responsibility of exactly one team leader, and no team leader is responsible for another team leader.
Given the number of employees *n*, find in how many ways Fafa could choose the number of team leaders *l* in such a way that it is possible to divide employees between them evenly.
|
The input consists of a single line containing a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of employees in Fafa's company.
|
Print a single integer representing the answer to the problem.
|
[
"2\n",
"10\n"
] |
[
"1\n",
"3\n"
] |
In the second sample Fafa has 3 ways:
- choose only 1 employee as a team leader with 9 employees under his responsibility. - choose 2 employees as team leaders with 4 employees under the responsibility of each of them. - choose 5 employees as team leaders with 1 employee under the responsibility of each of them.
| 500
|
[
{
"input": "2",
"output": "1"
},
{
"input": "10",
"output": "3"
},
{
"input": "3",
"output": "1"
},
{
"input": "4",
"output": "2"
},
{
"input": "6",
"output": "3"
},
{
"input": "13",
"output": "1"
},
{
"input": "100000",
"output": "35"
},
{
"input": "1024",
"output": "10"
},
{
"input": "99999",
"output": "11"
},
{
"input": "10007",
"output": "1"
},
{
"input": "4096",
"output": "12"
},
{
"input": "65536",
"output": "16"
},
{
"input": "40320",
"output": "95"
},
{
"input": "30030",
"output": "63"
},
{
"input": "161",
"output": "3"
},
{
"input": "1000",
"output": "15"
},
{
"input": "10000",
"output": "24"
},
{
"input": "777",
"output": "7"
},
{
"input": "121",
"output": "2"
},
{
"input": "25",
"output": "2"
},
{
"input": "40000",
"output": "34"
},
{
"input": "99990",
"output": "47"
},
{
"input": "98765",
"output": "3"
},
{
"input": "56789",
"output": "3"
},
{
"input": "13579",
"output": "3"
},
{
"input": "97531",
"output": "3"
},
{
"input": "12345",
"output": "7"
},
{
"input": "54321",
"output": "7"
},
{
"input": "83160",
"output": "127"
},
{
"input": "9",
"output": "2"
},
{
"input": "21",
"output": "3"
},
{
"input": "11",
"output": "1"
},
{
"input": "15",
"output": "3"
}
] | 1,685,115,490
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 33
| 77
| 1,331,200
|
n = int(input())
# n-l = k l
count = 0
for i in range(1, n):
if (n-i)%i == 0:
count += 1
print(count)
|
Title: Fafa and his Company
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Fafa owns a company that works on huge projects. There are *n* employees in Fafa's company. Whenever the company has a new project to start working on, Fafa has to divide the tasks of this project among all the employees.
Fafa finds doing this every time is very tiring for him. So, he decided to choose the best *l* employees in his company as team leaders. Whenever there is a new project, Fafa will divide the tasks among only the team leaders and each team leader will be responsible of some positive number of employees to give them the tasks. To make this process fair for the team leaders, each one of them should be responsible for the same number of employees. Moreover, every employee, who is not a team leader, has to be under the responsibility of exactly one team leader, and no team leader is responsible for another team leader.
Given the number of employees *n*, find in how many ways Fafa could choose the number of team leaders *l* in such a way that it is possible to divide employees between them evenly.
Input Specification:
The input consists of a single line containing a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of employees in Fafa's company.
Output Specification:
Print a single integer representing the answer to the problem.
Demo Input:
['2\n', '10\n']
Demo Output:
['1\n', '3\n']
Note:
In the second sample Fafa has 3 ways:
- choose only 1 employee as a team leader with 9 employees under his responsibility. - choose 2 employees as team leaders with 4 employees under the responsibility of each of them. - choose 5 employees as team leaders with 1 employee under the responsibility of each of them.
|
```python
n = int(input())
# n-l = k l
count = 0
for i in range(1, n):
if (n-i)%i == 0:
count += 1
print(count)
```
| 3
|
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,564,095,377
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 248
| 0
|
n = int(input())
list1 = list(map(int, input().split()))
countOdd = countEven = even = odd = 0
for i in range(len(list1)):
if list1[i] % 2 == 0:
countEven += 1
even = list1[i]
else:
countOdd += 1
odd = list1[i]
if countOdd == 1:
print(list1.index(odd) + 1)
else:
print(list1.index(even) + 1)
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
n = int(input())
list1 = list(map(int, input().split()))
countOdd = countEven = even = odd = 0
for i in range(len(list1)):
if list1[i] % 2 == 0:
countEven += 1
even = list1[i]
else:
countOdd += 1
odd = list1[i]
if countOdd == 1:
print(list1.index(odd) + 1)
else:
print(list1.index(even) + 1)
```
| 3.938
|
265
|
A
|
Colorful Stones (Simplified Edition)
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
|
The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
|
Print the final 1-based position of Liss in a single line.
|
[
"RGB\nRRR\n",
"RRRBGBRBBB\nBBBRR\n",
"BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n"
] |
[
"2\n",
"3\n",
"15\n"
] |
none
| 500
|
[
{
"input": "RGB\nRRR",
"output": "2"
},
{
"input": "RRRBGBRBBB\nBBBRR",
"output": "3"
},
{
"input": "BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB",
"output": "15"
},
{
"input": "G\nRRBBRBRRBR",
"output": "1"
},
{
"input": "RRRRRBRRBRRGRBGGRRRGRBBRBBBBBRGRBGBRRGBBBRBBGBRGBB\nB",
"output": "1"
},
{
"input": "RRGGBRGRBG\nBRRGGBBGGR",
"output": "7"
},
{
"input": "BBRRGBGGRGBRGBRBRBGR\nGGGRBGGGBRRRRGRBGBGRGRRBGRBGBG",
"output": "15"
},
{
"input": "GBRRBGBGBBBBRRRGBGRRRGBGBBBRGR\nRRGBRRGRBBBBBBGRRBBR",
"output": "8"
},
{
"input": "BRGRRGRGRRGBBGBBBRRBBRRBGBBGRGBBGGRGBRBGGGRRRBGGBB\nRGBBGRRBBBRRGRRBRBBRGBBGGGRGBGRRRRBRBGGBRBGGGRGBRR",
"output": "16"
},
{
"input": "GGRGGBRRGRGBRRGGRBBGGRRGBBBGBBBGGRBGGBRBBRGBRRRBRG\nGGRGRRRRRRRRRGBBBBRGBRGRGRRGBBRGGBRBBRBGBRGRRRRGGR",
"output": "18"
},
{
"input": "RBBRBGBBGGGBRRBGBRGRRGGRBBBBGRBGGBRRBGBBRBRGBBGGGG\nBRRGRBGRBGBRGBRBGGBBBGBBRGRBGRGRBGRBGGRRBGBRGRRBBG",
"output": "23"
},
{
"input": "RRGGRRBRGRGBRGBRGBBRGGGBRBGBRGBRGGBRBRGBGRRBBGGRBR\nBRGRBBBGRBGRRGGRRRRRRRRGGGGGGGGBGGGGGGGRGRBBRGRGBR",
"output": "14"
},
{
"input": "RBRBRRRRRGGR\nBBBBRRGGBGRBRGBBRGGGRGGBRRBRBRBGGG",
"output": "12"
},
{
"input": "GGRGGGBRGRGRBBRGGGRBGRRR\nGBBBBGBGBGBBBRGGRGGBGRRGRRRGBGB",
"output": "12"
},
{
"input": "RGRBGBRBBGBRRGGGBBGBRRBGRGBBBBBGRRRGGRBB\nBGR",
"output": "2"
},
{
"input": "R\nB",
"output": "1"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "50"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
},
{
"input": "R\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
}
] | 1,684,043,904
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 19
| 92
| 0
|
s1=input()
s2=input()
idx=0
for i in s2:
if s1[idx]==i:
idx+=1
print(idx+1)
|
Title: Colorful Stones (Simplified Edition)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
Input Specification:
The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
Output Specification:
Print the final 1-based position of Liss in a single line.
Demo Input:
['RGB\nRRR\n', 'RRRBGBRBBB\nBBBRR\n', 'BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n']
Demo Output:
['2\n', '3\n', '15\n']
Note:
none
|
```python
s1=input()
s2=input()
idx=0
for i in s2:
if s1[idx]==i:
idx+=1
print(idx+1)
```
| 3
|
|
588
|
A
|
Duff and Meat
|
PROGRAMMING
| 900
|
[
"greedy"
] | null | null |
Duff is addicted to meat! Malek wants to keep her happy for *n* days. In order to be happy in *i*-th day, she needs to eat exactly *a**i* kilograms of meat.
There is a big shop uptown and Malek wants to buy meat for her from there. In *i*-th day, they sell meat for *p**i* dollars per kilogram. Malek knows all numbers *a*1,<=...,<=*a**n* and *p*1,<=...,<=*p**n*. In each day, he can buy arbitrary amount of meat, also he can keep some meat he has for the future.
Malek is a little tired from cooking meat, so he asked for your help. Help him to minimize the total money he spends to keep Duff happy for *n* days.
|
The first line of input contains integer *n* (1<=≤<=*n*<=≤<=105), the number of days.
In the next *n* lines, *i*-th line contains two integers *a**i* and *p**i* (1<=≤<=*a**i*,<=*p**i*<=≤<=100), the amount of meat Duff needs and the cost of meat in that day.
|
Print the minimum money needed to keep Duff happy for *n* days, in one line.
|
[
"3\n1 3\n2 2\n3 1\n",
"3\n1 3\n2 1\n3 2\n"
] |
[
"10\n",
"8\n"
] |
In the first sample case: An optimal way would be to buy 1 kg on the first day, 2 kg on the second day and 3 kg on the third day.
In the second sample case: An optimal way would be to buy 1 kg on the first day and 5 kg (needed meat for the second and third day) on the second day.
| 750
|
[
{
"input": "3\n1 3\n2 2\n3 1",
"output": "10"
},
{
"input": "3\n1 3\n2 1\n3 2",
"output": "8"
},
{
"input": "1\n39 52",
"output": "2028"
},
{
"input": "2\n25 56\n94 17",
"output": "2998"
},
{
"input": "5\n39 21\n95 89\n73 90\n9 55\n85 32",
"output": "6321"
},
{
"input": "12\n70 11\n74 27\n32 11\n26 83\n57 18\n97 28\n75 43\n75 21\n84 29\n16 2\n89 63\n21 88",
"output": "6742"
},
{
"input": "2\n100 68\n38 80",
"output": "9384"
}
] | 1,620,457,789
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 30
| 841
| 31,334,400
|
import math
def main_function():
input_data = [[int(i) for i in input().split(" ")] for j in range(int(input()))]
total = 0
current_lowest_price = 1000000000000000000000000000000000000000000
for i in input_data:
needed_meat, price = i
if price < current_lowest_price:
current_lowest_price = price
total += current_lowest_price * needed_meat
return total
print(main_function())
|
Title: Duff and Meat
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Duff is addicted to meat! Malek wants to keep her happy for *n* days. In order to be happy in *i*-th day, she needs to eat exactly *a**i* kilograms of meat.
There is a big shop uptown and Malek wants to buy meat for her from there. In *i*-th day, they sell meat for *p**i* dollars per kilogram. Malek knows all numbers *a*1,<=...,<=*a**n* and *p*1,<=...,<=*p**n*. In each day, he can buy arbitrary amount of meat, also he can keep some meat he has for the future.
Malek is a little tired from cooking meat, so he asked for your help. Help him to minimize the total money he spends to keep Duff happy for *n* days.
Input Specification:
The first line of input contains integer *n* (1<=≤<=*n*<=≤<=105), the number of days.
In the next *n* lines, *i*-th line contains two integers *a**i* and *p**i* (1<=≤<=*a**i*,<=*p**i*<=≤<=100), the amount of meat Duff needs and the cost of meat in that day.
Output Specification:
Print the minimum money needed to keep Duff happy for *n* days, in one line.
Demo Input:
['3\n1 3\n2 2\n3 1\n', '3\n1 3\n2 1\n3 2\n']
Demo Output:
['10\n', '8\n']
Note:
In the first sample case: An optimal way would be to buy 1 kg on the first day, 2 kg on the second day and 3 kg on the third day.
In the second sample case: An optimal way would be to buy 1 kg on the first day and 5 kg (needed meat for the second and third day) on the second day.
|
```python
import math
def main_function():
input_data = [[int(i) for i in input().split(" ")] for j in range(int(input()))]
total = 0
current_lowest_price = 1000000000000000000000000000000000000000000
for i in input_data:
needed_meat, price = i
if price < current_lowest_price:
current_lowest_price = price
total += current_lowest_price * needed_meat
return total
print(main_function())
```
| 3
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,674,559,456
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 20
| 61
| 0
|
n,m,a = map(int,input().split())
x = n//a
y = m//a
if n%a != 0:
x +=1
if m%a != 0:
y +=1
print(x*y)
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
n,m,a = map(int,input().split())
x = n//a
y = m//a
if n%a != 0:
x +=1
if m%a != 0:
y +=1
print(x*y)
```
| 3.9695
|
385
|
A
|
Bear and Raspberry
|
PROGRAMMING
| 1,000
|
[
"brute force",
"greedy",
"implementation"
] | null | null |
The bear decided to store some raspberry for the winter. He cunningly found out the price for a barrel of honey in kilos of raspberry for each of the following *n* days. According to the bear's data, on the *i*-th (1<=≤<=*i*<=≤<=*n*) day, the price for one barrel of honey is going to is *x**i* kilos of raspberry.
Unfortunately, the bear has neither a honey barrel, nor the raspberry. At the same time, the bear's got a friend who is ready to lend him a barrel of honey for exactly one day for *c* kilograms of raspberry. That's why the bear came up with a smart plan. He wants to choose some day *d* (1<=≤<=*d*<=<<=*n*), lent a barrel of honey and immediately (on day *d*) sell it according to a daily exchange rate. The next day (*d*<=+<=1) the bear wants to buy a new barrel of honey according to a daily exchange rate (as he's got some raspberry left from selling the previous barrel) and immediately (on day *d*<=+<=1) give his friend the borrowed barrel of honey as well as *c* kilograms of raspberry for renting the barrel.
The bear wants to execute his plan at most once and then hibernate. What maximum number of kilograms of raspberry can he earn? Note that if at some point of the plan the bear runs out of the raspberry, then he won't execute such a plan.
|
The first line contains two space-separated integers, *n* and *c* (2<=≤<=*n*<=≤<=100,<=0<=≤<=*c*<=≤<=100), — the number of days and the number of kilos of raspberry that the bear should give for borrowing the barrel.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=100), the price of a honey barrel on day *i*.
|
Print a single integer — the answer to the problem.
|
[
"5 1\n5 10 7 3 20\n",
"6 2\n100 1 10 40 10 40\n",
"3 0\n1 2 3\n"
] |
[
"3\n",
"97\n",
"0\n"
] |
In the first sample the bear will lend a honey barrel at day 3 and then sell it for 7. Then the bear will buy a barrel for 3 and return it to the friend. So, the profit is (7 - 3 - 1) = 3.
In the second sample bear will lend a honey barrel at day 1 and then sell it for 100. Then the bear buy the barrel for 1 at the day 2. So, the profit is (100 - 1 - 2) = 97.
| 500
|
[
{
"input": "5 1\n5 10 7 3 20",
"output": "3"
},
{
"input": "6 2\n100 1 10 40 10 40",
"output": "97"
},
{
"input": "3 0\n1 2 3",
"output": "0"
},
{
"input": "2 0\n2 1",
"output": "1"
},
{
"input": "10 5\n10 1 11 2 12 3 13 4 14 5",
"output": "4"
},
{
"input": "100 4\n2 57 70 8 44 10 88 67 50 44 93 79 72 50 69 19 21 9 71 47 95 13 46 10 68 72 54 40 15 83 57 92 58 25 4 22 84 9 8 55 87 0 16 46 86 58 5 21 32 28 10 46 11 29 13 33 37 34 78 33 33 21 46 70 77 51 45 97 6 21 68 61 87 54 8 91 37 12 76 61 57 9 100 45 44 88 5 71 98 98 26 45 37 87 34 50 33 60 64 77",
"output": "87"
},
{
"input": "100 5\n15 91 86 53 18 52 26 89 8 4 5 100 11 64 88 91 35 57 67 72 71 71 69 73 97 23 11 1 59 86 37 82 6 67 71 11 7 31 11 68 21 43 89 54 27 10 3 33 8 57 79 26 90 81 6 28 24 7 33 50 24 13 27 85 4 93 14 62 37 67 33 40 7 48 41 4 14 9 95 10 64 62 7 93 23 6 28 27 97 64 26 83 70 0 97 74 11 82 70 93",
"output": "84"
},
{
"input": "6 100\n10 9 8 7 6 5",
"output": "0"
},
{
"input": "100 9\n66 71 37 41 23 38 77 11 74 13 51 26 93 56 81 17 12 70 85 37 54 100 14 99 12 83 44 16 99 65 13 48 92 32 69 33 100 57 58 88 25 45 44 85 5 41 82 15 37 18 21 45 3 68 33 9 52 64 8 73 32 41 87 99 26 26 47 24 79 93 9 44 11 34 85 26 14 61 49 38 25 65 49 81 29 82 28 23 2 64 38 13 77 68 67 23 58 57 83 46",
"output": "78"
},
{
"input": "100 100\n9 72 46 37 26 94 80 1 43 85 26 53 58 18 24 19 67 2 100 52 61 81 48 15 73 41 97 93 45 1 73 54 75 51 28 79 0 14 41 42 24 50 70 18 96 100 67 1 68 48 44 39 63 77 78 18 10 51 32 53 26 60 1 13 66 39 55 27 23 71 75 0 27 88 73 31 16 95 87 84 86 71 37 40 66 70 65 83 19 4 81 99 26 51 67 63 80 54 23 44",
"output": "0"
},
{
"input": "43 65\n32 58 59 75 85 18 57 100 69 0 36 38 79 95 82 47 7 55 28 88 27 88 63 71 80 86 67 53 69 37 99 54 81 19 55 12 2 17 84 77 25 26 62",
"output": "4"
},
{
"input": "12 64\n14 87 40 24 32 36 4 41 38 77 68 71",
"output": "0"
},
{
"input": "75 94\n80 92 25 48 78 17 69 52 79 73 12 15 59 55 25 61 96 27 98 43 30 43 36 94 67 54 86 99 100 61 65 8 65 19 18 21 75 31 2 98 55 87 14 1 17 97 94 11 57 29 34 71 76 67 45 0 78 29 86 82 29 23 77 100 48 43 65 62 88 34 7 28 13 1 1",
"output": "0"
},
{
"input": "59 27\n76 61 24 66 48 18 69 84 21 8 64 90 19 71 36 90 9 36 30 37 99 37 100 56 9 79 55 37 54 63 11 11 49 71 91 70 14 100 10 44 52 23 21 19 96 13 93 66 52 79 76 5 62 6 90 35 94 7 27",
"output": "63"
},
{
"input": "86 54\n41 84 16 5 20 79 73 13 23 24 42 73 70 80 69 71 33 44 62 29 86 88 40 64 61 55 58 19 16 23 84 100 38 91 89 98 47 50 55 87 12 94 2 12 0 1 4 26 50 96 68 34 94 80 8 22 60 3 72 84 65 89 44 52 50 9 24 34 81 28 56 17 38 85 78 90 62 60 1 40 91 2 7 41 84 22",
"output": "38"
},
{
"input": "37 2\n65 36 92 92 92 76 63 56 15 95 75 26 15 4 73 50 41 92 26 20 19 100 63 55 25 75 61 96 35 0 14 6 96 3 28 41 83",
"output": "91"
},
{
"input": "19 4\n85 2 56 70 33 75 89 60 100 81 42 28 18 92 29 96 49 23 14",
"output": "79"
},
{
"input": "89 1\n50 53 97 41 68 27 53 66 93 19 11 78 46 49 38 69 96 9 43 16 1 63 95 64 96 6 34 34 45 40 19 4 53 8 11 18 95 25 50 16 64 33 97 49 23 81 63 10 30 73 76 55 7 70 9 98 6 36 75 78 3 92 85 75 40 75 55 71 9 91 15 17 47 55 44 35 55 88 53 87 61 22 100 56 14 87 36 84 24",
"output": "91"
},
{
"input": "67 0\n40 48 15 46 90 7 65 52 24 15 42 81 2 6 71 94 32 18 97 67 83 98 48 51 10 47 8 68 36 46 65 75 90 30 62 9 5 35 80 60 69 58 62 68 58 73 80 9 22 46 56 64 44 11 93 73 62 54 15 20 17 69 16 33 85 62 49",
"output": "83"
},
{
"input": "96 0\n38 97 82 43 80 40 1 99 50 94 81 63 92 13 57 24 4 10 25 32 79 56 96 19 25 14 69 56 66 22 23 78 87 76 37 30 75 77 61 64 35 64 62 32 44 62 6 84 91 44 99 5 71 19 17 12 35 52 1 14 35 18 8 36 54 42 4 67 80 11 88 44 34 35 12 38 66 42 4 90 45 10 1 44 37 96 23 28 100 90 75 17 27 67 51 70",
"output": "94"
},
{
"input": "14 14\n87 63 62 31 59 47 40 89 92 43 80 30 99 42",
"output": "43"
},
{
"input": "12 0\n100 1 100 2 100 3 100 4 100 5 100 0",
"output": "100"
},
{
"input": "3 1\n1 2 3",
"output": "0"
},
{
"input": "3 2\n3 3 3",
"output": "0"
},
{
"input": "3 3\n3 2 1",
"output": "0"
},
{
"input": "3 100\n1 2 3",
"output": "0"
},
{
"input": "2 100\n0 0",
"output": "0"
},
{
"input": "2 90\n10 5",
"output": "0"
},
{
"input": "2 5\n5 4",
"output": "0"
},
{
"input": "3 1\n19 20 1",
"output": "18"
},
{
"input": "5 1\n5 10 7 4 20",
"output": "2"
},
{
"input": "5 1\n1 2 3 4 5",
"output": "0"
}
] | 1,698,574,321
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 46
| 0
|
n, c = map(int, input().split())
v = 0
a = input().split()
for i in range(n - 1):
d1, d2 = int(a[i]), int(a[i + 1])
v1 = d1 - d2 - c
if v1 > v:
v = v1
print(v)
|
Title: Bear and Raspberry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The bear decided to store some raspberry for the winter. He cunningly found out the price for a barrel of honey in kilos of raspberry for each of the following *n* days. According to the bear's data, on the *i*-th (1<=≤<=*i*<=≤<=*n*) day, the price for one barrel of honey is going to is *x**i* kilos of raspberry.
Unfortunately, the bear has neither a honey barrel, nor the raspberry. At the same time, the bear's got a friend who is ready to lend him a barrel of honey for exactly one day for *c* kilograms of raspberry. That's why the bear came up with a smart plan. He wants to choose some day *d* (1<=≤<=*d*<=<<=*n*), lent a barrel of honey and immediately (on day *d*) sell it according to a daily exchange rate. The next day (*d*<=+<=1) the bear wants to buy a new barrel of honey according to a daily exchange rate (as he's got some raspberry left from selling the previous barrel) and immediately (on day *d*<=+<=1) give his friend the borrowed barrel of honey as well as *c* kilograms of raspberry for renting the barrel.
The bear wants to execute his plan at most once and then hibernate. What maximum number of kilograms of raspberry can he earn? Note that if at some point of the plan the bear runs out of the raspberry, then he won't execute such a plan.
Input Specification:
The first line contains two space-separated integers, *n* and *c* (2<=≤<=*n*<=≤<=100,<=0<=≤<=*c*<=≤<=100), — the number of days and the number of kilos of raspberry that the bear should give for borrowing the barrel.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=100), the price of a honey barrel on day *i*.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['5 1\n5 10 7 3 20\n', '6 2\n100 1 10 40 10 40\n', '3 0\n1 2 3\n']
Demo Output:
['3\n', '97\n', '0\n']
Note:
In the first sample the bear will lend a honey barrel at day 3 and then sell it for 7. Then the bear will buy a barrel for 3 and return it to the friend. So, the profit is (7 - 3 - 1) = 3.
In the second sample bear will lend a honey barrel at day 1 and then sell it for 100. Then the bear buy the barrel for 1 at the day 2. So, the profit is (100 - 1 - 2) = 97.
|
```python
n, c = map(int, input().split())
v = 0
a = input().split()
for i in range(n - 1):
d1, d2 = int(a[i]), int(a[i + 1])
v1 = d1 - d2 - c
if v1 > v:
v = v1
print(v)
```
| 3
|
|
869
|
A
|
The Artful Expedient
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation"
] | null | null |
Rock... Paper!
After Karen have found the deterministic winning (losing?) strategy for rock-paper-scissors, her brother, Koyomi, comes up with a new game as a substitute. The game works as follows.
A positive integer *n* is decided first. Both Koyomi and Karen independently choose *n* distinct positive integers, denoted by *x*1,<=*x*2,<=...,<=*x**n* and *y*1,<=*y*2,<=...,<=*y**n* respectively. They reveal their sequences, and repeat until all of 2*n* integers become distinct, which is the only final state to be kept and considered.
Then they count the number of ordered pairs (*i*,<=*j*) (1<=≤<=*i*,<=*j*<=≤<=*n*) such that the value *x**i* xor *y**j* equals to one of the 2*n* integers. Here xor means the [bitwise exclusive or](https://en.wikipedia.org/wiki/Bitwise_operation#XOR) operation on two integers, and is denoted by operators ^ and/or xor in most programming languages.
Karen claims a win if the number of such pairs is even, and Koyomi does otherwise. And you're here to help determine the winner of their latest game.
|
The first line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=2<=000) — the length of both sequences.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=2·106) — the integers finally chosen by Koyomi.
The third line contains *n* space-separated integers *y*1,<=*y*2,<=...,<=*y**n* (1<=≤<=*y**i*<=≤<=2·106) — the integers finally chosen by Karen.
Input guarantees that the given 2*n* integers are pairwise distinct, that is, no pair (*i*,<=*j*) (1<=≤<=*i*,<=*j*<=≤<=*n*) exists such that one of the following holds: *x**i*<==<=*y**j*; *i*<=≠<=*j* and *x**i*<==<=*x**j*; *i*<=≠<=*j* and *y**i*<==<=*y**j*.
|
Output one line — the name of the winner, that is, "Koyomi" or "Karen" (without quotes). Please be aware of the capitalization.
|
[
"3\n1 2 3\n4 5 6\n",
"5\n2 4 6 8 10\n9 7 5 3 1\n"
] |
[
"Karen\n",
"Karen\n"
] |
In the first example, there are 6 pairs satisfying the constraint: (1, 1), (1, 2), (2, 1), (2, 3), (3, 2) and (3, 3). Thus, Karen wins since 6 is an even number.
In the second example, there are 16 such pairs, and Karen wins again.
| 500
|
[
{
"input": "3\n1 2 3\n4 5 6",
"output": "Karen"
},
{
"input": "5\n2 4 6 8 10\n9 7 5 3 1",
"output": "Karen"
},
{
"input": "1\n1\n2000000",
"output": "Karen"
},
{
"input": "2\n97153 2000000\n1999998 254",
"output": "Karen"
},
{
"input": "15\n31 30 29 28 27 26 25 24 23 22 21 20 19 18 17\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15",
"output": "Karen"
},
{
"input": "30\n79656 68607 871714 1858841 237684 1177337 532141 161161 1111201 527235 323345 1979059 665353 507265 1290761 610606 1238375 743262 106355 1167830 180315 1233029 816465 752968 782570 1499881 1328457 1867240 13948 1302782\n322597 1868510 1958236 1348157 765908 1023636 874300 537124 631783 414906 886318 1931572 1381013 992451 1305644 1525745 716087 83173 303248 1572710 43084 333341 992413 267806 70390 644521 1014900 497068 178940 1920268",
"output": "Karen"
},
{
"input": "30\n1143673 436496 1214486 1315862 148404 724601 1430740 1433008 1654610 1635673 614673 1713408 1270999 1697 1463796 50027 525482 1659078 688200 842647 518551 877506 1017082 1807856 3280 759698 1208220 470180 829800 1960886\n1312613 1965095 967255 1289012 1950383 582960 856825 49684 808824 319418 1968270 190821 344545 211332 1219388 1773751 1876402 132626 541448 1584672 24276 1053225 1823073 1858232 1209173 1035991 1956373 1237148 1973608 848873",
"output": "Karen"
},
{
"input": "1\n2\n3",
"output": "Karen"
},
{
"input": "1\n1048576\n1020000",
"output": "Karen"
},
{
"input": "3\n9 33 69\n71 74 100",
"output": "Karen"
},
{
"input": "3\n1 2 3\n9 5 6",
"output": "Karen"
},
{
"input": "3\n1 7 8\n9 10 20",
"output": "Karen"
},
{
"input": "3\n1 3 2\n4 5 8",
"output": "Karen"
},
{
"input": "3\n2 1 100\n3 4 9",
"output": "Karen"
},
{
"input": "3\n3 1 100\n2 1000 100000",
"output": "Karen"
},
{
"input": "3\n1 2 5\n3 4 6",
"output": "Karen"
},
{
"input": "3\n3 1 8\n2 4 17",
"output": "Karen"
},
{
"input": "3\n1 5 6\n7 8 3",
"output": "Karen"
},
{
"input": "1\n1\n3",
"output": "Karen"
},
{
"input": "3\n1 3 10\n2 4 20",
"output": "Karen"
},
{
"input": "3\n7 8 10\n15 9 11",
"output": "Karen"
},
{
"input": "3\n5 6 8\n3 100 9",
"output": "Karen"
},
{
"input": "3\n1 2 3\n4 5 8",
"output": "Karen"
},
{
"input": "3\n1 2 19\n3 7 30",
"output": "Karen"
},
{
"input": "3\n1 2 3\n6 7 8",
"output": "Karen"
},
{
"input": "3\n1 4 55\n2 3 9",
"output": "Karen"
},
{
"input": "3\n1 100 200\n5 4 500",
"output": "Karen"
},
{
"input": "1\n6\n7",
"output": "Karen"
},
{
"input": "3\n1 3 5\n2 4 13",
"output": "Karen"
},
{
"input": "3\n3 1 100\n2 1000 10000",
"output": "Karen"
},
{
"input": "3\n1 3 9\n2 4 40",
"output": "Karen"
},
{
"input": "2\n1 199999\n1935807 2000000",
"output": "Karen"
},
{
"input": "3\n1 3 8\n2 4 24",
"output": "Karen"
},
{
"input": "2\n4 1\n7 3",
"output": "Karen"
},
{
"input": "3\n1 2 4\n3 7 8",
"output": "Karen"
},
{
"input": "3\n1 6 10000\n2 3 100000",
"output": "Karen"
}
] | 1,591,207,454
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 49
| 155
| 1,638,400
|
# for(i=0;i<n;i++){
# cin>>k;
# sum+=k;
# if(k&1) flag=min(flag,k);
# }
# if(sum&1) cout<<sum;
# else cout<<max(0LL,sum-flag);
n=(int)(input())
ll=list(map(int,input().split()))
l=list(map(int,input().split()))
print('Karen')
|
Title: The Artful Expedient
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Rock... Paper!
After Karen have found the deterministic winning (losing?) strategy for rock-paper-scissors, her brother, Koyomi, comes up with a new game as a substitute. The game works as follows.
A positive integer *n* is decided first. Both Koyomi and Karen independently choose *n* distinct positive integers, denoted by *x*1,<=*x*2,<=...,<=*x**n* and *y*1,<=*y*2,<=...,<=*y**n* respectively. They reveal their sequences, and repeat until all of 2*n* integers become distinct, which is the only final state to be kept and considered.
Then they count the number of ordered pairs (*i*,<=*j*) (1<=≤<=*i*,<=*j*<=≤<=*n*) such that the value *x**i* xor *y**j* equals to one of the 2*n* integers. Here xor means the [bitwise exclusive or](https://en.wikipedia.org/wiki/Bitwise_operation#XOR) operation on two integers, and is denoted by operators ^ and/or xor in most programming languages.
Karen claims a win if the number of such pairs is even, and Koyomi does otherwise. And you're here to help determine the winner of their latest game.
Input Specification:
The first line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=2<=000) — the length of both sequences.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=2·106) — the integers finally chosen by Koyomi.
The third line contains *n* space-separated integers *y*1,<=*y*2,<=...,<=*y**n* (1<=≤<=*y**i*<=≤<=2·106) — the integers finally chosen by Karen.
Input guarantees that the given 2*n* integers are pairwise distinct, that is, no pair (*i*,<=*j*) (1<=≤<=*i*,<=*j*<=≤<=*n*) exists such that one of the following holds: *x**i*<==<=*y**j*; *i*<=≠<=*j* and *x**i*<==<=*x**j*; *i*<=≠<=*j* and *y**i*<==<=*y**j*.
Output Specification:
Output one line — the name of the winner, that is, "Koyomi" or "Karen" (without quotes). Please be aware of the capitalization.
Demo Input:
['3\n1 2 3\n4 5 6\n', '5\n2 4 6 8 10\n9 7 5 3 1\n']
Demo Output:
['Karen\n', 'Karen\n']
Note:
In the first example, there are 6 pairs satisfying the constraint: (1, 1), (1, 2), (2, 1), (2, 3), (3, 2) and (3, 3). Thus, Karen wins since 6 is an even number.
In the second example, there are 16 such pairs, and Karen wins again.
|
```python
# for(i=0;i<n;i++){
# cin>>k;
# sum+=k;
# if(k&1) flag=min(flag,k);
# }
# if(sum&1) cout<<sum;
# else cout<<max(0LL,sum-flag);
n=(int)(input())
ll=list(map(int,input().split()))
l=list(map(int,input().split()))
print('Karen')
```
| 3
|
|
624
|
A
|
Save Luke
|
PROGRAMMING
| 800
|
[
"math"
] | null | null |
Luke Skywalker got locked up in a rubbish shredder between two presses. R2D2 is already working on his rescue, but Luke needs to stay alive as long as possible. For simplicity we will assume that everything happens on a straight line, the presses are initially at coordinates 0 and *L*, and they move towards each other with speed *v*1 and *v*2, respectively. Luke has width *d* and is able to choose any position between the presses. Luke dies as soon as the distance between the presses is less than his width. Your task is to determine for how long Luke can stay alive.
|
The first line of the input contains four integers *d*, *L*, *v*1, *v*2 (1<=≤<=*d*,<=*L*,<=*v*1,<=*v*2<=≤<=10<=000,<=*d*<=<<=*L*) — Luke's width, the initial position of the second press and the speed of the first and second presses, respectively.
|
Print a single real value — the maximum period of time Luke can stay alive for. Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6.
Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if .
|
[
"2 6 2 2\n",
"1 9 1 2\n"
] |
[
"1.00000000000000000000\n",
"2.66666666666666650000\n"
] |
In the first sample Luke should stay exactly in the middle of the segment, that is at coordinates [2;4], as the presses move with the same speed.
In the second sample he needs to occupy the position <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/71395c777960eaded59a9fdc428a9625f152605b.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In this case both presses move to his edges at the same time.
| 500
|
[
{
"input": "2 6 2 2",
"output": "1.00000000000000000000"
},
{
"input": "1 9 1 2",
"output": "2.66666666666666650000"
},
{
"input": "1 10000 1 1",
"output": "4999.50000000000000000000"
},
{
"input": "9999 10000 10000 10000",
"output": "0.00005000000000000000"
},
{
"input": "1023 2340 1029 3021",
"output": "0.32518518518518519000"
},
{
"input": "2173 2176 10000 9989",
"output": "0.00015008254539996998"
},
{
"input": "1 2 123 1",
"output": "0.00806451612903225780"
},
{
"input": "123 1242 12 312",
"output": "3.45370370370370370000"
},
{
"input": "2 9997 3 12",
"output": "666.33333333333337000000"
},
{
"input": "1 10000 10000 10000",
"output": "0.49995000000000001000"
},
{
"input": "3274 4728 888 4578",
"output": "0.26600804976216613000"
},
{
"input": "4600 9696 5634 8248",
"output": "0.36709407866301685000"
},
{
"input": "2255 7902 8891 429",
"output": "0.60590128755364803000"
},
{
"input": "6745 9881 2149 9907",
"output": "0.26011944260119441000"
},
{
"input": "4400 8021 6895 2089",
"output": "0.40304986642920748000"
},
{
"input": "5726 9082 7448 3054",
"output": "0.31955817939440107000"
},
{
"input": "3381 9769 4898 2532",
"output": "0.85975773889636609000"
},
{
"input": "1036 6259 5451 4713",
"output": "0.51387249114521838000"
},
{
"input": "5526 6455 197 4191",
"output": "0.21171376481312670000"
},
{
"input": "1196 4082 4071 9971",
"output": "0.20552627830793335000"
},
{
"input": "8850 9921 8816 9449",
"output": "0.05863673692855187600"
},
{
"input": "3341 7299 2074 8927",
"output": "0.35978547404781386000"
},
{
"input": "7831 8609 6820 2596",
"output": "0.08262531860662701600"
},
{
"input": "2322 7212 77 4778",
"output": "1.00720906282183310000"
},
{
"input": "9976 9996 4823 4255",
"output": "0.00220312844238819110"
},
{
"input": "7631 9769 5377 6437",
"output": "0.18097172845776197000"
},
{
"input": "8957 9525 8634 107",
"output": "0.06498112344125385500"
},
{
"input": "6612 9565 3380 2288",
"output": "0.52099505998588569000"
},
{
"input": "1103 6256 3934 9062",
"output": "0.39650661742074483000"
},
{
"input": "1854 3280 1481 2140",
"output": "0.39381386357359843000"
}
] | 1,687,707,576
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 30
| 62
| 0
|
d, l, v1, v2 = map(int, input().split())
print(round((l-d)/(v1+v2), 16))
|
Title: Save Luke
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Luke Skywalker got locked up in a rubbish shredder between two presses. R2D2 is already working on his rescue, but Luke needs to stay alive as long as possible. For simplicity we will assume that everything happens on a straight line, the presses are initially at coordinates 0 and *L*, and they move towards each other with speed *v*1 and *v*2, respectively. Luke has width *d* and is able to choose any position between the presses. Luke dies as soon as the distance between the presses is less than his width. Your task is to determine for how long Luke can stay alive.
Input Specification:
The first line of the input contains four integers *d*, *L*, *v*1, *v*2 (1<=≤<=*d*,<=*L*,<=*v*1,<=*v*2<=≤<=10<=000,<=*d*<=<<=*L*) — Luke's width, the initial position of the second press and the speed of the first and second presses, respectively.
Output Specification:
Print a single real value — the maximum period of time Luke can stay alive for. Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6.
Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if .
Demo Input:
['2 6 2 2\n', '1 9 1 2\n']
Demo Output:
['1.00000000000000000000\n', '2.66666666666666650000\n']
Note:
In the first sample Luke should stay exactly in the middle of the segment, that is at coordinates [2;4], as the presses move with the same speed.
In the second sample he needs to occupy the position <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/71395c777960eaded59a9fdc428a9625f152605b.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In this case both presses move to his edges at the same time.
|
```python
d, l, v1, v2 = map(int, input().split())
print(round((l-d)/(v1+v2), 16))
```
| 3
|
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,592,938,303
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 218
| 6,963,200
|
#Nearly Lucky
'''
a=list(map(str,input()))
l=0
for i in range(len(a)):
if(a[i]=='4' or a[i]=='7'):
l+=1
if(l==4 or l==7 or l==44 or l==47 or l==74 or l==77):
print("YES")
else:
print("NO")'''
a=int(input())
b=list(map(int,input().strip().split()))
e,o=[],[]
for i in range(len(b)):
if b[i]%2==0:
e.append(b[i])
else:
o.append(b[i])
if len(e)==1:
print(b.index(e[0])+1)
else:
print(b.index(o[0])+1)
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
#Nearly Lucky
'''
a=list(map(str,input()))
l=0
for i in range(len(a)):
if(a[i]=='4' or a[i]=='7'):
l+=1
if(l==4 or l==7 or l==44 or l==47 or l==74 or l==77):
print("YES")
else:
print("NO")'''
a=int(input())
b=list(map(int,input().strip().split()))
e,o=[],[]
for i in range(len(b)):
if b[i]%2==0:
e.append(b[i])
else:
o.append(b[i])
if len(e)==1:
print(b.index(e[0])+1)
else:
print(b.index(o[0])+1)
```
| 3.93253
|
811
|
A
|
Vladik and Courtesy
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
At regular competition Vladik and Valera won *a* and *b* candies respectively. Vladik offered 1 his candy to Valera. After that Valera gave Vladik 2 his candies, so that no one thought that he was less generous. Vladik for same reason gave 3 candies to Valera in next turn.
More formally, the guys take turns giving each other one candy more than they received in the previous turn.
This continued until the moment when one of them couldn’t give the right amount of candy. Candies, which guys got from each other, they don’t consider as their own. You need to know, who is the first who can’t give the right amount of candy.
|
Single line of input data contains two space-separated integers *a*, *b* (1<=≤<=*a*,<=*b*<=≤<=109) — number of Vladik and Valera candies respectively.
|
Pring a single line "Vladik’’ in case, if Vladik first who can’t give right amount of candy, or "Valera’’ otherwise.
|
[
"1 1\n",
"7 6\n"
] |
[
"Valera\n",
"Vladik\n"
] |
Illustration for first test case:
<img class="tex-graphics" src="https://espresso.codeforces.com/ad9b7d0e481208de8e3a585aa1d96b9e1dda4fd7.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Illustration for second test case:
<img class="tex-graphics" src="https://espresso.codeforces.com/9f4836d2ccdffaee5a63898e5d4e6caf2ed4678c.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 500
|
[
{
"input": "1 1",
"output": "Valera"
},
{
"input": "7 6",
"output": "Vladik"
},
{
"input": "25 38",
"output": "Vladik"
},
{
"input": "8311 2468",
"output": "Valera"
},
{
"input": "250708 857756",
"output": "Vladik"
},
{
"input": "957985574 24997558",
"output": "Valera"
},
{
"input": "999963734 999994456",
"output": "Vladik"
},
{
"input": "1000000000 1000000000",
"output": "Vladik"
},
{
"input": "946 879",
"output": "Valera"
},
{
"input": "10819 45238",
"output": "Vladik"
},
{
"input": "101357 236928",
"output": "Vladik"
},
{
"input": "1033090 7376359",
"output": "Vladik"
},
{
"input": "9754309 9525494",
"output": "Valera"
},
{
"input": "90706344 99960537",
"output": "Vladik"
},
{
"input": "965161805 908862070",
"output": "Valera"
},
{
"input": "9 11",
"output": "Valera"
},
{
"input": "3 2",
"output": "Vladik"
},
{
"input": "6 6",
"output": "Vladik"
},
{
"input": "4 4",
"output": "Valera"
},
{
"input": "5 5",
"output": "Valera"
},
{
"input": "5 4",
"output": "Valera"
},
{
"input": "12345680 1",
"output": "Valera"
},
{
"input": "9 10",
"output": "Valera"
},
{
"input": "678 76687",
"output": "Vladik"
},
{
"input": "1 678",
"output": "Vladik"
},
{
"input": "45 1678",
"output": "Vladik"
},
{
"input": "3 3",
"output": "Vladik"
},
{
"input": "10 11",
"output": "Valera"
},
{
"input": "2 1",
"output": "Valera"
},
{
"input": "1 2",
"output": "Vladik"
},
{
"input": "2 2",
"output": "Vladik"
},
{
"input": "4 5",
"output": "Valera"
},
{
"input": "9 6",
"output": "Valera"
},
{
"input": "1 5",
"output": "Vladik"
},
{
"input": "7 8",
"output": "Vladik"
},
{
"input": "1000000000 999982505",
"output": "Valera"
},
{
"input": "12 12",
"output": "Vladik"
},
{
"input": "1000 950",
"output": "Valera"
},
{
"input": "10 9",
"output": "Valera"
},
{
"input": "100 9",
"output": "Valera"
},
{
"input": "1000 996",
"output": "Vladik"
},
{
"input": "9 5",
"output": "Valera"
}
] | 1,624,546,494
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 62
| 0
|
a,b=map(int,input().split())
n=1
i=0
while(a>=0 and b>=0):
if n%2==0:
b-=n
n+=1
else:
a-=n
n+=1
print("Vladik") if a<0 else print("Valera")
|
Title: Vladik and Courtesy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
At regular competition Vladik and Valera won *a* and *b* candies respectively. Vladik offered 1 his candy to Valera. After that Valera gave Vladik 2 his candies, so that no one thought that he was less generous. Vladik for same reason gave 3 candies to Valera in next turn.
More formally, the guys take turns giving each other one candy more than they received in the previous turn.
This continued until the moment when one of them couldn’t give the right amount of candy. Candies, which guys got from each other, they don’t consider as their own. You need to know, who is the first who can’t give the right amount of candy.
Input Specification:
Single line of input data contains two space-separated integers *a*, *b* (1<=≤<=*a*,<=*b*<=≤<=109) — number of Vladik and Valera candies respectively.
Output Specification:
Pring a single line "Vladik’’ in case, if Vladik first who can’t give right amount of candy, or "Valera’’ otherwise.
Demo Input:
['1 1\n', '7 6\n']
Demo Output:
['Valera\n', 'Vladik\n']
Note:
Illustration for first test case:
<img class="tex-graphics" src="https://espresso.codeforces.com/ad9b7d0e481208de8e3a585aa1d96b9e1dda4fd7.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Illustration for second test case:
<img class="tex-graphics" src="https://espresso.codeforces.com/9f4836d2ccdffaee5a63898e5d4e6caf2ed4678c.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
a,b=map(int,input().split())
n=1
i=0
while(a>=0 and b>=0):
if n%2==0:
b-=n
n+=1
else:
a-=n
n+=1
print("Vladik") if a<0 else print("Valera")
```
| 3
|
|
620
|
A
|
Professor GukiZ's Robot
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Professor GukiZ makes a new robot. The robot are in the point with coordinates (*x*1,<=*y*1) and should go to the point (*x*2,<=*y*2). In a single step the robot can change any of its coordinates (maybe both of them) by one (decrease or increase). So the robot can move in one of the 8 directions. Find the minimal number of steps the robot should make to get the finish position.
|
The first line contains two integers *x*1,<=*y*1 (<=-<=109<=≤<=*x*1,<=*y*1<=≤<=109) — the start position of the robot.
The second line contains two integers *x*2,<=*y*2 (<=-<=109<=≤<=*x*2,<=*y*2<=≤<=109) — the finish position of the robot.
|
Print the only integer *d* — the minimal number of steps to get the finish position.
|
[
"0 0\n4 5\n",
"3 4\n6 1\n"
] |
[
"5\n",
"3\n"
] |
In the first example robot should increase both of its coordinates by one four times, so it will be in position (4, 4). After that robot should simply increase its *y* coordinate and get the finish position.
In the second example robot should simultaneously increase *x* coordinate and decrease *y* coordinate by one three times.
| 0
|
[
{
"input": "0 0\n4 5",
"output": "5"
},
{
"input": "3 4\n6 1",
"output": "3"
},
{
"input": "0 0\n4 6",
"output": "6"
},
{
"input": "1 1\n-3 -5",
"output": "6"
},
{
"input": "-1 -1\n-10 100",
"output": "101"
},
{
"input": "1 -1\n100 -100",
"output": "99"
},
{
"input": "-1000000000 -1000000000\n1000000000 1000000000",
"output": "2000000000"
},
{
"input": "-1000000000 -1000000000\n0 999999999",
"output": "1999999999"
},
{
"input": "0 0\n2 1",
"output": "2"
},
{
"input": "10 0\n100 0",
"output": "90"
},
{
"input": "1 5\n6 4",
"output": "5"
},
{
"input": "0 0\n5 4",
"output": "5"
},
{
"input": "10 1\n20 1",
"output": "10"
},
{
"input": "1 1\n-3 4",
"output": "4"
},
{
"input": "-863407280 504312726\n786535210 -661703810",
"output": "1649942490"
},
{
"input": "-588306085 -741137832\n341385643 152943311",
"output": "929691728"
},
{
"input": "0 0\n4 0",
"output": "4"
},
{
"input": "93097194 -48405232\n-716984003 -428596062",
"output": "810081197"
},
{
"input": "9 1\n1 1",
"output": "8"
},
{
"input": "4 6\n0 4",
"output": "4"
},
{
"input": "2 4\n5 2",
"output": "3"
},
{
"input": "-100000000 -100000000\n100000000 100000123",
"output": "200000123"
},
{
"input": "5 6\n5 7",
"output": "1"
},
{
"input": "12 16\n12 1",
"output": "15"
},
{
"input": "0 0\n5 1",
"output": "5"
},
{
"input": "0 1\n1 1",
"output": "1"
},
{
"input": "-44602634 913365223\n-572368780 933284951",
"output": "527766146"
},
{
"input": "-2 0\n2 -2",
"output": "4"
},
{
"input": "0 0\n3 1",
"output": "3"
},
{
"input": "-458 2\n1255 4548",
"output": "4546"
},
{
"input": "-5 -4\n-3 -3",
"output": "2"
},
{
"input": "4 5\n7 3",
"output": "3"
},
{
"input": "-1000000000 -999999999\n1000000000 999999998",
"output": "2000000000"
},
{
"input": "-1000000000 -1000000000\n1000000000 -1000000000",
"output": "2000000000"
},
{
"input": "-464122675 -898521847\n656107323 -625340409",
"output": "1120229998"
},
{
"input": "-463154699 -654742385\n-699179052 -789004997",
"output": "236024353"
},
{
"input": "982747270 -593488945\n342286841 -593604186",
"output": "640460429"
},
{
"input": "-80625246 708958515\n468950878 574646184",
"output": "549576124"
},
{
"input": "0 0\n1 0",
"output": "1"
},
{
"input": "109810 1\n2 3",
"output": "109808"
},
{
"input": "-9 0\n9 9",
"output": "18"
},
{
"input": "9 9\n9 9",
"output": "0"
},
{
"input": "1 1\n4 3",
"output": "3"
},
{
"input": "1 2\n45 1",
"output": "44"
},
{
"input": "207558188 -313753260\n-211535387 -721675423",
"output": "419093575"
},
{
"input": "-11 0\n0 0",
"output": "11"
},
{
"input": "-1000000000 1000000000\n1000000000 -1000000000",
"output": "2000000000"
},
{
"input": "0 0\n1 1",
"output": "1"
},
{
"input": "0 0\n0 1",
"output": "1"
},
{
"input": "0 0\n-1 1",
"output": "1"
},
{
"input": "0 0\n-1 0",
"output": "1"
},
{
"input": "0 0\n-1 -1",
"output": "1"
},
{
"input": "0 0\n0 -1",
"output": "1"
},
{
"input": "0 0\n1 -1",
"output": "1"
},
{
"input": "10 90\n90 10",
"output": "80"
},
{
"input": "851016864 573579544\n-761410925 -380746263",
"output": "1612427789"
},
{
"input": "1 9\n9 9",
"output": "8"
},
{
"input": "1000 1000\n1000 1000",
"output": "0"
},
{
"input": "1 9\n9 1",
"output": "8"
},
{
"input": "1 90\n90 90",
"output": "89"
},
{
"input": "100 100\n1000 1000",
"output": "900"
},
{
"input": "-1 0\n0 0",
"output": "1"
},
{
"input": "-750595959 -2984043\n649569876 -749608783",
"output": "1400165835"
},
{
"input": "958048496 712083589\n423286949 810566863",
"output": "534761547"
},
{
"input": "146316710 53945094\n-523054748 147499505",
"output": "669371458"
},
{
"input": "50383856 -596516251\n-802950224 -557916272",
"output": "853334080"
},
{
"input": "-637204864 -280290367\n-119020929 153679771",
"output": "518183935"
},
{
"input": "-100 -100\n-60 -91",
"output": "40"
},
{
"input": "337537326 74909428\n-765558776 167951547",
"output": "1103096102"
},
{
"input": "0 81\n18 90",
"output": "18"
},
{
"input": "283722202 -902633305\n-831696497 -160868946",
"output": "1115418699"
},
{
"input": "1000 1000\n-1000 1000",
"output": "2000"
},
{
"input": "5 6\n4 8",
"output": "2"
},
{
"input": "40572000 597493595\n-935051731 368493185",
"output": "975623731"
},
{
"input": "-5 5\n5 5",
"output": "10"
}
] | 1,657,460,803
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 75
| 78
| 512,000
|
import sys
input = sys.stdin.readline
x1, y1 = map(int, input().split())
x2, y2 = map(int, input().split())
f = abs(x1 - x2)
s = abs(y1 - y2)
print(max(f, s))
|
Title: Professor GukiZ's Robot
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Professor GukiZ makes a new robot. The robot are in the point with coordinates (*x*1,<=*y*1) and should go to the point (*x*2,<=*y*2). In a single step the robot can change any of its coordinates (maybe both of them) by one (decrease or increase). So the robot can move in one of the 8 directions. Find the minimal number of steps the robot should make to get the finish position.
Input Specification:
The first line contains two integers *x*1,<=*y*1 (<=-<=109<=≤<=*x*1,<=*y*1<=≤<=109) — the start position of the robot.
The second line contains two integers *x*2,<=*y*2 (<=-<=109<=≤<=*x*2,<=*y*2<=≤<=109) — the finish position of the robot.
Output Specification:
Print the only integer *d* — the minimal number of steps to get the finish position.
Demo Input:
['0 0\n4 5\n', '3 4\n6 1\n']
Demo Output:
['5\n', '3\n']
Note:
In the first example robot should increase both of its coordinates by one four times, so it will be in position (4, 4). After that robot should simply increase its *y* coordinate and get the finish position.
In the second example robot should simultaneously increase *x* coordinate and decrease *y* coordinate by one three times.
|
```python
import sys
input = sys.stdin.readline
x1, y1 = map(int, input().split())
x2, y2 = map(int, input().split())
f = abs(x1 - x2)
s = abs(y1 - y2)
print(max(f, s))
```
| 3
|
|
78
|
A
|
Haiku
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Haiku
|
2
|
256
|
Haiku is a genre of Japanese traditional poetry.
A haiku poem consists of 17 syllables split into three phrases, containing 5, 7 and 5 syllables correspondingly (the first phrase should contain exactly 5 syllables, the second phrase should contain exactly 7 syllables, and the third phrase should contain exactly 5 syllables). A haiku masterpiece contains a description of a moment in those three phrases. Every word is important in a small poem, which is why haiku are rich with symbols. Each word has a special meaning, a special role. The main principle of haiku is to say much using a few words.
To simplify the matter, in the given problem we will consider that the number of syllable in the phrase is equal to the number of vowel letters there. Only the following letters are regarded as vowel letters: "a", "e", "i", "o" and "u".
Three phases from a certain poem are given. Determine whether it is haiku or not.
|
The input data consists of three lines. The length of each line is between 1 and 100, inclusive. The *i*-th line contains the *i*-th phrase of the poem. Each phrase consists of one or more words, which are separated by one or more spaces. A word is a non-empty sequence of lowercase Latin letters. Leading and/or trailing spaces in phrases are allowed. Every phrase has at least one non-space character. See the example for clarification.
|
Print "YES" (without the quotes) if the poem is a haiku. Otherwise, print "NO" (also without the quotes).
|
[
"on codeforces \nbeta round is running\n a rustling of keys \n",
"how many gallons\nof edo s rain did you drink\n cuckoo\n"
] |
[
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "on codeforces \nbeta round is running\n a rustling of keys ",
"output": "YES"
},
{
"input": "how many gallons\nof edo s rain did you drink\n cuckoo",
"output": "NO"
},
{
"input": " hatsu shigure\n saru mo komino wo\nhoshige nari",
"output": "YES"
},
{
"input": "o vetus stagnum\n rana de ripa salit\n ac sonant aquae",
"output": "NO"
},
{
"input": " furuike ya\nkawazu tobikomu\nmizu no oto ",
"output": "YES"
},
{
"input": " noch da leich\na stamperl zum aufwaerma\n da pfarrer kimmt a ",
"output": "NO"
},
{
"input": " sommerfuglene \n hvorfor bruge mange ord\n et kan gore det",
"output": "YES"
},
{
"input": " ab der mittagszeit\n ist es etwas schattiger\n ein wolkenhimmel",
"output": "NO"
},
{
"input": "tornando a vederli\ni fiori di ciliegio la sera\nson divenuti frutti",
"output": "NO"
},
{
"input": "kutaburete\nyado karu koro ya\nfuji no hana",
"output": "YES"
},
{
"input": " beginnings of poetry\n the rice planting songs \n of the interior",
"output": "NO"
},
{
"input": " door zomerregens\n zijn de kraanvogelpoten\n korter geworden",
"output": "NO"
},
{
"input": " derevo na srub\na ptitsi bezzabotno\n gnezdishko tam vyut",
"output": "YES"
},
{
"input": "writing in the dark\nunaware that my pen\nhas run out of ink",
"output": "NO"
},
{
"input": "kusaaiu\nuieueua\nuo efaa",
"output": "YES"
},
{
"input": "v\nh\np",
"output": "NO"
},
{
"input": "i\ni\nu",
"output": "NO"
},
{
"input": "awmio eoj\nabdoolceegood\nwaadeuoy",
"output": "YES"
},
{
"input": "xzpnhhnqsjpxdboqojixmofawhdjcfbscq\nfoparnxnbzbveycoltwdrfbwwsuobyoz hfbrszy\nimtqryscsahrxpic agfjh wvpmczjjdrnwj mcggxcdo",
"output": "YES"
},
{
"input": "wxjcvccp cppwsjpzbd dhizbcnnllckybrnfyamhgkvkjtxxfzzzuyczmhedhztugpbgpvgh\nmdewztdoycbpxtp bsiw hknggnggykdkrlihvsaykzfiiw\ndewdztnngpsnn lfwfbvnwwmxoojknygqb hfe ibsrxsxr",
"output": "YES"
},
{
"input": "nbmtgyyfuxdvrhuhuhpcfywzrbclp znvxw synxmzymyxcntmhrjriqgdjh xkjckydbzjbvtjurnf\nhhnhxdknvamywhsrkprofnyzlcgtdyzzjdsfxyddvilnzjziz qmwfdvzckgcbrrxplxnxf mpxwxyrpesnewjrx ajxlfj\nvcczq hddzd cvefmhxwxxyqcwkr fdsndckmesqeq zyjbwbnbyhybd cta nsxzidl jpcvtzkldwd",
"output": "YES"
},
{
"input": "rvwdsgdsrutgjwscxz pkd qtpmfbqsmctuevxdj kjzknzghdvxzlaljcntg jxhvzn yciktbsbyscfypx x xhkxnfpdp\nwdfhvqgxbcts mnrwbr iqttsvigwdgvlxwhsmnyxnttedonxcfrtmdjjmacvqtkbmsnwwvvrlxwvtggeowtgsqld qj\nvsxcdhbzktrxbywpdvstr meykarwtkbm pkkbhvwvelclfmpngzxdmblhcvf qmabmweldplmczgbqgzbqnhvcdpnpjtch ",
"output": "YES"
},
{
"input": "brydyfsmtzzkpdsqvvztmprhqzbzqvgsblnz naait tdtiprjsttwusdykndwcccxfmzmrmfmzjywkpgbfnjpypgcbcfpsyfj k\nucwdfkfyxxxht lxvnovqnnsqutjsyagrplb jhvtwdptrwcqrovncdvqljjlrpxcfbxqgsfylbgmcjpvpl ccbcybmigpmjrxpu\nfgwtpcjeywgnxgbttgx htntpbk tkkpwbgxwtbxvcpkqbzetjdkcwad tftnjdxxjdvbpfibvxuglvx llyhgjvggtw jtjyphs",
"output": "YES"
},
{
"input": "nyc aqgqzjjlj mswgmjfcxlqdscheskchlzljlsbhyn iobxymwzykrsnljj\nnnebeaoiraga\nqpjximoqzswhyyszhzzrhfwhf iyxysdtcpmikkwpugwlxlhqfkn",
"output": "NO"
},
{
"input": "lzrkztgfe mlcnq ay ydmdzxh cdgcghxnkdgmgfzgahdjjmqkpdbskreswpnblnrc fmkwziiqrbskp\np oukeaz gvvy kghtrjlczyl qeqhgfgfej\nwfolhkmktvsjnrpzfxcxzqmfidtlzmuhxac wsncjgmkckrywvxmnjdpjpfydhk qlmdwphcvyngansqhl",
"output": "NO"
},
{
"input": "yxcboqmpwoevrdhvpxfzqmammak\njmhphkxppkqkszhqqtkvflarsxzla pbxlnnnafqbsnmznfj qmhoktgzix qpmrgzxqvmjxhskkksrtryehfnmrt dtzcvnvwp\nscwymuecjxhw rdgsffqywwhjpjbfcvcrnisfqllnbplpadfklayjguyvtrzhwblftclfmsr",
"output": "NO"
},
{
"input": "qfdwsr jsbrpfmn znplcx nhlselflytndzmgxqpgwhpi ghvbbxrkjdirfghcybhkkqdzmyacvrrcgsneyjlgzfvdmxyjmph\nylxlyrzs drbktzsniwcbahjkgohcghoaczsmtzhuwdryjwdijmxkmbmxv yyfrokdnsx\nyw xtwyzqlfxwxghugoyscqlx pljtz aldfskvxlsxqgbihzndhxkswkxqpwnfcxzfyvncstfpqf",
"output": "NO"
},
{
"input": "g rguhqhcrzmuqthtmwzhfyhpmqzzosa\nmhjimzvchkhejh irvzejhtjgaujkqfxhpdqjnxr dvqallgssktqvsxi\npcwbliftjcvuzrsqiswohi",
"output": "NO"
},
{
"input": " ngxtlq iehiise vgffqcpnmsoqzyseuqqtggokymol zn\nvjdjljazeujwoubkcvtsbepooxqzrueaauokhepiquuopfild\ngoabauauaeotoieufueeknudiilupouaiaexcoapapu",
"output": "NO"
},
{
"input": "ycnvnnqk mhrmhctpkfbc qbyvtjznmndqjzgbcxmvrpkfcll zwspfptmbxgrdv dsgkk nfytsqjrnfbhh pzdldzymvkdxxwh\nvnhjfwgdnyjptsmblyxmpzylsbjlmtkkwjcbqwjctqvrlqqkdsrktxlnslspvnn mdgsmzblhbnvpczmqkcffwhwljqkzmk hxcm\nrghnjvzcpprrgmtgytpkzyc mrdnnhpkwypwqbtzjyfwvrdwyjltbzxtbstzs xdjzdmx yjsqtzlrnvyssvglsdjrmsrfrcdpqt",
"output": "NO"
},
{
"input": "ioeeaioeiuoeaeieuuieooaouiuouiioaueeaiaiuoaoiioeeaauooiuuieeuaeeoauieeaiuoieiaieuoauaaoioooieueueuai\nuooaoeeaoiuuoeioaoouaououoeioiaeueoioaiouaeaoioiuuaueeuaiuoiueoiuaoeeieeouaeeaeeieioeoiiieuuueuuieuo\naeeouieeieoueaioeoioooiouaeeeiaaioueauaueiouuuaieuuioiaeiueauueaoieauauoeueuaiueuuaueeoueauaeaoieeoo",
"output": "NO"
},
{
"input": "mkgycgmrqtmlwj vddlbsgdptyfrcj nmrddjchydvbsyhgzytfzvwbhqmmhkpsyrcnknpsqrr wcnf wfvgskrnsmnrcqgcnc q\npn cclcyjjdp rqkpgyrvyyd hhynrochfa pthyffqvskazfshvzcmvhmsrxvquzkdvivlbfypwbgltfbjmhzljvgzmxjlrjdjq\nauuouieuaaauoooeoiuoaueuueauiuuuiaeuwuoiaeoeaieauieouoaeiiieiioiuuuiuauioiiuoeauueieaueiaioeuaoaaau",
"output": "NO"
},
{
"input": "ab\na\na",
"output": "NO"
},
{
"input": "on codeforcs\nbeta round is runnineg\na rustling of keys",
"output": "NO"
},
{
"input": "coooooooooooooooood\nd\nd",
"output": "NO"
},
{
"input": "on codeforces \nbeta round is runninog\n a rustling of keys",
"output": "NO"
},
{
"input": "aaaaaaaaaaaaaaa\na\na",
"output": "NO"
},
{
"input": "aaaaaccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc\naaaaaaaccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc\naaaaaccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc",
"output": "YES"
},
{
"input": "cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc\ncccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc\ncccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc",
"output": "NO"
},
{
"input": "aaaaaa\naaaaaa\naaaaa",
"output": "NO"
}
] | 1,601,525,028
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 218
| 307,200
|
def ishaiku(s1,s2,s3):
cnt_s1=0
cnt_s2=0
cnt_s3=0
for i in s1:
if(i=='a' or i=='e' or i=='i' or i=='o' or i=='u'):
cnt_s1+=1
for i in s2:
if(i=='a' or i=='e' or i=='i' or i=='o' or i=='u'):
cnt_s2+=1
for i in s3:
if(i=='a' or i=='e' or i=='i' or i=='o' or i=='u'):
cnt_s3+=1
if(cnt_s1==5 and cnt_s2==7 and cnt_s3==5):
return True
return False
def main():
s1=str(input()).replace(" ","")
s2=str(input()).replace(" ","")
s3=str(input()).replace(" ","")
if(ishaiku(s1,s2,s3)):
print("YES")
else:
print("NO")
if __name__=='__main__':
main()
|
Title: Haiku
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Haiku is a genre of Japanese traditional poetry.
A haiku poem consists of 17 syllables split into three phrases, containing 5, 7 and 5 syllables correspondingly (the first phrase should contain exactly 5 syllables, the second phrase should contain exactly 7 syllables, and the third phrase should contain exactly 5 syllables). A haiku masterpiece contains a description of a moment in those three phrases. Every word is important in a small poem, which is why haiku are rich with symbols. Each word has a special meaning, a special role. The main principle of haiku is to say much using a few words.
To simplify the matter, in the given problem we will consider that the number of syllable in the phrase is equal to the number of vowel letters there. Only the following letters are regarded as vowel letters: "a", "e", "i", "o" and "u".
Three phases from a certain poem are given. Determine whether it is haiku or not.
Input Specification:
The input data consists of three lines. The length of each line is between 1 and 100, inclusive. The *i*-th line contains the *i*-th phrase of the poem. Each phrase consists of one or more words, which are separated by one or more spaces. A word is a non-empty sequence of lowercase Latin letters. Leading and/or trailing spaces in phrases are allowed. Every phrase has at least one non-space character. See the example for clarification.
Output Specification:
Print "YES" (without the quotes) if the poem is a haiku. Otherwise, print "NO" (also without the quotes).
Demo Input:
['on codeforces \nbeta round is running\n a rustling of keys \n', 'how many gallons\nof edo s rain did you drink\n cuckoo\n']
Demo Output:
['YES', 'NO']
Note:
none
|
```python
def ishaiku(s1,s2,s3):
cnt_s1=0
cnt_s2=0
cnt_s3=0
for i in s1:
if(i=='a' or i=='e' or i=='i' or i=='o' or i=='u'):
cnt_s1+=1
for i in s2:
if(i=='a' or i=='e' or i=='i' or i=='o' or i=='u'):
cnt_s2+=1
for i in s3:
if(i=='a' or i=='e' or i=='i' or i=='o' or i=='u'):
cnt_s3+=1
if(cnt_s1==5 and cnt_s2==7 and cnt_s3==5):
return True
return False
def main():
s1=str(input()).replace(" ","")
s2=str(input()).replace(" ","")
s3=str(input()).replace(" ","")
if(ishaiku(s1,s2,s3)):
print("YES")
else:
print("NO")
if __name__=='__main__':
main()
```
| 3.944928
|
735
|
A
|
Ostap and Grasshopper
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
On the way to Rio de Janeiro Ostap kills time playing with a grasshopper he took with him in a special box. Ostap builds a line of length *n* such that some cells of this line are empty and some contain obstacles. Then, he places his grasshopper to one of the empty cells and a small insect in another empty cell. The grasshopper wants to eat the insect.
Ostap knows that grasshopper is able to jump to any empty cell that is exactly *k* cells away from the current (to the left or to the right). Note that it doesn't matter whether intermediate cells are empty or not as the grasshopper makes a jump over them. For example, if *k*<==<=1 the grasshopper can jump to a neighboring cell only, and if *k*<==<=2 the grasshopper can jump over a single cell.
Your goal is to determine whether there is a sequence of jumps such that grasshopper will get from his initial position to the cell with an insect.
|
The first line of the input contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=*n*<=-<=1) — the number of cells in the line and the length of one grasshopper's jump.
The second line contains a string of length *n* consisting of characters '.', '#', 'G' and 'T'. Character '.' means that the corresponding cell is empty, character '#' means that the corresponding cell contains an obstacle and grasshopper can't jump there. Character 'G' means that the grasshopper starts at this position and, finally, 'T' means that the target insect is located at this cell. It's guaranteed that characters 'G' and 'T' appear in this line exactly once.
|
If there exists a sequence of jumps (each jump of length *k*), such that the grasshopper can get from his initial position to the cell with the insect, print "YES" (without quotes) in the only line of the input. Otherwise, print "NO" (without quotes).
|
[
"5 2\n#G#T#\n",
"6 1\nT....G\n",
"7 3\nT..#..G\n",
"6 2\n..GT..\n"
] |
[
"YES\n",
"YES\n",
"NO\n",
"NO\n"
] |
In the first sample, the grasshopper can make one jump to the right in order to get from cell 2 to cell 4.
In the second sample, the grasshopper is only able to jump to neighboring cells but the way to the insect is free — he can get there by jumping left 5 times.
In the third sample, the grasshopper can't make a single jump.
In the fourth sample, the grasshopper can only jump to the cells with odd indices, thus he won't be able to reach the insect.
| 500
|
[
{
"input": "5 2\n#G#T#",
"output": "YES"
},
{
"input": "6 1\nT....G",
"output": "YES"
},
{
"input": "7 3\nT..#..G",
"output": "NO"
},
{
"input": "6 2\n..GT..",
"output": "NO"
},
{
"input": "2 1\nGT",
"output": "YES"
},
{
"input": "100 5\nG####.####.####.####.####.####.####.####.####.####.####.####.####.####.####.####.####.####.####T####",
"output": "YES"
},
{
"input": "100 5\nG####.####.####.####.####.####.####.####.####.####.####.####.####.#########.####.####.####.####T####",
"output": "NO"
},
{
"input": "2 1\nTG",
"output": "YES"
},
{
"input": "99 1\n...T.............................................................................................G.",
"output": "YES"
},
{
"input": "100 2\nG............#.....#...........#....#...........##............#............#......................T.",
"output": "NO"
},
{
"input": "100 1\n#.#.#.##..#..##.#....##.##.##.#....####..##.#.##..GT..##...###.#.##.#..#..##.###..#.####..#.#.##..##",
"output": "YES"
},
{
"input": "100 2\n..#####.#.#.......#.#.#...##..####..###..#.#######GT####.#.#...##...##.#..###....##.#.#..#.###....#.",
"output": "NO"
},
{
"input": "100 3\nG..................................................................................................T",
"output": "YES"
},
{
"input": "100 3\nG..................................................................................................T",
"output": "YES"
},
{
"input": "100 3\nG..................................#......#......#.......#.#..........#........#......#..........#.T",
"output": "NO"
},
{
"input": "100 3\nG..............#..........#...#..............#.#.....................#......#........#.........#...T",
"output": "NO"
},
{
"input": "100 3\nG##################################################################################################T",
"output": "NO"
},
{
"input": "100 33\nG..................................................................................................T",
"output": "YES"
},
{
"input": "100 33\nG..................................................................................................T",
"output": "YES"
},
{
"input": "100 33\nG.........#........#..........#..............#.................#............................#.#....T",
"output": "YES"
},
{
"input": "100 33\nG.......#..................#..............................#............................#..........T.",
"output": "NO"
},
{
"input": "100 33\nG#..........##...#.#.....................#.#.#.........##..#...........#....#...........##...#..###T",
"output": "YES"
},
{
"input": "100 33\nG..#.#..#..####......#......##...##...#.##........#...#...#.##....###..#...###..##.#.....#......#.T.",
"output": "NO"
},
{
"input": "100 33\nG#....#..#..##.##..#.##.#......#.#.##..##.#.#.##.##....#.#.....####..##...#....##..##..........#...T",
"output": "NO"
},
{
"input": "100 33\nG#######.#..##.##.#...#..#.###.#.##.##.#..#.###..####.##.#.##....####...##..####.#..##.##.##.#....#T",
"output": "NO"
},
{
"input": "100 33\nG#####.#.##.###########.##..##..#######..########..###.###..#.####.######.############..####..#####T",
"output": "NO"
},
{
"input": "100 99\nT..................................................................................................G",
"output": "YES"
},
{
"input": "100 99\nT..................................................................................................G",
"output": "YES"
},
{
"input": "100 99\nT.#...............................#............#..............................##...................G",
"output": "YES"
},
{
"input": "100 99\nT..#....#.##...##########.#.#.#.#...####..#.....#..##..#######.######..#.....###..###...#.......#.#G",
"output": "YES"
},
{
"input": "100 99\nG##################################################################################################T",
"output": "YES"
},
{
"input": "100 9\nT..................................................................................................G",
"output": "YES"
},
{
"input": "100 9\nT.................................................................................................G.",
"output": "NO"
},
{
"input": "100 9\nT................................................................................................G..",
"output": "NO"
},
{
"input": "100 1\nG..................................................................................................T",
"output": "YES"
},
{
"input": "100 1\nT..................................................................................................G",
"output": "YES"
},
{
"input": "100 1\n##########G.........T###############################################################################",
"output": "YES"
},
{
"input": "100 1\n#################################################################################################G.T",
"output": "YES"
},
{
"input": "100 17\n##########G################.################.################.################T#####################",
"output": "YES"
},
{
"input": "100 17\n####.#..#.G######.#########.##..##########.#.################.################T######.####.#########",
"output": "YES"
},
{
"input": "100 17\n.########.G##.####.#.######.###############..#.###########.##.#####.##.#####.#T.###..###.########.##",
"output": "YES"
},
{
"input": "100 1\nG.............................................#....................................................T",
"output": "NO"
},
{
"input": "100 1\nT.#................................................................................................G",
"output": "NO"
},
{
"input": "100 1\n##########G....#....T###############################################################################",
"output": "NO"
},
{
"input": "100 1\n#################################################################################################G#T",
"output": "NO"
},
{
"input": "100 17\nG################.#################################.################T###############################",
"output": "NO"
},
{
"input": "100 17\nG################.###############..###.######.#######.###.#######.##T######################.###.####",
"output": "NO"
},
{
"input": "100 17\nG####.##.##.#####.####....##.####.#########.##.#..#.###############.T############.#########.#.####.#",
"output": "NO"
},
{
"input": "48 1\nT..............................................G",
"output": "YES"
},
{
"input": "23 1\nT.....................G",
"output": "YES"
},
{
"input": "49 1\nG...............................................T",
"output": "YES"
},
{
"input": "3 1\nTG#",
"output": "YES"
},
{
"input": "6 2\n..TG..",
"output": "NO"
},
{
"input": "14 3\n...G.....#..T.",
"output": "NO"
},
{
"input": "5 4\n##GT#",
"output": "NO"
},
{
"input": "6 2\nT#..G.",
"output": "YES"
},
{
"input": "5 2\nT.G.#",
"output": "YES"
},
{
"input": "6 1\nT...G#",
"output": "YES"
},
{
"input": "5 1\nTG###",
"output": "YES"
},
{
"input": "5 4\n.G..T",
"output": "NO"
},
{
"input": "7 2\nT#...#G",
"output": "YES"
},
{
"input": "7 1\n##TG###",
"output": "YES"
},
{
"input": "7 1\n###GT##",
"output": "YES"
},
{
"input": "5 2\nG..T.",
"output": "NO"
},
{
"input": "5 1\nG.T##",
"output": "YES"
},
{
"input": "6 2\nG.T###",
"output": "YES"
},
{
"input": "6 2\nG#T###",
"output": "YES"
},
{
"input": "10 2\n####T..G..",
"output": "NO"
},
{
"input": "3 1\nGT#",
"output": "YES"
},
{
"input": "4 1\nTG##",
"output": "YES"
},
{
"input": "6 1\n.G..T.",
"output": "YES"
},
{
"input": "10 3\n......G..T",
"output": "YES"
},
{
"input": "3 2\nG.T",
"output": "YES"
},
{
"input": "4 1\n#G.T",
"output": "YES"
},
{
"input": "5 2\nT#G##",
"output": "YES"
},
{
"input": "4 2\nG#.T",
"output": "NO"
},
{
"input": "4 1\nGT##",
"output": "YES"
}
] | 1,531,763,391
| 291
|
Python 3
|
OK
|
TESTS
| 83
| 109
| 0
|
n, k = map(int, input().split())
s = input()
g, t = s.index('G'), s.index('T')
if (abs(g - t)) % k == 0:
for i in range(min(g, t), max(g, t), k):
if s[i] == '#':
print('NO')
exit()
print('YES')
else:
print('NO')
|
Title: Ostap and Grasshopper
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
On the way to Rio de Janeiro Ostap kills time playing with a grasshopper he took with him in a special box. Ostap builds a line of length *n* such that some cells of this line are empty and some contain obstacles. Then, he places his grasshopper to one of the empty cells and a small insect in another empty cell. The grasshopper wants to eat the insect.
Ostap knows that grasshopper is able to jump to any empty cell that is exactly *k* cells away from the current (to the left or to the right). Note that it doesn't matter whether intermediate cells are empty or not as the grasshopper makes a jump over them. For example, if *k*<==<=1 the grasshopper can jump to a neighboring cell only, and if *k*<==<=2 the grasshopper can jump over a single cell.
Your goal is to determine whether there is a sequence of jumps such that grasshopper will get from his initial position to the cell with an insect.
Input Specification:
The first line of the input contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=*n*<=-<=1) — the number of cells in the line and the length of one grasshopper's jump.
The second line contains a string of length *n* consisting of characters '.', '#', 'G' and 'T'. Character '.' means that the corresponding cell is empty, character '#' means that the corresponding cell contains an obstacle and grasshopper can't jump there. Character 'G' means that the grasshopper starts at this position and, finally, 'T' means that the target insect is located at this cell. It's guaranteed that characters 'G' and 'T' appear in this line exactly once.
Output Specification:
If there exists a sequence of jumps (each jump of length *k*), such that the grasshopper can get from his initial position to the cell with the insect, print "YES" (without quotes) in the only line of the input. Otherwise, print "NO" (without quotes).
Demo Input:
['5 2\n#G#T#\n', '6 1\nT....G\n', '7 3\nT..#..G\n', '6 2\n..GT..\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n', 'NO\n']
Note:
In the first sample, the grasshopper can make one jump to the right in order to get from cell 2 to cell 4.
In the second sample, the grasshopper is only able to jump to neighboring cells but the way to the insect is free — he can get there by jumping left 5 times.
In the third sample, the grasshopper can't make a single jump.
In the fourth sample, the grasshopper can only jump to the cells with odd indices, thus he won't be able to reach the insect.
|
```python
n, k = map(int, input().split())
s = input()
g, t = s.index('G'), s.index('T')
if (abs(g - t)) % k == 0:
for i in range(min(g, t), max(g, t), k):
if s[i] == '#':
print('NO')
exit()
print('YES')
else:
print('NO')
```
| 3
|
|
509
|
A
|
Maximum in Table
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
|
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
|
Print a single line containing a positive integer *m* — the maximum value in the table.
|
[
"1\n",
"5\n"
] |
[
"1",
"70"
] |
In the second test the rows of the table look as follows:
| 0
|
[
{
"input": "1",
"output": "1"
},
{
"input": "5",
"output": "70"
},
{
"input": "2",
"output": "2"
},
{
"input": "3",
"output": "6"
},
{
"input": "4",
"output": "20"
},
{
"input": "6",
"output": "252"
},
{
"input": "7",
"output": "924"
},
{
"input": "9",
"output": "12870"
},
{
"input": "10",
"output": "48620"
},
{
"input": "8",
"output": "3432"
}
] | 1,649,005,540
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 10
| 31
| 0
|
a=int(input())
b=[0, 1, 2, 6, 20, 70, 252, 924, 3432, 12870, 48620]
print(b[a])
|
Title: Maximum in Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
Input Specification:
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
Output Specification:
Print a single line containing a positive integer *m* — the maximum value in the table.
Demo Input:
['1\n', '5\n']
Demo Output:
['1', '70']
Note:
In the second test the rows of the table look as follows:
|
```python
a=int(input())
b=[0, 1, 2, 6, 20, 70, 252, 924, 3432, 12870, 48620]
print(b[a])
```
| 3
|
|
127
|
A
|
Wasted Time
|
PROGRAMMING
| 900
|
[
"geometry"
] | null | null |
Mr. Scrooge, a very busy man, decided to count the time he wastes on all sorts of useless stuff to evaluate the lost profit. He has already counted the time he wastes sleeping and eating. And now Mr. Scrooge wants to count the time he has wasted signing papers.
Mr. Scrooge's signature can be represented as a polyline *A*1*A*2... *A**n*. Scrooge signs like that: first it places a pen at the point *A*1, then draws a segment from point *A*1 to point *A*2, then he draws a segment from point *A*2 to point *A*3 and so on to point *A**n*, where he stops signing and takes the pen off the paper. At that the resulting line can intersect with itself and partially repeat itself but Scrooge pays no attention to it and never changes his signing style. As Scrooge makes the signature, he never takes the pen off the paper and his writing speed is constant — 50 millimeters per second.
Scrooge signed exactly *k* papers throughout his life and all those signatures look the same.
Find the total time Scrooge wasted signing the papers.
|
The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000). Each of the following *n* lines contains the coordinates of the polyline's endpoints. The *i*-th one contains coordinates of the point *A**i* — integers *x**i* and *y**i*, separated by a space.
All points *A**i* are different. The absolute value of all coordinates does not exceed 20. The coordinates are measured in millimeters.
|
Print one real number — the total time Scrooges wastes on signing the papers in seconds. The absolute or relative error should not exceed 10<=-<=6.
|
[
"2 1\n0 0\n10 0\n",
"5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0\n",
"6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0\n"
] |
[
"0.200000000",
"6.032163204",
"3.000000000"
] |
none
| 500
|
[
{
"input": "2 1\n0 0\n10 0",
"output": "0.200000000"
},
{
"input": "5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0",
"output": "6.032163204"
},
{
"input": "6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0",
"output": "3.000000000"
},
{
"input": "10 95\n-20 -5\n2 -8\n14 13\n10 3\n17 11\n13 -12\n-6 11\n14 -15\n-13 14\n19 8",
"output": "429.309294877"
},
{
"input": "30 1000\n4 -13\n14 13\n-14 -16\n-9 18\n17 11\n2 -8\n2 15\n8 -1\n-9 13\n8 -12\n-2 20\n11 -12\n19 8\n9 -15\n-20 -5\n-18 20\n-13 14\n-12 -17\n-4 3\n13 -12\n11 -10\n18 7\n-6 11\n10 13\n10 3\n6 -14\n-1 10\n14 -15\n2 11\n-8 10",
"output": "13629.282573522"
},
{
"input": "2 1\n-20 -10\n-10 -6",
"output": "0.215406592"
},
{
"input": "2 13\n13 -10\n-3 -2",
"output": "4.651021393"
},
{
"input": "2 21\n13 8\n14 10",
"output": "0.939148551"
},
{
"input": "2 75\n-3 12\n1 12",
"output": "6.000000000"
},
{
"input": "2 466\n10 16\n-6 -3",
"output": "231.503997374"
},
{
"input": "2 999\n6 16\n-17 -14",
"output": "755.286284531"
},
{
"input": "2 1000\n-17 -14\n-14 -8",
"output": "134.164078650"
},
{
"input": "3 384\n-4 -19\n-17 -2\n3 4",
"output": "324.722285390"
},
{
"input": "5 566\n-11 8\n2 -7\n7 0\n-7 -9\n-7 5",
"output": "668.956254495"
},
{
"input": "7 495\n-10 -13\n-9 -5\n4 9\n8 13\n-4 2\n2 10\n-18 15",
"output": "789.212495576"
},
{
"input": "10 958\n7 13\n20 19\n12 -7\n10 -10\n-13 -15\n-10 -7\n20 -5\n-11 19\n-7 3\n-4 18",
"output": "3415.618464093"
},
{
"input": "13 445\n-15 16\n-8 -14\n8 7\n4 15\n8 -13\n15 -11\n-12 -4\n2 -13\n-5 0\n-20 -14\n-8 -7\n-10 -18\n18 -5",
"output": "2113.552527680"
},
{
"input": "18 388\n11 -8\n13 10\n18 -17\n-15 3\n-13 -15\n20 -7\n1 -10\n-13 -12\n-12 -15\n-17 -8\n1 -2\n3 -20\n-8 -9\n15 -13\n-19 -6\n17 3\n-17 2\n6 6",
"output": "2999.497312668"
},
{
"input": "25 258\n-5 -3\n-18 -14\n12 3\n6 11\n4 2\n-19 -3\n19 -7\n-15 19\n-19 -12\n-11 -10\n-5 17\n10 15\n-4 1\n-3 -20\n6 16\n18 -19\n11 -19\n-17 10\n-17 17\n-2 -17\n-3 -9\n18 13\n14 8\n-2 -5\n-11 4",
"output": "2797.756635934"
},
{
"input": "29 848\n11 -10\n-19 1\n18 18\n19 -19\n0 -5\n16 10\n-20 -14\n7 15\n6 8\n-15 -16\n9 3\n16 -20\n-12 12\n18 -1\n-11 14\n18 10\n11 -20\n-20 -16\n-1 11\n13 10\n-6 13\n-7 -10\n-11 -10\n-10 3\n15 -13\n-4 11\n-13 -11\n-11 -17\n11 -5",
"output": "12766.080247922"
},
{
"input": "36 3\n-11 20\n-11 13\n-17 9\n15 9\n-6 9\n-1 11\n12 -11\n16 -10\n-20 7\n-18 6\n-15 -2\n20 -20\n16 4\n-20 -8\n-12 -15\n-13 -6\n-9 -4\n0 -10\n8 -1\n1 4\n5 8\n8 -15\n16 -12\n19 1\n0 -4\n13 -4\n17 -13\n-7 11\n14 9\n-14 -9\n5 -8\n11 -8\n-17 -5\n1 -3\n-16 -17\n2 -3",
"output": "36.467924851"
},
{
"input": "48 447\n14 9\n9 -17\n-17 11\n-14 14\n19 -8\n-14 -17\n-7 10\n-6 -11\n-9 -19\n19 10\n-4 2\n-5 16\n20 9\n-10 20\n-7 -17\n14 -16\n-2 -10\n-18 -17\n14 12\n-6 -19\n5 -18\n-3 2\n-3 10\n-5 5\n13 -12\n10 -18\n10 -12\n-2 4\n7 -15\n-5 -5\n11 14\n11 10\n-6 -9\n13 -4\n13 9\n6 12\n-13 17\n-9 -12\n14 -19\n10 12\n-15 8\n-1 -11\n19 8\n11 20\n-9 -3\n16 1\n-14 19\n8 -4",
"output": "9495.010556306"
},
{
"input": "50 284\n-17 -13\n7 12\n-13 0\n13 1\n14 6\n14 -9\n-5 -1\n0 -10\n12 -3\n-14 6\n-8 10\n-16 17\n0 -1\n4 -9\n2 6\n1 8\n-8 -14\n3 9\n1 -15\n-4 -19\n-7 -20\n18 10\n3 -11\n10 16\n2 -6\n-9 19\n-3 -1\n20 9\n-12 -5\n-10 -2\n16 -7\n-16 -18\n-2 17\n2 8\n7 -15\n4 1\n6 -17\n19 9\n-10 -20\n5 2\n10 -2\n3 7\n20 0\n8 -14\n-16 -1\n-20 7\n20 -19\n17 18\n-11 -18\n-16 14",
"output": "6087.366930474"
},
{
"input": "57 373\n18 3\n-4 -1\n18 5\n-7 -15\n-6 -10\n-19 1\n20 15\n15 4\n-1 -2\n13 -14\n0 12\n10 3\n-16 -17\n-14 -9\n-11 -10\n17 19\n-2 6\n-12 -15\n10 20\n16 7\n9 -1\n4 13\n8 -2\n-1 -16\n-3 8\n14 11\n-12 3\n-5 -6\n3 4\n5 7\n-9 9\n11 4\n-19 10\n-7 4\n-20 -12\n10 16\n13 11\n13 -11\n7 -1\n17 18\n-19 7\n14 13\n5 -1\n-7 6\n-1 -6\n6 20\n-16 2\n4 17\n16 -11\n-4 -20\n19 -18\n17 16\n-14 -8\n3 2\n-6 -16\n10 -10\n-13 -11",
"output": "8929.162822862"
},
{
"input": "60 662\n15 17\n-2 -19\n-4 -17\n10 0\n15 10\n-8 -14\n14 9\n-15 20\n6 5\n-9 0\n-13 20\n13 -2\n10 9\n7 5\n4 18\n-10 1\n6 -15\n15 -16\n6 13\n4 -6\n2 5\n18 19\n8 3\n-7 14\n-12 -20\n14 19\n-15 0\n-2 -12\n9 18\n14 4\n2 -20\n3 0\n20 9\n-5 11\n-11 1\n2 -19\n-14 -4\n18 6\n16 16\n15 3\n-1 -5\n9 20\n12 -8\n-1 10\n-4 -9\n3 6\n3 -12\n14 -10\n-8 10\n-18 6\n14 -2\n-14 -12\n-10 -7\n10 -6\n14 1\n6 14\n15 19\n4 14\n3 -14\n-9 -13",
"output": "16314.207721932"
},
{
"input": "61 764\n-9 15\n11 -8\n-6 -7\n-13 -19\n16 -16\n-5 -1\n20 -19\n-14 -1\n-11 4\n7 -2\n-3 2\n-14 -17\n15 18\n20 15\n-13 -2\n15 8\n3 13\n19 -10\n2 -6\n15 -3\n-12 11\n4 -16\n-14 20\n0 2\n11 -7\n-6 -11\n16 7\n8 -3\n16 -10\n-3 9\n9 5\n4 -1\n-17 9\n14 -4\n8 6\n-19 12\n10 -17\n-5 7\n7 -3\n5 3\n6 -14\n9 9\n-16 -19\n11 -16\n-17 15\n8 5\n16 -19\n-7 10\n14 -15\n15 19\n-20 -16\n6 -2\n-4 6\n7 -15\n1 -8\n20 -17\n3 7\n10 12\n10 -11\n-19 10\n0 -11",
"output": "22153.369189802"
}
] | 1,607,237,715
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 248
| 0
|
import math
n, k = map(int, input().split())
x, y = map(int, input().split())
length = 0
for i in range(n-1):
c, d = map(int, input().split())
length+=(math.sqrt((c-x)**2+(d-y)**2))
x = c
y = d
print((length/50)*k)
|
Title: Wasted Time
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mr. Scrooge, a very busy man, decided to count the time he wastes on all sorts of useless stuff to evaluate the lost profit. He has already counted the time he wastes sleeping and eating. And now Mr. Scrooge wants to count the time he has wasted signing papers.
Mr. Scrooge's signature can be represented as a polyline *A*1*A*2... *A**n*. Scrooge signs like that: first it places a pen at the point *A*1, then draws a segment from point *A*1 to point *A*2, then he draws a segment from point *A*2 to point *A*3 and so on to point *A**n*, where he stops signing and takes the pen off the paper. At that the resulting line can intersect with itself and partially repeat itself but Scrooge pays no attention to it and never changes his signing style. As Scrooge makes the signature, he never takes the pen off the paper and his writing speed is constant — 50 millimeters per second.
Scrooge signed exactly *k* papers throughout his life and all those signatures look the same.
Find the total time Scrooge wasted signing the papers.
Input Specification:
The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000). Each of the following *n* lines contains the coordinates of the polyline's endpoints. The *i*-th one contains coordinates of the point *A**i* — integers *x**i* and *y**i*, separated by a space.
All points *A**i* are different. The absolute value of all coordinates does not exceed 20. The coordinates are measured in millimeters.
Output Specification:
Print one real number — the total time Scrooges wastes on signing the papers in seconds. The absolute or relative error should not exceed 10<=-<=6.
Demo Input:
['2 1\n0 0\n10 0\n', '5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0\n', '6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0\n']
Demo Output:
['0.200000000', '6.032163204', '3.000000000']
Note:
none
|
```python
import math
n, k = map(int, input().split())
x, y = map(int, input().split())
length = 0
for i in range(n-1):
c, d = map(int, input().split())
length+=(math.sqrt((c-x)**2+(d-y)**2))
x = c
y = d
print((length/50)*k)
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
For a given positive integer *n* denote its *k*-rounding as the minimum positive integer *x*, such that *x* ends with *k* or more zeros in base 10 and is divisible by *n*.
For example, 4-rounding of 375 is 375·80<==<=30000. 30000 is the minimum integer such that it ends with 4 or more zeros and is divisible by 375.
Write a program that will perform the *k*-rounding of *n*.
|
The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=109, 0<=≤<=*k*<=≤<=8).
|
Print the *k*-rounding of *n*.
|
[
"375 4\n",
"10000 1\n",
"38101 0\n",
"123456789 8\n"
] |
[
"30000\n",
"10000\n",
"38101\n",
"12345678900000000\n"
] |
none
| 0
|
[
{
"input": "375 4",
"output": "30000"
},
{
"input": "10000 1",
"output": "10000"
},
{
"input": "38101 0",
"output": "38101"
},
{
"input": "123456789 8",
"output": "12345678900000000"
},
{
"input": "1 0",
"output": "1"
},
{
"input": "2 0",
"output": "2"
},
{
"input": "100 0",
"output": "100"
},
{
"input": "1000000000 0",
"output": "1000000000"
},
{
"input": "160 2",
"output": "800"
},
{
"input": "3 0",
"output": "3"
},
{
"input": "10 0",
"output": "10"
},
{
"input": "1 1",
"output": "10"
},
{
"input": "2 1",
"output": "10"
},
{
"input": "3 1",
"output": "30"
},
{
"input": "4 1",
"output": "20"
},
{
"input": "5 1",
"output": "10"
},
{
"input": "6 1",
"output": "30"
},
{
"input": "7 1",
"output": "70"
},
{
"input": "8 1",
"output": "40"
},
{
"input": "9 1",
"output": "90"
},
{
"input": "10 1",
"output": "10"
},
{
"input": "11 1",
"output": "110"
},
{
"input": "12 1",
"output": "60"
},
{
"input": "16 2",
"output": "400"
},
{
"input": "2 2",
"output": "100"
},
{
"input": "1 2",
"output": "100"
},
{
"input": "5 2",
"output": "100"
},
{
"input": "15 2",
"output": "300"
},
{
"input": "36 2",
"output": "900"
},
{
"input": "1 8",
"output": "100000000"
},
{
"input": "8 8",
"output": "100000000"
},
{
"input": "96 8",
"output": "300000000"
},
{
"input": "175 8",
"output": "700000000"
},
{
"input": "9999995 8",
"output": "199999900000000"
},
{
"input": "999999999 8",
"output": "99999999900000000"
},
{
"input": "12345678 8",
"output": "617283900000000"
},
{
"input": "78125 8",
"output": "100000000"
},
{
"input": "390625 8",
"output": "100000000"
},
{
"input": "1953125 8",
"output": "500000000"
},
{
"input": "9765625 8",
"output": "2500000000"
},
{
"input": "68359375 8",
"output": "17500000000"
},
{
"input": "268435456 8",
"output": "104857600000000"
},
{
"input": "125829120 8",
"output": "9830400000000"
},
{
"input": "128000 8",
"output": "400000000"
},
{
"input": "300000 8",
"output": "300000000"
},
{
"input": "3711871 8",
"output": "371187100000000"
},
{
"input": "55555 8",
"output": "1111100000000"
},
{
"input": "222222222 8",
"output": "11111111100000000"
},
{
"input": "479001600 8",
"output": "7484400000000"
},
{
"input": "655360001 7",
"output": "6553600010000000"
},
{
"input": "655360001 8",
"output": "65536000100000000"
},
{
"input": "1000000000 1",
"output": "1000000000"
},
{
"input": "1000000000 7",
"output": "1000000000"
},
{
"input": "1000000000 8",
"output": "1000000000"
},
{
"input": "100000000 8",
"output": "100000000"
},
{
"input": "10000000 8",
"output": "100000000"
},
{
"input": "1000000 8",
"output": "100000000"
},
{
"input": "10000009 8",
"output": "1000000900000000"
},
{
"input": "10000005 8",
"output": "200000100000000"
},
{
"input": "10000002 8",
"output": "500000100000000"
},
{
"input": "999999997 8",
"output": "99999999700000000"
},
{
"input": "999999997 7",
"output": "9999999970000000"
},
{
"input": "999999995 8",
"output": "19999999900000000"
},
{
"input": "123 8",
"output": "12300000000"
},
{
"input": "24 2",
"output": "600"
},
{
"input": "16 4",
"output": "10000"
},
{
"input": "123456787 8",
"output": "12345678700000000"
},
{
"input": "100000000 8",
"output": "100000000"
},
{
"input": "7 1",
"output": "70"
},
{
"input": "101 1",
"output": "1010"
},
{
"input": "50 2",
"output": "100"
},
{
"input": "999999818 1",
"output": "4999999090"
},
{
"input": "2 1",
"output": "10"
},
{
"input": "123 1",
"output": "1230"
},
{
"input": "16 1",
"output": "80"
},
{
"input": "1 1",
"output": "10"
},
{
"input": "1000000000 8",
"output": "1000000000"
},
{
"input": "15304 6",
"output": "1913000000"
},
{
"input": "3 8",
"output": "300000000"
},
{
"input": "4 2",
"output": "100"
},
{
"input": "100000 7",
"output": "10000000"
},
{
"input": "5 8",
"output": "100000000"
},
{
"input": "16724 6",
"output": "4181000000"
},
{
"input": "999999999 1",
"output": "9999999990"
},
{
"input": "999999990 8",
"output": "9999999900000000"
},
{
"input": "999999999 8",
"output": "99999999900000000"
},
{
"input": "100000 1",
"output": "100000"
},
{
"input": "8 3",
"output": "1000"
},
{
"input": "16768 6",
"output": "262000000"
},
{
"input": "123456789 1",
"output": "1234567890"
},
{
"input": "2 8",
"output": "100000000"
},
{
"input": "999999937 8",
"output": "99999993700000000"
},
{
"input": "5 1",
"output": "10"
},
{
"input": "2000000 7",
"output": "10000000"
},
{
"input": "1999998 2",
"output": "99999900"
},
{
"input": "125 3",
"output": "1000"
}
] | 1,505,654,044
| 543
|
Python 3
|
OK
|
TESTS
| 96
| 62
| 5,529,600
|
n, k = map(int, input().split())
a = n
del2 = 0
del5 = 0
while n % 2 == 0 and del2 < k:
del2 += 1
n //= 2
while n % 5 == 0 and del5 < k:
del5 += 1
n //= 5
print(a * 2**(k-del2) * 5**(k-del5))
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
For a given positive integer *n* denote its *k*-rounding as the minimum positive integer *x*, such that *x* ends with *k* or more zeros in base 10 and is divisible by *n*.
For example, 4-rounding of 375 is 375·80<==<=30000. 30000 is the minimum integer such that it ends with 4 or more zeros and is divisible by 375.
Write a program that will perform the *k*-rounding of *n*.
Input Specification:
The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=109, 0<=≤<=*k*<=≤<=8).
Output Specification:
Print the *k*-rounding of *n*.
Demo Input:
['375 4\n', '10000 1\n', '38101 0\n', '123456789 8\n']
Demo Output:
['30000\n', '10000\n', '38101\n', '12345678900000000\n']
Note:
none
|
```python
n, k = map(int, input().split())
a = n
del2 = 0
del5 = 0
while n % 2 == 0 and del2 < k:
del2 += 1
n //= 2
while n % 5 == 0 and del5 < k:
del5 += 1
n //= 5
print(a * 2**(k-del2) * 5**(k-del5))
```
| 3
|
|
327
|
A
|
Flipping Game
|
PROGRAMMING
| 1,200
|
[
"brute force",
"dp",
"implementation"
] | null | null |
Iahub got bored, so he invented a game to be played on paper.
He writes *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Each of those integers can be either 0 or 1. He's allowed to do exactly one move: he chooses two indices *i* and *j* (1<=≤<=*i*<=≤<=*j*<=≤<=*n*) and flips all values *a**k* for which their positions are in range [*i*,<=*j*] (that is *i*<=≤<=*k*<=≤<=*j*). Flip the value of *x* means to apply operation *x*<==<=1 - *x*.
The goal of the game is that after exactly one move to obtain the maximum number of ones. Write a program to solve the little game of Iahub.
|
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100). In the second line of the input there are *n* integers: *a*1,<=*a*2,<=...,<=*a**n*. It is guaranteed that each of those *n* values is either 0 or 1.
|
Print an integer — the maximal number of 1s that can be obtained after exactly one move.
|
[
"5\n1 0 0 1 0\n",
"4\n1 0 0 1\n"
] |
[
"4\n",
"4\n"
] |
In the first case, flip the segment from 2 to 5 (*i* = 2, *j* = 5). That flip changes the sequence, it becomes: [1 1 1 0 1]. So, it contains four ones. There is no way to make the whole sequence equal to [1 1 1 1 1].
In the second case, flipping only the second and the third element (*i* = 2, *j* = 3) will turn all numbers into 1.
| 500
|
[
{
"input": "5\n1 0 0 1 0",
"output": "4"
},
{
"input": "4\n1 0 0 1",
"output": "4"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "8\n1 0 0 0 1 0 0 0",
"output": "7"
},
{
"input": "18\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "18"
},
{
"input": "23\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "22"
},
{
"input": "100\n0 1 0 1 1 1 0 1 0 1 0 0 1 1 1 1 0 0 1 1 1 1 1 1 1 0 0 1 1 1 0 1 1 0 0 0 1 1 1 1 0 0 1 1 1 0 0 1 1 0 1 1 1 0 0 0 1 0 0 0 0 0 1 1 0 0 1 1 1 1 1 1 1 1 0 1 1 1 0 1 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1",
"output": "70"
},
{
"input": "100\n0 1 1 0 1 0 0 1 0 0 0 1 1 0 0 0 1 1 1 0 1 0 0 0 0 0 1 0 1 0 1 0 1 0 1 0 0 0 1 0 0 0 0 0 1 1 0 1 0 1 0 1 1 1 0 1 0 1 1 0 0 1 1 0 0 1 1 1 0 0 1 0 0 1 1 0 1 0 0 1 1 0 1 0 0 1 1 0 0 0 0 1 0 0 0 0 1 1 1 1",
"output": "60"
},
{
"input": "18\n0 1 0 1 0 1 0 1 0 1 1 0 1 1 0 1 1 0",
"output": "11"
},
{
"input": "25\n0 1 0 0 0 0 0 1 0 1 0 1 0 0 0 0 1 1 1 0 0 1 1 0 1",
"output": "18"
},
{
"input": "55\n0 0 1 1 0 0 0 1 0 1 1 0 1 1 1 0 1 1 1 1 1 0 0 1 0 0 1 0 1 1 0 0 1 0 1 1 0 1 1 1 1 0 1 1 0 0 0 0 1 1 0 1 1 1 1",
"output": "36"
},
{
"input": "75\n1 1 0 1 0 1 1 0 0 0 0 0 1 1 1 1 1 0 1 0 1 0 0 0 0 1 1 1 0 1 0 0 1 1 0 1 0 0 1 1 0 1 0 1 0 1 0 0 0 0 1 0 0 1 1 1 0 0 1 0 1 1 0 0 0 0 1 1 0 0 0 1 0 0 0",
"output": "44"
},
{
"input": "100\n0 0 1 0 1 0 0 1 1 0 1 1 0 1 0 1 1 0 0 0 0 0 1 0 0 1 1 0 0 0 1 0 0 1 1 0 0 1 1 1 0 0 0 0 1 0 1 1 1 0 0 1 0 1 1 1 1 1 1 1 0 1 0 1 0 0 1 0 1 1 1 0 0 0 0 1 0 1 1 0 0 1 1 0 1 1 1 1 0 1 1 1 0 0 1 1 0 1 0 1",
"output": "61"
},
{
"input": "100\n0 0 0 1 0 0 0 1 0 1 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 1 0 1 0 1 0 1 0 1 1 0 1 1 0 0 0 1 1 1 1 0 1 1 0 1 1 1 1 0 1 0 0 1 0 1 0 0 0 0 1 1 0 0 1 0 0 1 1 0 1 1 0 1 0 0 1 1 0 1 1 1 1 0 1 0 0 1 0 1 1 1 0 1 1 0",
"output": "61"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "100"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "99"
},
{
"input": "100\n0 0 1 1 1 0 1 1 0 0 1 0 1 0 1 0 0 1 0 1 1 0 0 1 1 1 1 1 1 0 1 0 0 1 0 0 0 0 1 1 1 0 1 1 1 0 1 1 1 0 0 1 0 0 1 1 0 0 0 1 1 1 0 1 1 0 0 0 0 1 0 0 1 0 1 0 0 0 0 0 0 1 1 1 0 1 1 1 0 1 1 1 1 1 0 0 0 0 1 0",
"output": "61"
},
{
"input": "100\n0 1 1 1 1 1 1 0 0 0 1 1 0 0 0 1 0 0 0 0 0 0 1 1 1 0 0 0 1 1 1 0 1 0 0 1 1 0 0 0 1 1 1 1 1 1 1 1 1 1 0 0 1 0 1 0 0 0 0 1 0 1 0 1 0 0 1 0 1 0 1 1 0 0 0 0 0 1 1 1 0 1 1 0 1 1 0 0 0 1 0 1 1 0 0 0 0 0 0 1",
"output": "59"
},
{
"input": "99\n1 1 0 0 0 1 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 0 0 0 0 0 0 1 1 0 0 1 0 1 1 1 0 0 0 0 0 1 0 0 0 0 0 0 1 0 1 1 0 1 0 0 1 1 0 1 0 0 0 1 1 1 1 0 1 1 1 0 0 1 1 0 0 0 0 1 0 0 0 0 0 1 0 1 1 1",
"output": "61"
},
{
"input": "2\n1 1",
"output": "1"
}
] | 1,654,242,817
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 21
| 92
| 0
|
n,l,c,a,m = int(input()),list(map(int,input().split())),0,0,-1
for i in range (0, n):
c += l[i] == 1
a += (l[i] == 0) - (l[i] == 1)
m = max(m, a)
a *= a > 0
print(m + c)
|
Title: Flipping Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Iahub got bored, so he invented a game to be played on paper.
He writes *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Each of those integers can be either 0 or 1. He's allowed to do exactly one move: he chooses two indices *i* and *j* (1<=≤<=*i*<=≤<=*j*<=≤<=*n*) and flips all values *a**k* for which their positions are in range [*i*,<=*j*] (that is *i*<=≤<=*k*<=≤<=*j*). Flip the value of *x* means to apply operation *x*<==<=1 - *x*.
The goal of the game is that after exactly one move to obtain the maximum number of ones. Write a program to solve the little game of Iahub.
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100). In the second line of the input there are *n* integers: *a*1,<=*a*2,<=...,<=*a**n*. It is guaranteed that each of those *n* values is either 0 or 1.
Output Specification:
Print an integer — the maximal number of 1s that can be obtained after exactly one move.
Demo Input:
['5\n1 0 0 1 0\n', '4\n1 0 0 1\n']
Demo Output:
['4\n', '4\n']
Note:
In the first case, flip the segment from 2 to 5 (*i* = 2, *j* = 5). That flip changes the sequence, it becomes: [1 1 1 0 1]. So, it contains four ones. There is no way to make the whole sequence equal to [1 1 1 1 1].
In the second case, flipping only the second and the third element (*i* = 2, *j* = 3) will turn all numbers into 1.
|
```python
n,l,c,a,m = int(input()),list(map(int,input().split())),0,0,-1
for i in range (0, n):
c += l[i] == 1
a += (l[i] == 0) - (l[i] == 1)
m = max(m, a)
a *= a > 0
print(m + c)
```
| 3
|
|
787
|
A
|
The Monster
|
PROGRAMMING
| 1,200
|
[
"brute force",
"math",
"number theory"
] | null | null |
A monster is chasing after Rick and Morty on another planet. They're so frightened that sometimes they scream. More accurately, Rick screams at times *b*,<=*b*<=+<=*a*,<=*b*<=+<=2*a*,<=*b*<=+<=3*a*,<=... and Morty screams at times *d*,<=*d*<=+<=*c*,<=*d*<=+<=2*c*,<=*d*<=+<=3*c*,<=....
The Monster will catch them if at any point they scream at the same time, so it wants to know when it will catch them (the first time they scream at the same time) or that they will never scream at the same time.
|
The first line of input contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100).
The second line contains two integers *c* and *d* (1<=≤<=*c*,<=*d*<=≤<=100).
|
Print the first time Rick and Morty will scream at the same time, or <=-<=1 if they will never scream at the same time.
|
[
"20 2\n9 19\n",
"2 1\n16 12\n"
] |
[
"82\n",
"-1\n"
] |
In the first sample testcase, Rick's 5th scream and Morty's 8th time are at time 82.
In the second sample testcase, all Rick's screams will be at odd times and Morty's will be at even times, so they will never scream at the same time.
| 500
|
[
{
"input": "20 2\n9 19",
"output": "82"
},
{
"input": "2 1\n16 12",
"output": "-1"
},
{
"input": "39 52\n88 78",
"output": "1222"
},
{
"input": "59 96\n34 48",
"output": "1748"
},
{
"input": "87 37\n91 29",
"output": "211"
},
{
"input": "11 81\n49 7",
"output": "301"
},
{
"input": "39 21\n95 89",
"output": "3414"
},
{
"input": "59 70\n48 54",
"output": "1014"
},
{
"input": "87 22\n98 32",
"output": "718"
},
{
"input": "15 63\n51 13",
"output": "-1"
},
{
"input": "39 7\n97 91",
"output": "1255"
},
{
"input": "18 18\n71 71",
"output": "1278"
},
{
"input": "46 71\n16 49",
"output": "209"
},
{
"input": "70 11\n74 27",
"output": "2321"
},
{
"input": "94 55\n20 96",
"output": "-1"
},
{
"input": "18 4\n77 78",
"output": "1156"
},
{
"input": "46 44\n23 55",
"output": "-1"
},
{
"input": "74 88\n77 37",
"output": "1346"
},
{
"input": "94 37\n34 7",
"output": "789"
},
{
"input": "22 81\n80 88",
"output": "-1"
},
{
"input": "46 30\n34 62",
"output": "674"
},
{
"input": "40 4\n81 40",
"output": "364"
},
{
"input": "69 48\n39 9",
"output": "48"
},
{
"input": "89 93\n84 87",
"output": "5967"
},
{
"input": "17 45\n42 65",
"output": "317"
},
{
"input": "41 85\n95 46",
"output": "331"
},
{
"input": "69 30\n41 16",
"output": "1410"
},
{
"input": "93 74\n99 93",
"output": "-1"
},
{
"input": "17 19\n44 75",
"output": "427"
},
{
"input": "45 63\n98 53",
"output": "3483"
},
{
"input": "69 11\n48 34",
"output": "-1"
},
{
"input": "55 94\n3 96",
"output": "204"
},
{
"input": "100 100\n100 100",
"output": "100"
},
{
"input": "1 1\n1 1",
"output": "1"
},
{
"input": "1 1\n1 100",
"output": "100"
},
{
"input": "1 100\n100 1",
"output": "101"
},
{
"input": "98 1\n99 100",
"output": "9703"
},
{
"input": "98 1\n99 2",
"output": "9605"
},
{
"input": "97 2\n99 100",
"output": "4852"
},
{
"input": "3 3\n3 1",
"output": "-1"
},
{
"input": "3 2\n7 2",
"output": "2"
},
{
"input": "2 3\n2 5",
"output": "5"
},
{
"input": "2 3\n2 3",
"output": "3"
},
{
"input": "100 3\n100 5",
"output": "-1"
},
{
"input": "6 10\n12 14",
"output": "-1"
},
{
"input": "4 2\n4 4",
"output": "-1"
},
{
"input": "2 3\n2 2",
"output": "-1"
},
{
"input": "2 3\n4 99",
"output": "99"
},
{
"input": "1 5\n1 5",
"output": "5"
},
{
"input": "1 100\n3 1",
"output": "100"
},
{
"input": "2 2\n2 1",
"output": "-1"
},
{
"input": "2 10\n6 20",
"output": "20"
},
{
"input": "2 2\n2 10",
"output": "10"
},
{
"input": "3 7\n3 6",
"output": "-1"
},
{
"input": "1 100\n1 100",
"output": "100"
},
{
"input": "7 25\n39 85",
"output": "319"
},
{
"input": "84 82\n38 6",
"output": "82"
},
{
"input": "7 7\n7 14",
"output": "14"
}
] | 1,645,109,897
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 58
| 62
| 0
|
ab = list(map(int, input().split()))
a = ab[0]
b = ab[1]
cd = list(map(int, input().split()))
c = cd[0]
d = cd[1]
num_list = []
if b == d:
print(b)
elif a >= c:
for i in range(max((d - b), 0)//a + c + 1):
num_list.append(a * i + b)
for i in num_list:
if (i - d) % c == 0 and i - d >= 0:
print(i)
break
if num_list.index(i) == len(num_list) - 1:
print(-1)
break
elif a < c:
for i in range(max((b - d), 0)//c + a + 1):
num_list.append(c * i + d)
for i in num_list:
if (i - b) % a == 0 and i - b >= 0:
print(i)
break
if num_list.index(i) == len(num_list) - 1:
print(-1)
break
|
Title: The Monster
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A monster is chasing after Rick and Morty on another planet. They're so frightened that sometimes they scream. More accurately, Rick screams at times *b*,<=*b*<=+<=*a*,<=*b*<=+<=2*a*,<=*b*<=+<=3*a*,<=... and Morty screams at times *d*,<=*d*<=+<=*c*,<=*d*<=+<=2*c*,<=*d*<=+<=3*c*,<=....
The Monster will catch them if at any point they scream at the same time, so it wants to know when it will catch them (the first time they scream at the same time) or that they will never scream at the same time.
Input Specification:
The first line of input contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100).
The second line contains two integers *c* and *d* (1<=≤<=*c*,<=*d*<=≤<=100).
Output Specification:
Print the first time Rick and Morty will scream at the same time, or <=-<=1 if they will never scream at the same time.
Demo Input:
['20 2\n9 19\n', '2 1\n16 12\n']
Demo Output:
['82\n', '-1\n']
Note:
In the first sample testcase, Rick's 5th scream and Morty's 8th time are at time 82.
In the second sample testcase, all Rick's screams will be at odd times and Morty's will be at even times, so they will never scream at the same time.
|
```python
ab = list(map(int, input().split()))
a = ab[0]
b = ab[1]
cd = list(map(int, input().split()))
c = cd[0]
d = cd[1]
num_list = []
if b == d:
print(b)
elif a >= c:
for i in range(max((d - b), 0)//a + c + 1):
num_list.append(a * i + b)
for i in num_list:
if (i - d) % c == 0 and i - d >= 0:
print(i)
break
if num_list.index(i) == len(num_list) - 1:
print(-1)
break
elif a < c:
for i in range(max((b - d), 0)//c + a + 1):
num_list.append(c * i + d)
for i in num_list:
if (i - b) % a == 0 and i - b >= 0:
print(i)
break
if num_list.index(i) == len(num_list) - 1:
print(-1)
break
```
| 3
|
|
845
|
B
|
Luba And The Ticket
|
PROGRAMMING
| 1,600
|
[
"brute force",
"greedy",
"implementation"
] | null | null |
Luba has a ticket consisting of 6 digits. In one move she can choose digit in any position and replace it with arbitrary digit. She wants to know the minimum number of digits she needs to replace in order to make the ticket lucky.
The ticket is considered lucky if the sum of first three digits equals to the sum of last three digits.
|
You are given a string consisting of 6 characters (all characters are digits from 0 to 9) — this string denotes Luba's ticket. The ticket can start with the digit 0.
|
Print one number — the minimum possible number of digits Luba needs to replace to make the ticket lucky.
|
[
"000000\n",
"123456\n",
"111000\n"
] |
[
"0\n",
"2\n",
"1\n"
] |
In the first example the ticket is already lucky, so the answer is 0.
In the second example Luba can replace 4 and 5 with zeroes, and the ticket will become lucky. It's easy to see that at least two replacements are required.
In the third example Luba can replace any zero with 3. It's easy to see that at least one replacement is required.
| 0
|
[
{
"input": "000000",
"output": "0"
},
{
"input": "123456",
"output": "2"
},
{
"input": "111000",
"output": "1"
},
{
"input": "120111",
"output": "0"
},
{
"input": "999999",
"output": "0"
},
{
"input": "199880",
"output": "1"
},
{
"input": "899889",
"output": "1"
},
{
"input": "899888",
"output": "1"
},
{
"input": "505777",
"output": "2"
},
{
"input": "999000",
"output": "3"
},
{
"input": "989010",
"output": "3"
},
{
"input": "651894",
"output": "1"
},
{
"input": "858022",
"output": "2"
},
{
"input": "103452",
"output": "1"
},
{
"input": "999801",
"output": "2"
},
{
"input": "999990",
"output": "1"
},
{
"input": "697742",
"output": "1"
},
{
"input": "242367",
"output": "2"
},
{
"input": "099999",
"output": "1"
},
{
"input": "198999",
"output": "1"
},
{
"input": "023680",
"output": "1"
},
{
"input": "999911",
"output": "2"
},
{
"input": "000990",
"output": "2"
},
{
"input": "117099",
"output": "1"
},
{
"input": "990999",
"output": "1"
},
{
"input": "000111",
"output": "1"
},
{
"input": "000444",
"output": "2"
},
{
"input": "202597",
"output": "2"
},
{
"input": "000333",
"output": "1"
},
{
"input": "030039",
"output": "1"
},
{
"input": "000009",
"output": "1"
},
{
"input": "006456",
"output": "1"
},
{
"input": "022995",
"output": "3"
},
{
"input": "999198",
"output": "1"
},
{
"input": "223456",
"output": "2"
},
{
"input": "333665",
"output": "2"
},
{
"input": "123986",
"output": "2"
},
{
"input": "599257",
"output": "1"
},
{
"input": "101488",
"output": "3"
},
{
"input": "111399",
"output": "2"
},
{
"input": "369009",
"output": "1"
},
{
"input": "024887",
"output": "2"
},
{
"input": "314347",
"output": "1"
},
{
"input": "145892",
"output": "1"
},
{
"input": "321933",
"output": "1"
},
{
"input": "100172",
"output": "1"
},
{
"input": "222455",
"output": "2"
},
{
"input": "317596",
"output": "1"
},
{
"input": "979245",
"output": "2"
},
{
"input": "000018",
"output": "1"
},
{
"input": "101389",
"output": "2"
},
{
"input": "123985",
"output": "2"
},
{
"input": "900000",
"output": "1"
},
{
"input": "132069",
"output": "1"
},
{
"input": "949256",
"output": "1"
},
{
"input": "123996",
"output": "2"
},
{
"input": "034988",
"output": "2"
},
{
"input": "320869",
"output": "2"
},
{
"input": "089753",
"output": "1"
},
{
"input": "335667",
"output": "2"
},
{
"input": "868580",
"output": "1"
},
{
"input": "958031",
"output": "2"
},
{
"input": "117999",
"output": "2"
},
{
"input": "000001",
"output": "1"
},
{
"input": "213986",
"output": "2"
},
{
"input": "123987",
"output": "3"
},
{
"input": "111993",
"output": "2"
},
{
"input": "642479",
"output": "1"
},
{
"input": "033788",
"output": "2"
},
{
"input": "766100",
"output": "2"
},
{
"input": "012561",
"output": "1"
},
{
"input": "111695",
"output": "2"
},
{
"input": "123689",
"output": "2"
},
{
"input": "944234",
"output": "1"
},
{
"input": "154999",
"output": "2"
},
{
"input": "333945",
"output": "1"
},
{
"input": "371130",
"output": "1"
},
{
"input": "977330",
"output": "2"
},
{
"input": "777544",
"output": "2"
},
{
"input": "111965",
"output": "2"
},
{
"input": "988430",
"output": "2"
},
{
"input": "123789",
"output": "3"
},
{
"input": "111956",
"output": "2"
},
{
"input": "444776",
"output": "2"
},
{
"input": "001019",
"output": "1"
},
{
"input": "011299",
"output": "2"
},
{
"input": "011389",
"output": "2"
},
{
"input": "999333",
"output": "2"
},
{
"input": "126999",
"output": "2"
},
{
"input": "744438",
"output": "0"
},
{
"input": "588121",
"output": "3"
},
{
"input": "698213",
"output": "2"
},
{
"input": "652858",
"output": "1"
},
{
"input": "989304",
"output": "3"
},
{
"input": "888213",
"output": "3"
},
{
"input": "969503",
"output": "2"
},
{
"input": "988034",
"output": "2"
},
{
"input": "889444",
"output": "2"
},
{
"input": "990900",
"output": "1"
},
{
"input": "301679",
"output": "2"
},
{
"input": "434946",
"output": "1"
},
{
"input": "191578",
"output": "2"
},
{
"input": "118000",
"output": "2"
},
{
"input": "636915",
"output": "0"
},
{
"input": "811010",
"output": "1"
},
{
"input": "822569",
"output": "1"
},
{
"input": "122669",
"output": "2"
},
{
"input": "010339",
"output": "2"
},
{
"input": "213698",
"output": "2"
},
{
"input": "895130",
"output": "2"
},
{
"input": "000900",
"output": "1"
},
{
"input": "191000",
"output": "2"
},
{
"input": "001000",
"output": "1"
},
{
"input": "080189",
"output": "2"
},
{
"input": "990000",
"output": "2"
},
{
"input": "201984",
"output": "2"
},
{
"input": "002667",
"output": "2"
},
{
"input": "877542",
"output": "2"
},
{
"input": "301697",
"output": "2"
},
{
"input": "211597",
"output": "2"
},
{
"input": "420337",
"output": "1"
},
{
"input": "024768",
"output": "2"
},
{
"input": "878033",
"output": "2"
},
{
"input": "788024",
"output": "2"
},
{
"input": "023869",
"output": "2"
},
{
"input": "466341",
"output": "1"
},
{
"input": "696327",
"output": "1"
},
{
"input": "779114",
"output": "2"
},
{
"input": "858643",
"output": "1"
},
{
"input": "011488",
"output": "3"
},
{
"input": "003669",
"output": "2"
},
{
"input": "202877",
"output": "3"
},
{
"input": "738000",
"output": "2"
},
{
"input": "567235",
"output": "2"
},
{
"input": "887321",
"output": "3"
},
{
"input": "401779",
"output": "2"
},
{
"input": "989473",
"output": "2"
},
{
"input": "004977",
"output": "3"
},
{
"input": "023778",
"output": "2"
},
{
"input": "809116",
"output": "1"
},
{
"input": "042762",
"output": "1"
},
{
"input": "777445",
"output": "2"
},
{
"input": "769302",
"output": "2"
},
{
"input": "023977",
"output": "2"
},
{
"input": "990131",
"output": "2"
}
] | 1,511,636,222
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 145
| 77
| 5,529,600
|
# get input and split into 2 arrays
num = input()
p1 = [int(x) for x in num[:3]]
p2 = [int(x) for x in num[3:]]
# p1 is array with lesser sum and p2 with greater sum
temp = p1[::] if sum(p1) < sum(p2) else p2[::]
p2 = p2 if sum(p2) >= sum(p1) else p1[::]
p1 = temp
_min = 0
# add to p1 or remove of p2, so the difference go to zero or change signal.
while sum(p1) < sum(p2):
if 9-min(p1) > max(p2): p1[p1.index(min(p1))] = 9
else: p2[p2.index(max(p2))] = 0
_min += 1
print(_min)
|
Title: Luba And The Ticket
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Luba has a ticket consisting of 6 digits. In one move she can choose digit in any position and replace it with arbitrary digit. She wants to know the minimum number of digits she needs to replace in order to make the ticket lucky.
The ticket is considered lucky if the sum of first three digits equals to the sum of last three digits.
Input Specification:
You are given a string consisting of 6 characters (all characters are digits from 0 to 9) — this string denotes Luba's ticket. The ticket can start with the digit 0.
Output Specification:
Print one number — the minimum possible number of digits Luba needs to replace to make the ticket lucky.
Demo Input:
['000000\n', '123456\n', '111000\n']
Demo Output:
['0\n', '2\n', '1\n']
Note:
In the first example the ticket is already lucky, so the answer is 0.
In the second example Luba can replace 4 and 5 with zeroes, and the ticket will become lucky. It's easy to see that at least two replacements are required.
In the third example Luba can replace any zero with 3. It's easy to see that at least one replacement is required.
|
```python
# get input and split into 2 arrays
num = input()
p1 = [int(x) for x in num[:3]]
p2 = [int(x) for x in num[3:]]
# p1 is array with lesser sum and p2 with greater sum
temp = p1[::] if sum(p1) < sum(p2) else p2[::]
p2 = p2 if sum(p2) >= sum(p1) else p1[::]
p1 = temp
_min = 0
# add to p1 or remove of p2, so the difference go to zero or change signal.
while sum(p1) < sum(p2):
if 9-min(p1) > max(p2): p1[p1.index(min(p1))] = 9
else: p2[p2.index(max(p2))] = 0
_min += 1
print(_min)
```
| 3
|
|
837
|
A
|
Text Volume
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
You are given a text of single-space separated words, consisting of small and capital Latin letters.
Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text.
Calculate the volume of the given text.
|
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text.
The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters.
|
Print one integer number — volume of text.
|
[
"7\nNonZERO\n",
"24\nthis is zero answer text\n",
"24\nHarbour Space University\n"
] |
[
"5\n",
"0\n",
"1\n"
] |
In the first example there is only one word, there are 5 capital letters in it.
In the second example all of the words contain 0 capital letters.
| 0
|
[
{
"input": "7\nNonZERO",
"output": "5"
},
{
"input": "24\nthis is zero answer text",
"output": "0"
},
{
"input": "24\nHarbour Space University",
"output": "1"
},
{
"input": "2\nWM",
"output": "2"
},
{
"input": "200\nLBmJKQLCKUgtTxMoDsEerwvLOXsxASSydOqWyULsRcjMYDWdDCgaDvBfATIWPVSXlbcCLHPYahhxMEYUiaxoCebghJqvmRnaNHYTKLeOiaLDnATPZAOgSNfBzaxLymTGjfzvTegbXsAthTxyDTcmBUkqyGlVGZhoazQzVSoKbTFcCRvYsgSCwjGMxBfWEwMHuagTBxkz",
"output": "105"
},
{
"input": "199\no A r v H e J q k J k v w Q F p O R y R Z o a K R L Z E H t X y X N y y p b x B m r R S q i A x V S u i c L y M n N X c C W Z m S j e w C w T r I S X T D F l w o k f t X u n W w p Z r A k I Y E h s g",
"output": "1"
},
{
"input": "200\nhCyIdivIiISmmYIsCLbpKcTyHaOgTUQEwnQACXnrLdHAVFLtvliTEMlzBVzTesQbhXmcqvwPDeojglBMIjOXANfyQxCSjOJyO SIqOTnRzVzseGIDDYNtrwIusScWSuEhPyEmgQIVEzXofRptjeMzzhtUQxJgcUWILUhEaaRmYRBVsjoqgmyPIKwSajdlNPccOOtWrez",
"output": "50"
},
{
"input": "1\ne",
"output": "0"
},
{
"input": "1\nA",
"output": "1"
},
{
"input": "200\nABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU VWXYZABCDE KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KZ",
"output": "10"
},
{
"input": "200\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "200"
},
{
"input": "200\nffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff",
"output": "0"
},
{
"input": "24\nHarbour Space UniversitY",
"output": "2"
},
{
"input": "5\naA AA",
"output": "2"
},
{
"input": "10\nas AS ASDA",
"output": "4"
},
{
"input": "10\nas AS ASDZ",
"output": "4"
},
{
"input": "3\na A",
"output": "1"
},
{
"input": "24\nHarbour space UniversitY",
"output": "2"
},
{
"input": "10\nas AS ASAa",
"output": "3"
},
{
"input": "15\naAb ABCDFGRHTJS",
"output": "11"
},
{
"input": "53\nsdfAZEZR AZE dfdf dsdRFGSDF ZZDZSD dfsd ERBGF dsfsdfR",
"output": "6"
},
{
"input": "10\nABC ABc AB",
"output": "3"
},
{
"input": "10\nA c de CDE",
"output": "3"
},
{
"input": "4\nA AB",
"output": "2"
},
{
"input": "18\nHARbour Space UNIV",
"output": "4"
},
{
"input": "13\na b c d e f A",
"output": "1"
},
{
"input": "6\nA B CA",
"output": "2"
},
{
"input": "4\naa A",
"output": "1"
},
{
"input": "3\nA a",
"output": "1"
}
] | 1,502,704,425
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 62
| 4,608,000
|
def calculate(word):
result = 0
for char in word:
result += 1 if char.isupper() else 0
return result
n = input()
words = input().split()
screams = [calculate(word) for word in words]
print(max(screams))
|
Title: Text Volume
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a text of single-space separated words, consisting of small and capital Latin letters.
Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text.
Calculate the volume of the given text.
Input Specification:
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text.
The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters.
Output Specification:
Print one integer number — volume of text.
Demo Input:
['7\nNonZERO\n', '24\nthis is zero answer text\n', '24\nHarbour Space University\n']
Demo Output:
['5\n', '0\n', '1\n']
Note:
In the first example there is only one word, there are 5 capital letters in it.
In the second example all of the words contain 0 capital letters.
|
```python
def calculate(word):
result = 0
for char in word:
result += 1 if char.isupper() else 0
return result
n = input()
words = input().split()
screams = [calculate(word) for word in words]
print(max(screams))
```
| 3
|
|
50
|
C
|
Happy Farm 5
|
PROGRAMMING
| 2,000
|
[
"geometry"
] |
C. Happy Farm 5
|
2
|
256
|
The Happy Farm 5 creators decided to invent the mechanism of cow grazing. The cows in the game are very slow and they move very slowly, it can even be considered that they stand still. However, carnivores should always be chased off them.
For that a young player Vasya decided to make the shepherd run round the cows along one and the same closed path. It is very important that the cows stayed strictly inside the area limited by the path, as otherwise some cows will sooner or later be eaten. To be absolutely sure in the cows' safety, Vasya wants the path completion time to be minimum.
The new game is launched for different devices, including mobile phones. That's why the developers decided to quit using the arithmetics with the floating decimal point and use only the arithmetics of integers. The cows and the shepherd in the game are represented as points on the plane with integer coordinates. The playing time is modeled by the turns. During every turn the shepherd can either stay where he stands or step in one of eight directions: horizontally, vertically, or diagonally. As the coordinates should always remain integer, then the length of a horizontal and vertical step is equal to 1, and the length of a diagonal step is equal to . The cows do not move. You have to minimize the number of moves the shepherd needs to run round the whole herd.
|
The first line contains an integer *N* which represents the number of cows in the herd (1<=≤<=*N*<=≤<=105). Each of the next *N* lines contains two integers *X**i* and *Y**i* which represent the coordinates of one cow of (|*X**i*|,<=|*Y**i*|<=≤<=106). Several cows can stand on one point.
|
Print the single number — the minimum number of moves in the sought path.
|
[
"4\n1 1\n5 1\n5 3\n1 3\n"
] |
[
"16\n"
] |
Picture for the example test: The coordinate grid is painted grey, the coordinates axes are painted black, the cows are painted red and the sought route is painted green.
| 1,500
|
[
{
"input": "4\n1 1\n5 1\n5 3\n1 3",
"output": "16"
},
{
"input": "3\n0 0\n5 0\n0 5",
"output": "19"
},
{
"input": "5\n0 0\n7 7\n7 5\n5 7\n1 1",
"output": "22"
},
{
"input": "5\n1 0\n-1 0\n1 0\n-1 0\n0 0",
"output": "8"
},
{
"input": "9\n1 0\n-1 0\n1 0\n-1 0\n0 0\n1 1\n-1 -1\n1 -1\n-1 1",
"output": "12"
},
{
"input": "5\n-10 10\n-10 -10\n10 -10\n9 8\n1 2",
"output": "81"
},
{
"input": "1\n7 -10",
"output": "4"
},
{
"input": "3\n7 -10\n7 -10\n7 -10",
"output": "4"
},
{
"input": "2\n-10 0\n-10 7",
"output": "18"
},
{
"input": "5\n-10 0\n-10 7\n-10 0\n-10 7\n-10 0",
"output": "18"
},
{
"input": "11\n0 0\n3 0\n1 0\n2 0\n1 0\n5 0\n3 0\n10 0\n6 0\n-1 0\n2 0",
"output": "26"
},
{
"input": "10\n1 0\n1 -3\n1 5\n1 -2\n1 5\n1 -2\n1 -2\n1 -2\n1 -2\n1 -2",
"output": "20"
},
{
"input": "6\n1 0\n2 1\n10 9\n-1 -2\n2 1\n-1 -2",
"output": "26"
},
{
"input": "6\n5 0\n0 5\n10 -5\n-5 10\n2 3\n3 2",
"output": "34"
},
{
"input": "3\n0 0\n2 0\n0 2",
"output": "10"
},
{
"input": "3\n0 0\n1 0\n0 2",
"output": "9"
},
{
"input": "3\n0 0\n2 0\n0 1",
"output": "9"
},
{
"input": "3\n0 0\n2 1\n0 2",
"output": "10"
},
{
"input": "3\n0 0\n2 0\n1 2",
"output": "10"
},
{
"input": "3\n0 0\n2 1\n1 2",
"output": "9"
},
{
"input": "3\n0 0\n3 1\n2 3",
"output": "12"
},
{
"input": "3\n10 0\n0 20\n33 30",
"output": "87"
},
{
"input": "4\n0 2\n2 0\n3 5\n5 3",
"output": "14"
},
{
"input": "5\n0 2\n2 0\n3 5\n5 3\n6 3",
"output": "16"
},
{
"input": "8\n0 2\n3 0\n5 3\n2 5\n2 2\n3 3\n2 2\n2 2",
"output": "16"
},
{
"input": "4\n0 3\n3 0\n5 3\n2 5",
"output": "15"
},
{
"input": "10\n2 0\n1 1\n0 2\n4 0\n0 4\n3 8\n5 8\n7 8\n8 7\n8 4",
"output": "26"
},
{
"input": "4\n-1000000 -1000000\n1000000 1000000\n-1000000 1000000\n1000000 -1000000",
"output": "8000004"
},
{
"input": "4\n-1000000 -999993\n999991 999997\n-999998 999996\n999994 -1000000",
"output": "7999973"
},
{
"input": "11\n-1000000 -999993\n999991 999997\n1 3\n1 3\n0 0\n-999998 999996\n-1 3\n4 5\n-999998 999996\n6 7\n999994 -1000000",
"output": "7999973"
},
{
"input": "2\n-1000000 -1000000\n999999 999999",
"output": "4000002"
},
{
"input": "2\n-1000000 -1000000\n999999 1000000",
"output": "4000004"
},
{
"input": "3\n1 -1\n-1 -1\n-1 1",
"output": "10"
},
{
"input": "3\n2 2\n1 -2\n0 2",
"output": "14"
},
{
"input": "3\n1 -1\n1 2\n-2 -2",
"output": "14"
},
{
"input": "3\n0 2\n-1 1\n2 -1",
"output": "11"
},
{
"input": "3\n2 1\n1 2\n-2 0",
"output": "12"
},
{
"input": "3\n0 2\n2 1\n2 1",
"output": "8"
},
{
"input": "3\n1 1\n0 2\n0 -1",
"output": "10"
},
{
"input": "4\n-1 -2\n2 -1\n-1 -1\n-1 0",
"output": "12"
},
{
"input": "4\n2 1\n1 1\n-1 2\n-2 -2",
"output": "15"
},
{
"input": "4\n1 2\n0 1\n0 3\n-1 -3",
"output": "16"
},
{
"input": "4\n1 -1\n0 -2\n0 1\n-1 0",
"output": "10"
},
{
"input": "5\n-2 2\n2 -3\n2 3\n2 1\n2 -3",
"output": "19"
},
{
"input": "5\n-3 -3\n-3 3\n1 0\n-2 2\n0 -1",
"output": "18"
},
{
"input": "6\n2 -1\n-2 1\n-1 -1\n0 2\n2 -2\n-2 0",
"output": "15"
},
{
"input": "8\n3 -1\n1 -1\n0 2\n-2 -2\n1 -2\n1 -2\n3 2\n3 2",
"output": "19"
},
{
"input": "20\n9 0\n11 6\n13 4\n7 3\n9 0\n10 4\n11 4\n11 2\n9 0\n9 1\n9 0\n10 4\n13 4\n10 6\n10 6\n9 0\n9 1\n10 2\n10 4\n12 3",
"output": "17"
},
{
"input": "30\n-4 0\n-4 0\n-5 2\n-1 3\n-3 3\n-3 4\n-1 2\n-3 3\n-2 4\n-4 0\n-1 -1\n-2 2\n-2 2\n-5 1\n-1 3\n-1 -1\n-5 1\n-1 -1\n-3 1\n-3 0\n-5 2\n-2 -1\n-4 0\n-1 4\n-5 2\n-1 -1\n-1 3\n-4 1\n-3 4\n-3 -1",
"output": "18"
},
{
"input": "40\n6 -14\n12 -13\n13 -16\n12 -13\n12 -13\n7 -13\n13 -16\n11 -15\n6 -14\n5 -14\n13 -14\n8 -17\n9 -13\n10 -10\n6 -13\n6 -15\n7 -12\n10 -11\n14 -14\n12 -12\n6 -14\n6 -14\n9 -15\n12 -13\n5 -14\n13 -16\n7 -12\n11 -17\n12 -13\n14 -14\n10 -11\n10 -18\n6 -15\n9 -14\n10 -14\n15 -15\n8 -13\n13 -15\n8 -17\n13 -13",
"output": "24"
},
{
"input": "50\n-10 4\n5 4\n-4 4\n0 4\n-11 2\n-10 6\n-3 2\n-2 -3\n-2 -5\n5 -4\n0 -3\n5 -4\n-13 3\n-9 3\n1 -4\n-1 3\n0 5\n-7 2\n-9 5\n0 4\n4 5\n-2 -5\n4 4\n-9 1\n-9 6\n3 -2\n2 -4\n-10 6\n-2 -3\n-7 2\n2 5\n-2 6\n-2 6\n2 5\n2 -4\n5 2\n-5 -2\n4 4\n2 -4\n2 -4\n5 3\n5 1\n3 -1\n-10 4\n4 -5\n-4 2\n-5 -2\n-2 2\n-1 4\n3 5",
"output": "48"
},
{
"input": "60\n22 -7\n25 -2\n21 5\n21 2\n26 1\n19 1\n21 0\n21 2\n29 -5\n18 -3\n27 -3\n29 -5\n23 -4\n29 -5\n22 0\n19 -1\n23 0\n21 -5\n24 -1\n21 -4\n19 1\n24 3\n19 3\n25 -7\n24 -3\n30 -5\n24 -3\n27 -7\n20 -5\n16 -1\n25 -5\n19 -3\n18 -1\n17 -1\n19 1\n18 2\n28 -5\n24 0\n25 2\n22 1\n29 -5\n22 -1\n19 1\n28 -2\n29 -2\n22 -4\n21 0\n22 -4\n21 -5\n19 3\n22 -1\n21 5\n27 -4\n30 -3\n30 -5\n22 3\n19 2\n26 -1\n23 3\n22 -4",
"output": "35"
},
{
"input": "20\n-118 -4\n-114 -8\n-86 40\n-77 38\n-128 24\n-114 -8\n-107 24\n-63 15\n-114 -8\n-138 34\n-136 53\n-116 37\n-62 14\n-116 37\n-112 10\n-146 25\n-83 42\n-62 14\n-107 11\n-138 34",
"output": "200"
},
{
"input": "30\n220065 650176\n-85645 309146\n245761 474510\n297068 761230\n39280 454823\n65372 166746\n316557 488319\n220065 650176\n245761 474510\n65372 166746\n-8475 -14722\n327177 312018\n371695 397843\n343097 243895\n-113462 117273\n-8189 440841\n327177 312018\n-171241 288713\n-147691 268033\n265028 425605\n208512 456240\n97333 6791\n-109657 297156\n-109657 297156\n-176591 87288\n-120815 31512\n120019 546293\n3773 19061\n161901 442125\n-50681 429871",
"output": "1727359"
},
{
"input": "50\n139 201\n115 37\n206 8\n115 37\n167 201\n189 1\n167 201\n141 201\n141 201\n115 37\n78 81\n167 201\n126 201\n78 91\n103 186\n208 169\n85 67\n208 153\n78 97\n208 89\n126 26\n141 201\n208 42\n166 41\n78 124\n156 1\n181 201\n78 129\n208 169\n208 52\n78 85\n128 201\n167 201\n208 23\n100 52\n148 4\n116 199\n208 122\n173 201\n167 201\n153 1\n176 1\n170 194\n78 132\n206 8\n208 23\n208 67\n208 116\n78 161\n142 160",
"output": "515"
},
{
"input": "60\n-20 179\n-68 0\n-110 68\n-22 177\n47 140\n-49 -4\n-106 38\n-23 22\n20 193\n47 173\n-23 22\n-100 32\n-97 29\n47 124\n-49 -4\n20 193\n-20 179\n-50 149\n-59 -7\n4 193\n-23 22\n-97 29\n-23 22\n-66 133\n47 167\n-61 138\n-49 -4\n-91 108\n-110 84\n47 166\n-110 77\n-99 100\n-23 22\n-59 -7\n47 128\n46 91\n9 193\n-110 86\n-49 -4\n8 193\n2 47\n-35 164\n-100 32\n47 114\n-56 -7\n47 148\n14 193\n20 65\n47 171\n47 171\n-110 53\n47 93\n20 65\n-35 164\n-50 149\n-25 174\n9 193\n47 150\n-49 -4\n-110 44",
"output": "446"
},
{
"input": "54\n-2 0\n-2 0\n3 -3\n-3 -6\n-5 -5\n-1 -4\n2 5\n-4 2\n2 5\n-5 5\n5 3\n3 1\n-2 1\n4 4\n-4 4\n-3 2\n-5 -4\n2 4\n4 2\n-2 1\n4 -1\n5 4\n-2 1\n-5 5\n-3 -1\n-4 -1\n1 -4\n-2 -2\n3 -3\n2 6\n-5 3\n-1 4\n5 -1\n2 -4\n2 -2\n1 4\n-5 5\n0 4\n-5 3\n-4 -2\n3 -2\n3 -1\n-4 -1\n5 5\n4 5\n3 -3\n1 2\n2 5\n-2 -4\n-5 5\n-4 1\n2 4\n-3 -4\n1 6",
"output": "40"
},
{
"input": "35\n3 -3\n1 4\n-3 -3\n2 -2\n0 -1\n-1 -1\n2 5\n0 -1\n1 3\n-3 -5\n1 -1\n3 5\n1 -3\n3 -5\n-1 3\n2 -3\n1 -1\n-3 5\n-3 -2\n2 -2\n1 -6\n-3 5\n-1 1\n1 -3\n1 4\n3 4\n-1 -1\n0 -5\n3 -2\n-3 -4\n3 6\n1 4\n-2 1\n2 -3\n2 -6",
"output": "37"
},
{
"input": "43\n-1 2\n2 -3\n-2 0\n2 -1\n0 1\n0 0\n1 -3\n0 -2\n0 2\n2 0\n-1 2\n2 -3\n1 2\n1 0\n1 -3\n-2 -3\n2 -3\n-2 0\n0 -3\n1 -2\n-2 -3\n1 1\n2 -3\n2 1\n-1 -3\n1 2\n1 -3\n-1 2\n0 1\n0 -1\n0 -3\n2 1\n1 0\n-2 -3\n0 -2\n1 1\n-2 2\n-2 -3\n-2 3\n-1 0\n1 -1\n2 2\n-1 -2",
"output": "23"
},
{
"input": "61\n0 -5\n0 3\n0 -1\n0 -4\n0 6\n0 -1\n0 -3\n0 6\n0 5\n0 -5\n0 1\n0 2\n0 5\n0 -3\n0 1\n0 -6\n0 -3\n0 3\n0 -3\n0 -5\n0 2\n0 1\n0 5\n0 3\n0 -2\n0 -2\n0 -3\n0 -6\n0 -4\n0 -2\n0 0\n0 -1\n0 -5\n0 -6\n0 6\n0 0\n0 -5\n0 1\n0 2\n0 -2\n0 -5\n0 6\n0 -3\n0 4\n0 5\n0 2\n0 -6\n0 -3\n0 2\n0 1\n0 -2\n0 -4\n0 -2\n0 4\n0 -1\n0 6\n0 0\n0 -1\n0 -3\n0 -4\n0 -3",
"output": "28"
},
{
"input": "57\n-8 0\n-2 0\n-2 0\n-7 0\n-8 0\n0 0\n8 0\n8 0\n3 0\n-2 0\n-3 0\n6 0\n-7 0\n-9 0\n-2 0\n-4 0\n-8 0\n0 0\n6 0\n7 0\n3 0\n0 0\n9 0\n0 0\n-9 0\n3 0\n8 0\n0 0\n6 0\n-4 0\n8 0\n10 0\n-7 0\n3 0\n-1 0\n8 0\n3 0\n1 0\n6 0\n3 0\n-8 0\n4 0\n-8 0\n-2 0\n1 0\n6 0\n7 0\n-6 0\n-2 0\n-2 0\n-8 0\n-8 0\n2 0\n0 0\n10 0\n4 0\n-8 0",
"output": "42"
}
] | 1,672,675,805
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 75
| 748
| 0
|
n=int(input())
mh=sh=-10**7
ml=sl=10**7
for i in range(n):
a,b=map(int,input().split())
m=a+b
s=a-b
mh=max(mh,m)
ml=min(ml,m)
sh=max(sh,s)
sl=min(sl,s)
print(mh-ml+sh-sl+4)
|
Title: Happy Farm 5
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The Happy Farm 5 creators decided to invent the mechanism of cow grazing. The cows in the game are very slow and they move very slowly, it can even be considered that they stand still. However, carnivores should always be chased off them.
For that a young player Vasya decided to make the shepherd run round the cows along one and the same closed path. It is very important that the cows stayed strictly inside the area limited by the path, as otherwise some cows will sooner or later be eaten. To be absolutely sure in the cows' safety, Vasya wants the path completion time to be minimum.
The new game is launched for different devices, including mobile phones. That's why the developers decided to quit using the arithmetics with the floating decimal point and use only the arithmetics of integers. The cows and the shepherd in the game are represented as points on the plane with integer coordinates. The playing time is modeled by the turns. During every turn the shepherd can either stay where he stands or step in one of eight directions: horizontally, vertically, or diagonally. As the coordinates should always remain integer, then the length of a horizontal and vertical step is equal to 1, and the length of a diagonal step is equal to . The cows do not move. You have to minimize the number of moves the shepherd needs to run round the whole herd.
Input Specification:
The first line contains an integer *N* which represents the number of cows in the herd (1<=≤<=*N*<=≤<=105). Each of the next *N* lines contains two integers *X**i* and *Y**i* which represent the coordinates of one cow of (|*X**i*|,<=|*Y**i*|<=≤<=106). Several cows can stand on one point.
Output Specification:
Print the single number — the minimum number of moves in the sought path.
Demo Input:
['4\n1 1\n5 1\n5 3\n1 3\n']
Demo Output:
['16\n']
Note:
Picture for the example test: The coordinate grid is painted grey, the coordinates axes are painted black, the cows are painted red and the sought route is painted green.
|
```python
n=int(input())
mh=sh=-10**7
ml=sl=10**7
for i in range(n):
a,b=map(int,input().split())
m=a+b
s=a-b
mh=max(mh,m)
ml=min(ml,m)
sh=max(sh,s)
sl=min(sl,s)
print(mh-ml+sh-sl+4)
```
| 3.813
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.