contestId
int64
0
1.01k
index
stringclasses
40 values
name
stringlengths
2
54
type
stringclasses
2 values
rating
int64
0
3.4k
tags
listlengths
0
7
title
stringclasses
393 values
time-limit
stringclasses
7 values
memory-limit
stringclasses
6 values
problem-description
stringlengths
0
2.97k
input-specification
stringlengths
4
1.87k
output-specification
stringlengths
4
1.12k
demo-input
listlengths
0
7
demo-output
listlengths
0
7
note
stringlengths
0
5.24k
points
float64
0
3.5k
test_cases
listlengths
0
402
creationTimeSeconds
int64
1.37B
1.7B
relativeTimeSeconds
int64
8
2.15B
programmingLanguage
stringclasses
3 values
verdict
stringclasses
1 value
testset
stringclasses
9 values
passedTestCount
int64
1
402
timeConsumedMillis
int64
15
8.06k
memoryConsumedBytes
int64
0
514M
code
stringlengths
11
61.4k
prompt
stringlengths
297
7.35k
response
stringlengths
25
61.4k
score
float64
2.82
3.99
50
A
Domino piling
PROGRAMMING
800
[ "greedy", "math" ]
A. Domino piling
2
256
You are given a rectangular board of *M*<=Γ—<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=Γ—<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions.
In a single line you are given two integers *M* and *N* β€” board sizes in squares (1<=≀<=*M*<=≀<=*N*<=≀<=16).
Output one number β€” the maximal number of dominoes, which can be placed.
[ "2 4\n", "3 3\n" ]
[ "4\n", "4\n" ]
none
500
[ { "input": "2 4", "output": "4" }, { "input": "3 3", "output": "4" }, { "input": "1 5", "output": "2" }, { "input": "1 6", "output": "3" }, { "input": "1 15", "output": "7" }, { "input": "1 16", "output": "8" }, { "input": "2 5", "output": "5" }, { "input": "2 6", "output": "6" }, { "input": "2 7", "output": "7" }, { "input": "2 14", "output": "14" }, { "input": "2 15", "output": "15" }, { "input": "1 4", "output": "2" }, { "input": "2 16", "output": "16" }, { "input": "3 5", "output": "7" }, { "input": "3 6", "output": "9" }, { "input": "3 10", "output": "15" }, { "input": "3 14", "output": "21" }, { "input": "3 15", "output": "22" }, { "input": "3 16", "output": "24" }, { "input": "5 7", "output": "17" }, { "input": "16 16", "output": "128" }, { "input": "15 16", "output": "120" }, { "input": "2 3", "output": "3" }, { "input": "15 15", "output": "112" }, { "input": "14 16", "output": "112" }, { "input": "11 13", "output": "71" }, { "input": "5 16", "output": "40" }, { "input": "8 15", "output": "60" }, { "input": "2 2", "output": "2" }, { "input": "3 4", "output": "6" }, { "input": "4 4", "output": "8" }, { "input": "1 1", "output": "0" }, { "input": "1 2", "output": "1" }, { "input": "1 3", "output": "1" }, { "input": "14 15", "output": "105" } ]
1,680,062,742
2,147,483,647
Python 3
OK
TESTS
35
92
0
m, n = map(int, input().split()) ans = (m * n) // 2 print(ans)
Title: Domino piling Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: You are given a rectangular board of *M*<=Γ—<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=Γ—<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions. Input Specification: In a single line you are given two integers *M* and *N* β€” board sizes in squares (1<=≀<=*M*<=≀<=*N*<=≀<=16). Output Specification: Output one number β€” the maximal number of dominoes, which can be placed. Demo Input: ['2 4\n', '3 3\n'] Demo Output: ['4\n', '4\n'] Note: none
```python m, n = map(int, input().split()) ans = (m * n) // 2 print(ans) ```
3.977
629
A
Far Relative’s Birthday Cake
PROGRAMMING
800
[ "brute force", "combinatorics", "constructive algorithms", "implementation" ]
null
null
Door's family is going celebrate Famil Doors's birthday party. They love Famil Door so they are planning to make his birthday cake weird! The cake is a *n*<=Γ—<=*n* square consisting of equal squares with side length 1. Each square is either empty or consists of a single chocolate. They bought the cake and randomly started to put the chocolates on the cake. The value of Famil Door's happiness will be equal to the number of pairs of cells with chocolates that are in the same row or in the same column of the cake. Famil Doors's family is wondering what is the amount of happiness of Famil going to be? Please, note that any pair can be counted no more than once, as two different cells can't share both the same row and the same column.
In the first line of the input, you are given a single integer *n* (1<=≀<=*n*<=≀<=100)Β β€” the length of the side of the cake. Then follow *n* lines, each containing *n* characters. Empty cells are denoted with '.', while cells that contain chocolates are denoted by 'C'.
Print the value of Famil Door's happiness, i.e. the number of pairs of chocolate pieces that share the same row or the same column.
[ "3\n.CC\nC..\nC.C\n", "4\nCC..\nC..C\n.CC.\n.CC.\n" ]
[ "4\n", "9\n" ]
If we number rows from top to bottom and columns from left to right, then, pieces that share the same row in the first sample are: 1. (1, 2) and (1, 3) 1. (3, 1) and (3, 3) 1. (2, 1) and (3, 1) 1. (1, 3) and (3, 3)
500
[ { "input": "3\n.CC\nC..\nC.C", "output": "4" }, { "input": "4\nCC..\nC..C\n.CC.\n.CC.", "output": "9" }, { "input": "5\n.CCCC\nCCCCC\n.CCC.\nCC...\n.CC.C", "output": "46" }, { "input": "7\n.CC..CC\nCC.C..C\nC.C..C.\nC...C.C\nCCC.CCC\n.CC...C\n.C.CCC.", "output": "84" }, { "input": "8\n..C....C\nC.CCC.CC\n.C..C.CC\nCC......\nC..C..CC\nC.C...C.\nC.C..C..\nC...C.C.", "output": "80" }, { "input": "9\n.C...CCCC\nC.CCCC...\n....C..CC\n.CC.CCC..\n.C.C..CC.\nC...C.CCC\nCCC.C...C\nCCCC....C\n..C..C..C", "output": "144" }, { "input": "10\n..C..C.C..\n..CC..C.CC\n.C.C...C.C\n..C.CC..CC\n....C..C.C\n...C..C..C\nCC.CC....C\n..CCCC.C.C\n..CC.CCC..\nCCCC..C.CC", "output": "190" }, { "input": "11\nC.CC...C.CC\nCC.C....C.C\n.....C..CCC\n....C.CC.CC\nC..C..CC...\nC...C...C..\nCC..CCC.C.C\n..C.CC.C..C\nC...C.C..CC\n.C.C..CC..C\n.C.C.CC.C..", "output": "228" }, { "input": "21\n...CCC.....CC..C..C.C\n..CCC...CC...CC.CCC.C\n....C.C.C..CCC..C.C.C\n....CCC..C..C.CC.CCC.\n...CCC.C..C.C.....CCC\n.CCC.....CCC..C...C.C\nCCCC.C...CCC.C...C.CC\nC..C...C.CCC..CC..C..\nC...CC..C.C.CC..C.CC.\nCC..CCCCCCCCC..C....C\n.C..CCCC.CCCC.CCC...C\nCCC...CCC...CCC.C..C.\n.CCCCCCCC.CCCC.CC.C..\n.C.C..C....C.CCCCCC.C\n...C...C.CCC.C.CC..C.\nCCC...CC..CC...C..C.C\n.CCCCC...C.C..C.CC.C.\n..CCC.C.C..CCC.CCC...\n..C..C.C.C.....CC.C..\n.CC.C...C.CCC.C....CC\n...C..CCCC.CCC....C..", "output": "2103" }, { "input": "20\nC.C.CCC.C....C.CCCCC\nC.CC.C..CCC....CCCC.\n.CCC.CC...CC.CCCCCC.\n.C...CCCC..C....CCC.\n.C..CCCCCCC.C.C.....\nC....C.C..CCC.C..CCC\n...C.C.CC..CC..CC...\nC...CC.C.CCCCC....CC\n.CC.C.CCC....C.CCC.C\nCC...CC...CC..CC...C\nC.C..CC.C.CCCC.C.CC.\n..CCCCC.C.CCC..CCCC.\n....C..C..C.CC...C.C\nC..CCC..CC..C.CC..CC\n...CC......C.C..C.C.\nCC.CCCCC.CC.CC...C.C\n.C.CC..CC..CCC.C.CCC\nC..C.CC....C....C...\n..CCC..CCC...CC..C.C\n.C.CCC.CCCCCCCCC..CC", "output": "2071" }, { "input": "17\nCCC..C.C....C.C.C\n.C.CC.CC...CC..C.\n.CCCC.CC.C..CCC.C\n...CCC.CC.CCC.C.C\nCCCCCCCC..C.CC.CC\n...C..C....C.CC.C\nCC....CCC...C.CC.\n.CC.C.CC..C......\n.CCCCC.C.CC.CCCCC\n..CCCC...C..CC..C\nC.CC.C.CC..C.C.C.\nC..C..C..CCC.C...\n.C..CCCC..C......\n.CC.C...C..CC.CC.\nC..C....CC...CC..\nC.CC.CC..C.C..C..\nCCCC...C.C..CCCC.", "output": "1160" }, { "input": "15\nCCCC.C..CCC....\nCCCCCC.CC.....C\n...C.CC.C.C.CC.\nCCCCCCC..C..C..\nC..CCC..C.CCCC.\n.CC..C.C.C.CC.C\n.C.C..C..C.C..C\n...C...C..CCCC.\n.....C.C..CC...\nCC.C.C..CC.C..C\n..CCCCC..CCC...\nCC.CC.C..CC.CCC\n..CCC...CC.C..C\nCC..C.C..CCC..C\n.C.C....CCC...C", "output": "789" }, { "input": "1\n.", "output": "0" }, { "input": "3\n.CC\nC..\nC.C", "output": "4" }, { "input": "13\nC.C...C.C.C..\nCC.CCCC.CC..C\n.C.CCCCC.CC..\nCCCC..C...C..\n...CC.C.C...C\n.CC.CCC...CC.\nCC.CCCCCC....\n.C...C..CC..C\nCCCC.CC...C..\n.C.CCC..C.CC.\n..C...CC..C.C\n..C.CCC..CC.C\n.C...CCC.CC.C", "output": "529" }, { "input": "16\n.C.C.C.C.C...C.C\n..C..C.CCCCCC...\n..C.C.C.C..C..C.\n.CC....C.CCC..C.\n.C.CCC..C....CCC\nCC..C.CC..C.C.CC\n...C..C..CC..CC.\n.CCC..C.CC.C.C..\n.CC.C..........C\nC...C....CC..C..\nC.CCC.C..C..C...\n.CCCCCCCCCCCC..C\n..C.C.CC.CC.CCC.\nCC..C.C....C..CC\nC.CCC..C..C.C.CC\n.C.CCC.CC..CCC.C", "output": "874" }, { "input": "2\nCC\nCC", "output": "4" }, { "input": "3\nC..\nC..\nC..", "output": "3" } ]
1,616,065,395
2,147,483,647
Python 3
OK
TESTS
48
171
307,200
n = int(input()) cke=[] for i in range(n): a=[] s = input() for j in range(n): a.append(s[j]) cke.append(a) c=0 for i in range(n): for j in range(n): if cke[i][j]=='C': for k in range(j+1,n): if cke[i][k]=='C': c += 1 for k in range(i+1,n): if cke[k][j]=='C': c += 1 print(c)
Title: Far Relative’s Birthday Cake Time Limit: None seconds Memory Limit: None megabytes Problem Description: Door's family is going celebrate Famil Doors's birthday party. They love Famil Door so they are planning to make his birthday cake weird! The cake is a *n*<=Γ—<=*n* square consisting of equal squares with side length 1. Each square is either empty or consists of a single chocolate. They bought the cake and randomly started to put the chocolates on the cake. The value of Famil Door's happiness will be equal to the number of pairs of cells with chocolates that are in the same row or in the same column of the cake. Famil Doors's family is wondering what is the amount of happiness of Famil going to be? Please, note that any pair can be counted no more than once, as two different cells can't share both the same row and the same column. Input Specification: In the first line of the input, you are given a single integer *n* (1<=≀<=*n*<=≀<=100)Β β€” the length of the side of the cake. Then follow *n* lines, each containing *n* characters. Empty cells are denoted with '.', while cells that contain chocolates are denoted by 'C'. Output Specification: Print the value of Famil Door's happiness, i.e. the number of pairs of chocolate pieces that share the same row or the same column. Demo Input: ['3\n.CC\nC..\nC.C\n', '4\nCC..\nC..C\n.CC.\n.CC.\n'] Demo Output: ['4\n', '9\n'] Note: If we number rows from top to bottom and columns from left to right, then, pieces that share the same row in the first sample are: 1. (1, 2) and (1, 3) 1. (3, 1) and (3, 3) 1. (2, 1) and (3, 1) 1. (1, 3) and (3, 3)
```python n = int(input()) cke=[] for i in range(n): a=[] s = input() for j in range(n): a.append(s[j]) cke.append(a) c=0 for i in range(n): for j in range(n): if cke[i][j]=='C': for k in range(j+1,n): if cke[i][k]=='C': c += 1 for k in range(i+1,n): if cke[k][j]=='C': c += 1 print(c) ```
3
69
A
Young Physicist
PROGRAMMING
1,000
[ "implementation", "math" ]
A. Young Physicist
2
256
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" β€” thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
The first line contains a positive integer *n* (1<=≀<=*n*<=≀<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≀<=*x**i*,<=*y**i*,<=*z**i*<=≀<=100).
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
[ "3\n4 1 7\n-2 4 -1\n1 -5 -3\n", "3\n3 -1 7\n-5 2 -4\n2 -1 -3\n" ]
[ "NO", "YES" ]
none
500
[ { "input": "3\n4 1 7\n-2 4 -1\n1 -5 -3", "output": "NO" }, { "input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3", "output": "YES" }, { "input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41", "output": "NO" }, { "input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33", "output": "NO" }, { "input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7", "output": "NO" }, { "input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38", "output": "NO" }, { "input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6", "output": "YES" }, { "input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0", "output": "YES" }, { "input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0", "output": "YES" }, { "input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0", "output": "YES" }, { "input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0", "output": "YES" }, { "input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0", "output": "YES" }, { "input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87", "output": "YES" }, { "input": "3\n1 2 3\n3 2 1\n0 0 0", "output": "NO" }, { "input": "2\n5 -23 12\n0 0 0", "output": "NO" }, { "input": "1\n0 0 0", "output": "YES" }, { "input": "1\n1 -2 0", "output": "NO" }, { "input": "2\n-23 77 -86\n23 -77 86", "output": "YES" }, { "input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82", "output": "YES" }, { "input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0", "output": "YES" }, { "input": "3\n96 49 -12\n2 -66 28\n-98 17 -16", "output": "YES" }, { "input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0", "output": "YES" }, { "input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53", "output": "YES" }, { "input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1", "output": "YES" }, { "input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0", "output": "YES" }, { "input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0", "output": "YES" }, { "input": "3\n0 2 -2\n1 -1 3\n-3 0 0", "output": "NO" } ]
1,665,042,179
2,147,483,647
Python 3
OK
TESTS
81
124
409,600
from re import X n = int(input()) forces = [0, 0, 0] for i in range(n): [x, y, z] = [int(_) for _ in input().split()] forces[0] += x forces[1] += y forces[2] += z if forces[0] or forces[1] or forces[2]: print('NO') else: print('YES')
Title: Young Physicist Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" β€” thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. Input Specification: The first line contains a positive integer *n* (1<=≀<=*n*<=≀<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≀<=*x**i*,<=*y**i*,<=*z**i*<=≀<=100). Output Specification: Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. Demo Input: ['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n'] Demo Output: ['NO', 'YES'] Note: none
```python from re import X n = int(input()) forces = [0, 0, 0] for i in range(n): [x, y, z] = [int(_) for _ in input().split()] forces[0] += x forces[1] += y forces[2] += z if forces[0] or forces[1] or forces[2]: print('NO') else: print('YES') ```
3.968237
58
A
Chat room
PROGRAMMING
1,000
[ "greedy", "strings" ]
A. Chat room
1
256
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
If Vasya managed to say hello, print "YES", otherwise print "NO".
[ "ahhellllloou\n", "hlelo\n" ]
[ "YES\n", "NO\n" ]
none
500
[ { "input": "ahhellllloou", "output": "YES" }, { "input": "hlelo", "output": "NO" }, { "input": "helhcludoo", "output": "YES" }, { "input": "hehwelloho", "output": "YES" }, { "input": "pnnepelqomhhheollvlo", "output": "YES" }, { "input": "tymbzjyqhymedasloqbq", "output": "NO" }, { "input": "yehluhlkwo", "output": "NO" }, { "input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello", "output": "YES" }, { "input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq", "output": "YES" }, { "input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi", "output": "YES" }, { "input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo", "output": "YES" }, { "input": "lqllcolohwflhfhlnaow", "output": "NO" }, { "input": "heheeellollvoo", "output": "YES" }, { "input": "hellooo", "output": "YES" }, { "input": "o", "output": "NO" }, { "input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv", "output": "YES" }, { "input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk", "output": "YES" }, { "input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry", "output": "NO" }, { "input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq", "output": "NO" }, { "input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi", "output": "YES" }, { "input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm", "output": "YES" }, { "input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac", "output": "NO" }, { "input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok", "output": "YES" }, { "input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz", "output": "YES" }, { "input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb", "output": "YES" }, { "input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla", "output": "YES" }, { "input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz", "output": "YES" }, { "input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti", "output": "YES" }, { "input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli", "output": "YES" }, { "input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo", "output": "YES" }, { "input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk", "output": "NO" }, { "input": "loee", "output": "NO" }, { "input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo", "output": "NO" }, { "input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi", "output": "YES" }, { "input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv", "output": "NO" }, { "input": "hello", "output": "YES" }, { "input": "oohell", "output": "NO" }, { "input": "hell", "output": "NO" }, { "input": "eloellohoelo", "output": "NO" }, { "input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo", "output": "YES" } ]
1,688,398,008
2,147,483,647
Python 3
OK
TESTS
40
46
0
str=input() i,j=0,0 s="hello" while(i<len(str) and j<5): if(str[i]==s[j] ): i=i+1 j=j+1 else: i=i+1 if(j==5): print("YES") else: print("NO") i=i+1 # -*- coding: latin-1 -*-j=j+1
Title: Chat room Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*. Input Specification: The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters. Output Specification: If Vasya managed to say hello, print "YES", otherwise print "NO". Demo Input: ['ahhellllloou\n', 'hlelo\n'] Demo Output: ['YES\n', 'NO\n'] Note: none
```python str=input() i,j=0,0 s="hello" while(i<len(str) and j<5): if(str[i]==s[j] ): i=i+1 j=j+1 else: i=i+1 if(j==5): print("YES") else: print("NO") i=i+1 # -*- coding: latin-1 -*-j=j+1 ```
3.977
686
A
Free Ice Cream
PROGRAMMING
800
[ "constructive algorithms", "implementation" ]
null
null
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer. At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue). If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress. Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
The first line contains two space-separated integers *n* and *x* (1<=≀<=*n*<=≀<=1000, 0<=≀<=*x*<=≀<=109). Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≀<=*d**i*<=≀<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
Print two space-separated integersΒ β€” number of ice cream packs left after all operations, and number of kids that left the house in distress.
[ "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n", "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n" ]
[ "22 1\n", "3 2\n" ]
Consider the first sample. 1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
500
[ { "input": "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20", "output": "22 1" }, { "input": "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98", "output": "3 2" }, { "input": "6 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000", "output": "7000000000 0" }, { "input": "5 12\n- 12\n+ 7\n- 6\n- 1\n+ 46", "output": "46 0" }, { "input": "11 1000\n- 100\n+ 100\n+ 100\n+ 100\n+ 100\n- 100\n- 100\n- 100\n- 100\n- 100\n- 100", "output": "700 0" }, { "input": "1 0\n- 526403222", "output": "0 1" }, { "input": "1 897986543\n- 371188251", "output": "526798292 0" }, { "input": "1 0\n+ 1", "output": "1 0" }, { "input": "1 0\n- 1", "output": "0 1" }, { "input": "1 10\n+ 10", "output": "20 0" }, { "input": "1 3\n- 5", "output": "3 1" }, { "input": "1 0\n- 5", "output": "0 1" }, { "input": "1 0\n+ 5", "output": "5 0" } ]
1,603,031,369
2,147,483,647
Python 3
OK
TESTS
34
109
0
n, x = list(map(int, input().split(" "))) b = 0 for i in range(n): s = input().split(" ") if s[0] == "+": x += int(s[1]) else: if x < int(s[1]): b+=1 else: x -= int(s[1]) print(x, b)
Title: Free Ice Cream Time Limit: None seconds Memory Limit: None megabytes Problem Description: After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer. At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue). If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress. Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids. Input Specification: The first line contains two space-separated integers *n* and *x* (1<=≀<=*n*<=≀<=1000, 0<=≀<=*x*<=≀<=109). Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≀<=*d**i*<=≀<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place. Output Specification: Print two space-separated integersΒ β€” number of ice cream packs left after all operations, and number of kids that left the house in distress. Demo Input: ['5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n', '5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n'] Demo Output: ['22 1\n', '3 2\n'] Note: Consider the first sample. 1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining.
```python n, x = list(map(int, input().split(" "))) b = 0 for i in range(n): s = input().split(" ") if s[0] == "+": x += int(s[1]) else: if x < int(s[1]): b+=1 else: x -= int(s[1]) print(x, b) ```
3
3
A
Shortest path of the king
PROGRAMMING
1,000
[ "greedy", "shortest paths" ]
A. Shortest path of the king
1
64
The king is left alone on the chessboard. In spite of this loneliness, he doesn't lose heart, because he has business of national importance. For example, he has to pay an official visit to square *t*. As the king is not in habit of wasting his time, he wants to get from his current position *s* to square *t* in the least number of moves. Help him to do this. In one move the king can get to the square that has a common side or a common vertex with the square the king is currently in (generally there are 8 different squares he can move to).
The first line contains the chessboard coordinates of square *s*, the second line β€” of square *t*. Chessboard coordinates consist of two characters, the first one is a lowercase Latin letter (from a to h), the second one is a digit from 1 to 8.
In the first line print *n* β€” minimum number of the king's moves. Then in *n* lines print the moves themselves. Each move is described with one of the 8: L, R, U, D, LU, LD, RU or RD. L, R, U, D stand respectively for moves left, right, up and down (according to the picture), and 2-letter combinations stand for diagonal moves. If the answer is not unique, print any of them.
[ "a8\nh1\n" ]
[ "7\nRD\nRD\nRD\nRD\nRD\nRD\nRD\n" ]
none
0
[ { "input": "a8\nh1", "output": "7\nRD\nRD\nRD\nRD\nRD\nRD\nRD" }, { "input": "b2\nb4", "output": "2\nU\nU" }, { "input": "a5\na5", "output": "0" }, { "input": "h1\nb2", "output": "6\nLU\nL\nL\nL\nL\nL" }, { "input": "c5\nh2", "output": "5\nRD\nRD\nRD\nR\nR" }, { "input": "e1\nf2", "output": "1\nRU" }, { "input": "g4\nd2", "output": "3\nLD\nLD\nL" }, { "input": "a8\nb2", "output": "6\nRD\nD\nD\nD\nD\nD" }, { "input": "d4\nh2", "output": "4\nRD\nRD\nR\nR" }, { "input": "c5\na2", "output": "3\nLD\nLD\nD" }, { "input": "h5\nf8", "output": "3\nLU\nLU\nU" }, { "input": "e6\nb6", "output": "3\nL\nL\nL" }, { "input": "a6\ng4", "output": "6\nRD\nRD\nR\nR\nR\nR" }, { "input": "f7\nc2", "output": "5\nLD\nLD\nLD\nD\nD" }, { "input": "b7\nh8", "output": "6\nRU\nR\nR\nR\nR\nR" }, { "input": "g7\nd6", "output": "3\nLD\nL\nL" }, { "input": "c8\na3", "output": "5\nLD\nLD\nD\nD\nD" }, { "input": "h8\nf1", "output": "7\nLD\nLD\nD\nD\nD\nD\nD" }, { "input": "d1\nb7", "output": "6\nLU\nLU\nU\nU\nU\nU" }, { "input": "a7\ne5", "output": "4\nRD\nRD\nR\nR" }, { "input": "d6\nb1", "output": "5\nLD\nLD\nD\nD\nD" }, { "input": "f5\ng5", "output": "1\nR" }, { "input": "h4\nd1", "output": "4\nLD\nLD\nLD\nL" }, { "input": "b3\na5", "output": "2\nLU\nU" }, { "input": "d2\nf1", "output": "2\nRD\nR" }, { "input": "f1\nc5", "output": "4\nLU\nLU\nLU\nU" }, { "input": "a8\nh1", "output": "7\nRD\nRD\nRD\nRD\nRD\nRD\nRD" }, { "input": "c7\ne5", "output": "2\nRD\nRD" }, { "input": "e7\nb1", "output": "6\nLD\nLD\nLD\nD\nD\nD" }, { "input": "g8\na8", "output": "6\nL\nL\nL\nL\nL\nL" }, { "input": "g6\nf2", "output": "4\nLD\nD\nD\nD" }, { "input": "g4\nc4", "output": "4\nL\nL\nL\nL" }, { "input": "g2\na6", "output": "6\nLU\nLU\nLU\nLU\nL\nL" }, { "input": "f8\nf8", "output": "0" }, { "input": "f5\nd2", "output": "3\nLD\nLD\nD" } ]
1,698,522,413
2,147,483,647
PyPy 3-64
OK
TESTS
35
124
0
a = input() b = input() a = [a[0], int(a[1])] b = [b[0], int(b[1])] points = ['a', 'b', 'c', 'd', 'e', 'f', 'g', 'h'] b[0] = points.index(b[0]) + 1 a[0] = points.index(a[0]) + 1 print(max(abs(a[0] - b[0]), abs(a[1] - b[1]))) while a[0] != b[0] or a[1] != b[1]: if a[0] < b[0]: print('R', end='') a[0] += 1 elif a[0] > b[0]: print('L', end='') a[0] -= 1 if a[1] < b[1]: print('U', end='') a[1] += 1 elif a[1] > b[1]: print('D', end='') a[1] -= 1 print()
Title: Shortest path of the king Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: The king is left alone on the chessboard. In spite of this loneliness, he doesn't lose heart, because he has business of national importance. For example, he has to pay an official visit to square *t*. As the king is not in habit of wasting his time, he wants to get from his current position *s* to square *t* in the least number of moves. Help him to do this. In one move the king can get to the square that has a common side or a common vertex with the square the king is currently in (generally there are 8 different squares he can move to). Input Specification: The first line contains the chessboard coordinates of square *s*, the second line β€” of square *t*. Chessboard coordinates consist of two characters, the first one is a lowercase Latin letter (from a to h), the second one is a digit from 1 to 8. Output Specification: In the first line print *n* β€” minimum number of the king's moves. Then in *n* lines print the moves themselves. Each move is described with one of the 8: L, R, U, D, LU, LD, RU or RD. L, R, U, D stand respectively for moves left, right, up and down (according to the picture), and 2-letter combinations stand for diagonal moves. If the answer is not unique, print any of them. Demo Input: ['a8\nh1\n'] Demo Output: ['7\nRD\nRD\nRD\nRD\nRD\nRD\nRD\n'] Note: none
```python a = input() b = input() a = [a[0], int(a[1])] b = [b[0], int(b[1])] points = ['a', 'b', 'c', 'd', 'e', 'f', 'g', 'h'] b[0] = points.index(b[0]) + 1 a[0] = points.index(a[0]) + 1 print(max(abs(a[0] - b[0]), abs(a[1] - b[1]))) while a[0] != b[0] or a[1] != b[1]: if a[0] < b[0]: print('R', end='') a[0] += 1 elif a[0] > b[0]: print('L', end='') a[0] -= 1 if a[1] < b[1]: print('U', end='') a[1] += 1 elif a[1] > b[1]: print('D', end='') a[1] -= 1 print() ```
3.938
385
A
Bear and Raspberry
PROGRAMMING
1,000
[ "brute force", "greedy", "implementation" ]
null
null
The bear decided to store some raspberry for the winter. He cunningly found out the price for a barrel of honey in kilos of raspberry for each of the following *n* days. According to the bear's data, on the *i*-th (1<=≀<=*i*<=≀<=*n*) day, the price for one barrel of honey is going to is *x**i* kilos of raspberry. Unfortunately, the bear has neither a honey barrel, nor the raspberry. At the same time, the bear's got a friend who is ready to lend him a barrel of honey for exactly one day for *c* kilograms of raspberry. That's why the bear came up with a smart plan. He wants to choose some day *d* (1<=≀<=*d*<=&lt;<=*n*), lent a barrel of honey and immediately (on day *d*) sell it according to a daily exchange rate. The next day (*d*<=+<=1) the bear wants to buy a new barrel of honey according to a daily exchange rate (as he's got some raspberry left from selling the previous barrel) and immediately (on day *d*<=+<=1) give his friend the borrowed barrel of honey as well as *c* kilograms of raspberry for renting the barrel. The bear wants to execute his plan at most once and then hibernate. What maximum number of kilograms of raspberry can he earn? Note that if at some point of the plan the bear runs out of the raspberry, then he won't execute such a plan.
The first line contains two space-separated integers, *n* and *c* (2<=≀<=*n*<=≀<=100,<=0<=≀<=*c*<=≀<=100), β€” the number of days and the number of kilos of raspberry that the bear should give for borrowing the barrel. The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≀<=*x**i*<=≀<=100), the price of a honey barrel on day *i*.
Print a single integer β€” the answer to the problem.
[ "5 1\n5 10 7 3 20\n", "6 2\n100 1 10 40 10 40\n", "3 0\n1 2 3\n" ]
[ "3\n", "97\n", "0\n" ]
In the first sample the bear will lend a honey barrel at day 3 and then sell it for 7. Then the bear will buy a barrel for 3 and return it to the friend. So, the profit is (7 - 3 - 1) = 3. In the second sample bear will lend a honey barrel at day 1 and then sell it for 100. Then the bear buy the barrel for 1 at the day 2. So, the profit is (100 - 1 - 2) = 97.
500
[ { "input": "5 1\n5 10 7 3 20", "output": "3" }, { "input": "6 2\n100 1 10 40 10 40", "output": "97" }, { "input": "3 0\n1 2 3", "output": "0" }, { "input": "2 0\n2 1", "output": "1" }, { "input": "10 5\n10 1 11 2 12 3 13 4 14 5", "output": "4" }, { "input": "100 4\n2 57 70 8 44 10 88 67 50 44 93 79 72 50 69 19 21 9 71 47 95 13 46 10 68 72 54 40 15 83 57 92 58 25 4 22 84 9 8 55 87 0 16 46 86 58 5 21 32 28 10 46 11 29 13 33 37 34 78 33 33 21 46 70 77 51 45 97 6 21 68 61 87 54 8 91 37 12 76 61 57 9 100 45 44 88 5 71 98 98 26 45 37 87 34 50 33 60 64 77", "output": "87" }, { "input": "100 5\n15 91 86 53 18 52 26 89 8 4 5 100 11 64 88 91 35 57 67 72 71 71 69 73 97 23 11 1 59 86 37 82 6 67 71 11 7 31 11 68 21 43 89 54 27 10 3 33 8 57 79 26 90 81 6 28 24 7 33 50 24 13 27 85 4 93 14 62 37 67 33 40 7 48 41 4 14 9 95 10 64 62 7 93 23 6 28 27 97 64 26 83 70 0 97 74 11 82 70 93", "output": "84" }, { "input": "6 100\n10 9 8 7 6 5", "output": "0" }, { "input": "100 9\n66 71 37 41 23 38 77 11 74 13 51 26 93 56 81 17 12 70 85 37 54 100 14 99 12 83 44 16 99 65 13 48 92 32 69 33 100 57 58 88 25 45 44 85 5 41 82 15 37 18 21 45 3 68 33 9 52 64 8 73 32 41 87 99 26 26 47 24 79 93 9 44 11 34 85 26 14 61 49 38 25 65 49 81 29 82 28 23 2 64 38 13 77 68 67 23 58 57 83 46", "output": "78" }, { "input": "100 100\n9 72 46 37 26 94 80 1 43 85 26 53 58 18 24 19 67 2 100 52 61 81 48 15 73 41 97 93 45 1 73 54 75 51 28 79 0 14 41 42 24 50 70 18 96 100 67 1 68 48 44 39 63 77 78 18 10 51 32 53 26 60 1 13 66 39 55 27 23 71 75 0 27 88 73 31 16 95 87 84 86 71 37 40 66 70 65 83 19 4 81 99 26 51 67 63 80 54 23 44", "output": "0" }, { "input": "43 65\n32 58 59 75 85 18 57 100 69 0 36 38 79 95 82 47 7 55 28 88 27 88 63 71 80 86 67 53 69 37 99 54 81 19 55 12 2 17 84 77 25 26 62", "output": "4" }, { "input": "12 64\n14 87 40 24 32 36 4 41 38 77 68 71", "output": "0" }, { "input": "75 94\n80 92 25 48 78 17 69 52 79 73 12 15 59 55 25 61 96 27 98 43 30 43 36 94 67 54 86 99 100 61 65 8 65 19 18 21 75 31 2 98 55 87 14 1 17 97 94 11 57 29 34 71 76 67 45 0 78 29 86 82 29 23 77 100 48 43 65 62 88 34 7 28 13 1 1", "output": "0" }, { "input": "59 27\n76 61 24 66 48 18 69 84 21 8 64 90 19 71 36 90 9 36 30 37 99 37 100 56 9 79 55 37 54 63 11 11 49 71 91 70 14 100 10 44 52 23 21 19 96 13 93 66 52 79 76 5 62 6 90 35 94 7 27", "output": "63" }, { "input": "86 54\n41 84 16 5 20 79 73 13 23 24 42 73 70 80 69 71 33 44 62 29 86 88 40 64 61 55 58 19 16 23 84 100 38 91 89 98 47 50 55 87 12 94 2 12 0 1 4 26 50 96 68 34 94 80 8 22 60 3 72 84 65 89 44 52 50 9 24 34 81 28 56 17 38 85 78 90 62 60 1 40 91 2 7 41 84 22", "output": "38" }, { "input": "37 2\n65 36 92 92 92 76 63 56 15 95 75 26 15 4 73 50 41 92 26 20 19 100 63 55 25 75 61 96 35 0 14 6 96 3 28 41 83", "output": "91" }, { "input": "19 4\n85 2 56 70 33 75 89 60 100 81 42 28 18 92 29 96 49 23 14", "output": "79" }, { "input": "89 1\n50 53 97 41 68 27 53 66 93 19 11 78 46 49 38 69 96 9 43 16 1 63 95 64 96 6 34 34 45 40 19 4 53 8 11 18 95 25 50 16 64 33 97 49 23 81 63 10 30 73 76 55 7 70 9 98 6 36 75 78 3 92 85 75 40 75 55 71 9 91 15 17 47 55 44 35 55 88 53 87 61 22 100 56 14 87 36 84 24", "output": "91" }, { "input": "67 0\n40 48 15 46 90 7 65 52 24 15 42 81 2 6 71 94 32 18 97 67 83 98 48 51 10 47 8 68 36 46 65 75 90 30 62 9 5 35 80 60 69 58 62 68 58 73 80 9 22 46 56 64 44 11 93 73 62 54 15 20 17 69 16 33 85 62 49", "output": "83" }, { "input": "96 0\n38 97 82 43 80 40 1 99 50 94 81 63 92 13 57 24 4 10 25 32 79 56 96 19 25 14 69 56 66 22 23 78 87 76 37 30 75 77 61 64 35 64 62 32 44 62 6 84 91 44 99 5 71 19 17 12 35 52 1 14 35 18 8 36 54 42 4 67 80 11 88 44 34 35 12 38 66 42 4 90 45 10 1 44 37 96 23 28 100 90 75 17 27 67 51 70", "output": "94" }, { "input": "14 14\n87 63 62 31 59 47 40 89 92 43 80 30 99 42", "output": "43" }, { "input": "12 0\n100 1 100 2 100 3 100 4 100 5 100 0", "output": "100" }, { "input": "3 1\n1 2 3", "output": "0" }, { "input": "3 2\n3 3 3", "output": "0" }, { "input": "3 3\n3 2 1", "output": "0" }, { "input": "3 100\n1 2 3", "output": "0" }, { "input": "2 100\n0 0", "output": "0" }, { "input": "2 90\n10 5", "output": "0" }, { "input": "2 5\n5 4", "output": "0" }, { "input": "3 1\n19 20 1", "output": "18" }, { "input": "5 1\n5 10 7 4 20", "output": "2" }, { "input": "5 1\n1 2 3 4 5", "output": "0" } ]
1,621,752,327
2,147,483,647
Python 3
OK
TESTS
32
62
0
n, c = map(int, input().split()) price = list(map(int, input().split())) p = price[0]-price[1]-c for i in range(1,n-1): p = max(price[i]-price[i+1]-c, p) if p<0: print('0') else: print(p)
Title: Bear and Raspberry Time Limit: None seconds Memory Limit: None megabytes Problem Description: The bear decided to store some raspberry for the winter. He cunningly found out the price for a barrel of honey in kilos of raspberry for each of the following *n* days. According to the bear's data, on the *i*-th (1<=≀<=*i*<=≀<=*n*) day, the price for one barrel of honey is going to is *x**i* kilos of raspberry. Unfortunately, the bear has neither a honey barrel, nor the raspberry. At the same time, the bear's got a friend who is ready to lend him a barrel of honey for exactly one day for *c* kilograms of raspberry. That's why the bear came up with a smart plan. He wants to choose some day *d* (1<=≀<=*d*<=&lt;<=*n*), lent a barrel of honey and immediately (on day *d*) sell it according to a daily exchange rate. The next day (*d*<=+<=1) the bear wants to buy a new barrel of honey according to a daily exchange rate (as he's got some raspberry left from selling the previous barrel) and immediately (on day *d*<=+<=1) give his friend the borrowed barrel of honey as well as *c* kilograms of raspberry for renting the barrel. The bear wants to execute his plan at most once and then hibernate. What maximum number of kilograms of raspberry can he earn? Note that if at some point of the plan the bear runs out of the raspberry, then he won't execute such a plan. Input Specification: The first line contains two space-separated integers, *n* and *c* (2<=≀<=*n*<=≀<=100,<=0<=≀<=*c*<=≀<=100), β€” the number of days and the number of kilos of raspberry that the bear should give for borrowing the barrel. The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≀<=*x**i*<=≀<=100), the price of a honey barrel on day *i*. Output Specification: Print a single integer β€” the answer to the problem. Demo Input: ['5 1\n5 10 7 3 20\n', '6 2\n100 1 10 40 10 40\n', '3 0\n1 2 3\n'] Demo Output: ['3\n', '97\n', '0\n'] Note: In the first sample the bear will lend a honey barrel at day 3 and then sell it for 7. Then the bear will buy a barrel for 3 and return it to the friend. So, the profit is (7 - 3 - 1) = 3. In the second sample bear will lend a honey barrel at day 1 and then sell it for 100. Then the bear buy the barrel for 1 at the day 2. So, the profit is (100 - 1 - 2) = 97.
```python n, c = map(int, input().split()) price = list(map(int, input().split())) p = price[0]-price[1]-c for i in range(1,n-1): p = max(price[i]-price[i+1]-c, p) if p<0: print('0') else: print(p) ```
3
707
A
Brain's Photos
PROGRAMMING
800
[ "implementation" ]
null
null
Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead. As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such). Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour! As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white. Photo can be represented as a matrix sized *n*<=Γ—<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors: - 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black) The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored.
The first line of the input contains two integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=100)Β β€” the number of photo pixel matrix rows and columns respectively. Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'.
Print the "#Black&amp;White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line.
[ "2 2\nC M\nY Y\n", "3 2\nW W\nW W\nB B\n", "1 1\nW\n" ]
[ "#Color", "#Black&amp;White", "#Black&amp;White" ]
none
500
[ { "input": "2 2\nC M\nY Y", "output": "#Color" }, { "input": "3 2\nW W\nW W\nB B", "output": "#Black&White" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "2 3\nW W W\nB G Y", "output": "#Color" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "5 5\nW G B Y M\nG B Y M C\nB Y M C W\nY M C W G\nM C W G B", "output": "#Color" }, { "input": "1 6\nC M Y W G B", "output": "#Color" }, { "input": "1 3\nW G B", "output": "#Black&White" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "5 5\nW G B W G\nG B W G B\nB W G B W\nW G B W G\nG B W G B", "output": "#Black&White" }, { "input": "2 3\nW W W\nB G C", "output": "#Color" }, { "input": "2 3\nW W W\nB G M", "output": "#Color" }, { "input": "3 3\nC B W\nB Y M\nB B W", "output": "#Color" }, { "input": "1 3\nW C W", "output": "#Color" }, { "input": "3 3\nB W B\nB C W\nB W W", "output": "#Color" }, { "input": "1 2\nW Y", "output": "#Color" }, { "input": "1 1\nG", "output": "#Black&White" }, { "input": "1 3\nB G W", "output": "#Black&White" }, { "input": "2 2\nW W\nB C", "output": "#Color" }, { "input": "1 1\nM", "output": "#Color" }, { "input": "1 2\nW C", "output": "#Color" }, { "input": "2 3\nW W M\nW W M", "output": "#Color" }, { "input": "3 2\nW W\nW W\nB C", "output": "#Color" }, { "input": "2 3\nW W C\nW W W", "output": "#Color" }, { "input": "1 3\nG G G", "output": "#Black&White" }, { "input": "1 1\nC", "output": "#Color" }, { "input": "1 2\nC W", "output": "#Color" }, { "input": "1 3\nW W C", "output": "#Color" }, { "input": "2 2\nW B\nB G", "output": "#Black&White" }, { "input": "2 2\nB B\nY Y", "output": "#Color" }, { "input": "2 2\nG G\nC C", "output": "#Color" }, { "input": "1 2\nB C", "output": "#Color" }, { "input": "1 4\nG G G C", "output": "#Color" }, { "input": "1 1\nB", "output": "#Black&White" }, { "input": "2 1\nY\nB", "output": "#Color" } ]
1,690,953,693
2,147,483,647
PyPy 3-64
OK
TESTS
50
62
1,638,400
M,N = map(int,input().split()) def COLOR(M): Flag = False for _ in range(M): X = list(input().split()) for i in X: if i == 'C' or i == 'M' or i == 'Y': Flag = True return "#Black&White" if Flag==False else "#Color" print(COLOR(M))
Title: Brain's Photos Time Limit: None seconds Memory Limit: None megabytes Problem Description: Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead. As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such). Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour! As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white. Photo can be represented as a matrix sized *n*<=Γ—<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors: - 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black) The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored. Input Specification: The first line of the input contains two integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=100)Β β€” the number of photo pixel matrix rows and columns respectively. Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'. Output Specification: Print the "#Black&amp;White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line. Demo Input: ['2 2\nC M\nY Y\n', '3 2\nW W\nW W\nB B\n', '1 1\nW\n'] Demo Output: ['#Color', '#Black&amp;White', '#Black&amp;White'] Note: none
```python M,N = map(int,input().split()) def COLOR(M): Flag = False for _ in range(M): X = list(input().split()) for i in X: if i == 'C' or i == 'M' or i == 'Y': Flag = True return "#Black&White" if Flag==False else "#Color" print(COLOR(M)) ```
3
467
A
George and Accommodation
PROGRAMMING
800
[ "implementation" ]
null
null
George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory. George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≀<=*q**i*). Your task is to count how many rooms has free place for both George and Alex.
The first line contains a single integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of rooms. The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≀<=*p**i*<=≀<=*q**i*<=≀<=100) β€” the number of people who already live in the *i*-th room and the room's capacity.
Print a single integer β€” the number of rooms where George and Alex can move in.
[ "3\n1 1\n2 2\n3 3\n", "3\n1 10\n0 10\n10 10\n" ]
[ "0\n", "2\n" ]
none
500
[ { "input": "3\n1 1\n2 2\n3 3", "output": "0" }, { "input": "3\n1 10\n0 10\n10 10", "output": "2" }, { "input": "2\n36 67\n61 69", "output": "2" }, { "input": "3\n21 71\n10 88\n43 62", "output": "3" }, { "input": "3\n1 2\n2 3\n3 4", "output": "0" }, { "input": "10\n0 10\n0 20\n0 30\n0 40\n0 50\n0 60\n0 70\n0 80\n0 90\n0 100", "output": "10" }, { "input": "13\n14 16\n30 31\n45 46\n19 20\n15 17\n66 67\n75 76\n95 97\n29 30\n37 38\n0 2\n36 37\n8 9", "output": "4" }, { "input": "19\n66 67\n97 98\n89 91\n67 69\n67 68\n18 20\n72 74\n28 30\n91 92\n27 28\n75 77\n17 18\n74 75\n28 30\n16 18\n90 92\n9 11\n22 24\n52 54", "output": "12" }, { "input": "15\n55 57\n95 97\n57 59\n34 36\n50 52\n96 98\n39 40\n13 15\n13 14\n74 76\n47 48\n56 58\n24 25\n11 13\n67 68", "output": "10" }, { "input": "17\n68 69\n47 48\n30 31\n52 54\n41 43\n33 35\n38 40\n56 58\n45 46\n92 93\n73 74\n61 63\n65 66\n37 39\n67 68\n77 78\n28 30", "output": "8" }, { "input": "14\n64 66\n43 44\n10 12\n76 77\n11 12\n25 27\n87 88\n62 64\n39 41\n58 60\n10 11\n28 29\n57 58\n12 14", "output": "7" }, { "input": "38\n74 76\n52 54\n78 80\n48 49\n40 41\n64 65\n28 30\n6 8\n49 51\n68 70\n44 45\n57 59\n24 25\n46 48\n49 51\n4 6\n63 64\n76 78\n57 59\n18 20\n63 64\n71 73\n88 90\n21 22\n89 90\n65 66\n89 91\n96 98\n42 44\n1 1\n74 76\n72 74\n39 40\n75 76\n29 30\n48 49\n87 89\n27 28", "output": "22" }, { "input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "26\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2", "output": "0" }, { "input": "68\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2", "output": "68" }, { "input": "7\n0 1\n1 5\n2 4\n3 5\n4 6\n5 6\n6 8", "output": "5" }, { "input": "1\n0 0", "output": "0" }, { "input": "1\n100 100", "output": "0" }, { "input": "44\n0 8\n1 11\n2 19\n3 5\n4 29\n5 45\n6 6\n7 40\n8 19\n9 22\n10 18\n11 26\n12 46\n13 13\n14 27\n15 48\n16 25\n17 20\n18 29\n19 27\n20 45\n21 39\n22 29\n23 39\n24 42\n25 37\n26 52\n27 36\n28 43\n29 35\n30 38\n31 70\n32 47\n33 38\n34 61\n35 71\n36 51\n37 71\n38 59\n39 77\n40 70\n41 80\n42 77\n43 73", "output": "42" }, { "input": "3\n1 3\n2 7\n8 9", "output": "2" }, { "input": "53\n0 1\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n18 19\n19 20\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53", "output": "0" }, { "input": "55\n0 0\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54", "output": "0" }, { "input": "51\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 62\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 82\n55 68\n55 70\n55 63\n55 55\n55 55\n55 55\n55 75\n55 75\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 82\n55 99\n55 60", "output": "12" }, { "input": "14\n1 1\n1 1\n1 55\n1 16\n1 1\n1 1\n1 55\n1 62\n1 53\n1 26\n1 1\n1 36\n1 2\n1 3", "output": "8" } ]
1,694,781,705
2,147,483,647
Python 3
OK
TESTS
27
46
0
N = int(input()) cnt = 0 for i in range(N): X,Y = map(int,input().split()) if((Y-X)>=2): cnt = cnt+1 print(cnt)
Title: George and Accommodation Time Limit: None seconds Memory Limit: None megabytes Problem Description: George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory. George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≀<=*q**i*). Your task is to count how many rooms has free place for both George and Alex. Input Specification: The first line contains a single integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of rooms. The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≀<=*p**i*<=≀<=*q**i*<=≀<=100) β€” the number of people who already live in the *i*-th room and the room's capacity. Output Specification: Print a single integer β€” the number of rooms where George and Alex can move in. Demo Input: ['3\n1 1\n2 2\n3 3\n', '3\n1 10\n0 10\n10 10\n'] Demo Output: ['0\n', '2\n'] Note: none
```python N = int(input()) cnt = 0 for i in range(N): X,Y = map(int,input().split()) if((Y-X)>=2): cnt = cnt+1 print(cnt) ```
3
228
A
Is your horseshoe on the other hoof?
PROGRAMMING
800
[ "implementation" ]
null
null
Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party.
The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≀<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≀<=109) β€” the colors of horseshoes Valera has. Consider all possible colors indexed with integers.
Print a single integer β€” the minimum number of horseshoes Valera needs to buy.
[ "1 7 3 3\n", "7 7 7 7\n" ]
[ "1\n", "3\n" ]
none
500
[ { "input": "1 7 3 3", "output": "1" }, { "input": "7 7 7 7", "output": "3" }, { "input": "81170865 673572653 756938629 995577259", "output": "0" }, { "input": "3491663 217797045 522540872 715355328", "output": "0" }, { "input": "251590420 586975278 916631563 586975278", "output": "1" }, { "input": "259504825 377489979 588153796 377489979", "output": "1" }, { "input": "652588203 931100304 931100304 652588203", "output": "2" }, { "input": "391958720 651507265 391958720 651507265", "output": "2" }, { "input": "90793237 90793237 90793237 90793237", "output": "3" }, { "input": "551651653 551651653 551651653 551651653", "output": "3" }, { "input": "156630260 609654355 668943582 973622757", "output": "0" }, { "input": "17061017 110313588 434481173 796661222", "output": "0" }, { "input": "24975422 256716298 337790533 690960249", "output": "0" }, { "input": "255635360 732742923 798648949 883146723", "output": "0" }, { "input": "133315691 265159773 734556507 265159773", "output": "1" }, { "input": "28442865 741657755 978106882 978106882", "output": "1" }, { "input": "131245479 174845575 497483467 131245479", "output": "1" }, { "input": "139159884 616215581 958341883 616215581", "output": "1" }, { "input": "147784432 947653080 947653080 947653080", "output": "2" }, { "input": "94055790 756126496 756126496 94055790", "output": "2" }, { "input": "240458500 511952208 240458500 511952208", "output": "2" }, { "input": "681828506 972810624 972810624 681828506", "output": "2" }, { "input": "454961014 454961014 454961014 454961014", "output": "3" }, { "input": "915819430 915819430 915819430 915819430", "output": "3" }, { "input": "671645142 671645142 671645142 671645142", "output": "3" }, { "input": "132503558 132503558 132503558 132503558", "output": "3" }, { "input": "5 5 999999 6", "output": "1" }, { "input": "1 1 2 5", "output": "1" }, { "input": "2 1 2 3", "output": "1" }, { "input": "1 1 3 5", "output": "1" }, { "input": "1 1 3 3", "output": "2" }, { "input": "2 2 2 1", "output": "2" }, { "input": "3 1 1 1", "output": "2" }, { "input": "1 2 2 2", "output": "2" } ]
1,690,597,253
2,147,483,647
Python 3
OK
TESTS
34
92
0
number1,number2,number3,number4=input().split() number1,number2,number3,number4=int(number1),int(number2),int(number3),int(number4) count=1 list_=[number1,number2,number3,number4] list_.sort() for i in range(3): if(list_[i]!=list_[i+1]): count+=1 print(4-count)
Title: Is your horseshoe on the other hoof? Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party. Input Specification: The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≀<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≀<=109) β€” the colors of horseshoes Valera has. Consider all possible colors indexed with integers. Output Specification: Print a single integer β€” the minimum number of horseshoes Valera needs to buy. Demo Input: ['1 7 3 3\n', '7 7 7 7\n'] Demo Output: ['1\n', '3\n'] Note: none
```python number1,number2,number3,number4=input().split() number1,number2,number3,number4=int(number1),int(number2),int(number3),int(number4) count=1 list_=[number1,number2,number3,number4] list_.sort() for i in range(3): if(list_[i]!=list_[i+1]): count+=1 print(4-count) ```
3
895
A
Pizza Separation
PROGRAMMING
1,200
[ "brute force", "implementation" ]
null
null
Students Vasya and Petya are studying at the BSU (Byteland State University). At one of the breaks they decided to order a pizza. In this problem pizza is a circle of some radius. The pizza was delivered already cut into *n* pieces. The *i*-th piece is a sector of angle equal to *a**i*. Vasya and Petya want to divide all pieces of pizza into two continuous sectors in such way that the difference between angles of these sectors is minimal. Sector angle is sum of angles of all pieces in it. Pay attention, that one of sectors can be empty.
The first line contains one integer *n* (1<=≀<=*n*<=≀<=360) Β β€” the number of pieces into which the delivered pizza was cut. The second line contains *n* integers *a**i* (1<=≀<=*a**i*<=≀<=360) Β β€” the angles of the sectors into which the pizza was cut. The sum of all *a**i* is 360.
Print one integer Β β€” the minimal difference between angles of sectors that will go to Vasya and Petya.
[ "4\n90 90 90 90\n", "3\n100 100 160\n", "1\n360\n", "4\n170 30 150 10\n" ]
[ "0\n", "40\n", "360\n", "0\n" ]
In first sample Vasya can take 1 and 2 pieces, Petya can take 3 and 4 pieces. Then the answer is |(90 + 90) - (90 + 90)| = 0. In third sample there is only one piece of pizza that can be taken by only one from Vasya and Petya. So the answer is |360 - 0| = 360. In fourth sample Vasya can take 1 and 4 pieces, then Petya will take 2 and 3 pieces. So the answer is |(170 + 10) - (30 + 150)| = 0. Picture explaning fourth sample: <img class="tex-graphics" src="https://espresso.codeforces.com/4bb3450aca241f92fedcba5479bf1b6d22cf813d.png" style="max-width: 100.0%;max-height: 100.0%;"/> Both red and green sectors consist of two adjacent pieces of pizza. So Vasya can take green sector, then Petya will take red sector.
500
[ { "input": "4\n90 90 90 90", "output": "0" }, { "input": "3\n100 100 160", "output": "40" }, { "input": "1\n360", "output": "360" }, { "input": "4\n170 30 150 10", "output": "0" }, { "input": "5\n10 10 10 10 320", "output": "280" }, { "input": "8\n45 45 45 45 45 45 45 45", "output": "0" }, { "input": "3\n120 120 120", "output": "120" }, { "input": "5\n110 90 70 50 40", "output": "40" }, { "input": "2\n170 190", "output": "20" }, { "input": "15\n25 25 25 25 25 25 25 25 25 25 25 25 25 25 10", "output": "10" }, { "input": "5\n30 60 180 60 30", "output": "0" }, { "input": "2\n359 1", "output": "358" }, { "input": "5\n100 100 30 100 30", "output": "40" }, { "input": "5\n36 34 35 11 244", "output": "128" }, { "input": "5\n96 94 95 71 4", "output": "18" }, { "input": "2\n85 275", "output": "190" }, { "input": "3\n281 67 12", "output": "202" }, { "input": "5\n211 113 25 9 2", "output": "62" }, { "input": "13\n286 58 6 1 1 1 1 1 1 1 1 1 1", "output": "212" }, { "input": "15\n172 69 41 67 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "20\n226 96 2 20 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "92" }, { "input": "50\n148 53 32 11 4 56 8 2 5 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "3\n1 1 358", "output": "356" }, { "input": "20\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 341", "output": "322" }, { "input": "33\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 328", "output": "296" }, { "input": "70\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 291", "output": "222" }, { "input": "130\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 231", "output": "102" }, { "input": "200\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 161", "output": "0" }, { "input": "222\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 139", "output": "0" }, { "input": "10\n8 3 11 4 1 10 10 1 8 304", "output": "248" }, { "input": "12\n8 7 7 3 11 2 10 1 10 8 10 283", "output": "206" }, { "input": "13\n10 8 9 10 5 9 4 1 10 11 1 7 275", "output": "190" }, { "input": "14\n1 6 3 11 9 5 9 8 5 6 7 3 7 280", "output": "200" }, { "input": "15\n10 11 5 4 11 5 4 1 5 4 5 5 9 6 275", "output": "190" }, { "input": "30\n8 7 5 8 3 7 2 4 3 8 11 3 9 11 2 4 1 4 5 6 11 5 8 3 6 3 11 2 11 189", "output": "18" }, { "input": "70\n5 3 6 8 9 2 8 9 11 5 2 8 9 11 7 6 6 9 7 11 7 6 3 8 2 4 4 8 4 3 2 2 3 5 6 5 11 2 7 7 5 8 10 5 2 1 10 9 4 10 7 1 8 10 9 1 5 1 1 1 2 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "29\n2 10 1 5 7 2 9 11 9 9 10 8 4 11 2 5 4 1 4 9 6 10 8 3 1 3 8 9 189", "output": "18" }, { "input": "35\n3 4 11 4 4 2 3 4 3 9 7 10 2 7 8 3 11 3 6 4 6 7 11 10 8 7 6 7 2 8 5 3 2 2 168", "output": "0" }, { "input": "60\n4 10 3 10 6 3 11 8 11 9 3 5 9 2 6 5 6 9 4 10 1 1 3 7 2 10 5 5 3 10 5 2 1 2 9 11 11 9 11 4 11 7 5 6 10 9 3 4 7 8 7 3 6 7 8 5 1 1 1 5", "output": "0" }, { "input": "71\n3 11 8 1 10 1 7 9 6 4 11 10 11 2 4 1 11 7 9 10 11 4 8 7 11 3 8 4 1 8 4 2 9 9 7 10 10 9 5 7 9 7 2 1 7 6 5 11 5 9 4 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "63\n2 11 5 8 7 9 9 8 10 5 9 10 11 8 10 2 3 5 3 7 5 10 2 9 4 8 1 8 5 9 7 7 1 8 7 7 9 10 10 10 8 7 7 2 2 8 9 7 10 8 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "81\n5 8 7 11 2 7 1 1 5 8 7 2 3 11 4 9 7 6 4 4 2 1 1 7 9 4 1 8 3 1 4 10 7 9 9 8 11 3 4 3 10 8 6 4 7 2 4 3 6 11 11 10 7 10 2 10 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "47\n5 3 7 4 2 7 8 1 9 10 5 11 10 7 7 5 1 3 2 11 3 8 6 1 6 10 8 3 2 10 5 6 8 6 9 7 10 9 7 4 8 11 10 1 5 11 68", "output": "0" }, { "input": "100\n5 8 9 3 2 3 9 8 11 10 4 8 1 1 1 1 6 5 10 9 5 3 7 7 2 11 10 2 3 2 2 8 7 3 5 5 10 9 2 5 10 6 7 7 4 7 7 8 2 8 9 9 2 4 1 1 3 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "120\n9 11 3 7 3 7 9 1 10 7 11 4 1 5 3 5 6 3 1 11 8 8 11 7 3 5 1 9 1 7 10 10 10 10 9 5 4 8 2 8 2 1 4 5 3 11 3 5 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "200\n7 7 9 8 2 8 5 8 3 9 7 10 2 9 11 8 11 7 5 2 6 3 11 9 5 1 10 2 1 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "220\n3 2 8 1 3 5 5 11 1 5 2 6 9 2 2 6 8 10 7 1 3 2 10 9 10 10 4 10 9 5 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "6\n27 15 28 34 41 215", "output": "70" }, { "input": "7\n41 38 41 31 22 41 146", "output": "14" }, { "input": "8\n24 27 34 23 29 23 30 170", "output": "20" }, { "input": "9\n11 11 20 20 33 32 35 26 172", "output": "6" }, { "input": "10\n36 13 28 13 33 34 23 25 34 121", "output": "0" }, { "input": "11\n19 37 13 41 37 15 32 12 19 35 100", "output": "10" }, { "input": "12\n37 25 34 38 21 24 34 38 11 29 28 41", "output": "2" }, { "input": "13\n24 40 20 26 25 29 39 29 35 28 19 18 28", "output": "2" }, { "input": "14\n11 21 40 19 28 34 13 16 23 30 34 22 25 44", "output": "4" }, { "input": "3\n95 91 174", "output": "12" }, { "input": "4\n82 75 78 125", "output": "46" }, { "input": "6\n87 75 88 94 15 1", "output": "4" }, { "input": "10\n27 52 58 64 45 64 1 19 2 28", "output": "12" }, { "input": "50\n14 12 11 8 1 6 11 6 7 8 4 11 4 5 7 3 5 4 7 24 10 2 3 4 6 13 2 1 8 7 5 13 10 8 5 20 1 2 23 7 14 3 4 4 2 8 8 2 6 1", "output": "0" }, { "input": "100\n3 3 4 3 3 6 3 2 8 2 13 3 1 1 2 1 3 4 1 7 1 2 2 6 3 2 10 3 1 2 5 6 2 3 3 2 3 11 8 3 2 6 1 3 3 4 7 7 2 2 1 2 6 3 3 2 3 1 3 8 2 6 4 2 1 12 2 2 2 1 4 1 4 1 3 1 3 1 5 2 6 6 7 1 2 3 2 4 4 2 5 9 8 2 4 6 5 1 1 3", "output": "0" }, { "input": "150\n1 5 1 2 2 2 1 4 2 2 2 3 1 2 1 2 2 2 2 1 2 2 2 1 5 3 4 1 3 4 5 2 4 2 1 2 2 1 1 2 3 2 4 2 2 3 3 1 1 5 2 3 2 1 9 2 1 1 2 1 4 1 1 3 2 2 2 1 2 2 2 1 3 3 4 2 2 1 3 3 3 1 4 3 4 1 2 2 1 1 1 2 2 5 4 1 1 1 2 1 2 3 2 2 6 3 3 3 1 2 1 1 2 8 2 2 4 3 4 5 3 1 4 2 2 2 2 1 4 4 1 1 2 2 4 9 6 3 1 1 2 1 3 4 1 3 2 2 2 1", "output": "0" }, { "input": "200\n1 2 1 3 1 3 1 2 1 4 6 1 2 2 2 2 1 1 1 1 3 2 1 2 2 2 1 2 2 2 2 1 1 1 3 2 3 1 1 2 1 1 2 1 1 1 1 1 1 2 1 2 2 4 1 3 1 2 1 2 2 1 2 1 3 1 1 2 2 1 1 1 1 2 4 1 2 1 1 1 2 1 3 1 1 3 1 2 2 4 1 1 2 1 2 1 2 2 2 2 1 1 2 1 2 1 3 3 1 1 1 2 1 3 3 1 2 1 3 1 3 3 1 2 2 1 4 1 2 2 1 2 2 4 2 5 1 2 2 1 2 1 2 1 5 2 1 2 2 1 2 4 1 2 2 4 2 3 2 3 1 2 1 1 2 2 2 1 1 2 1 4 1 2 1 1 2 1 2 3 1 1 1 2 2 3 1 3 2 2 3 1 2 1 2 1 1 2 1 2", "output": "0" }, { "input": "5\n35 80 45 100 100", "output": "40" }, { "input": "4\n90 179 90 1", "output": "2" }, { "input": "5\n50 50 20 160 80", "output": "0" }, { "input": "5\n30 175 30 5 120", "output": "10" }, { "input": "4\n170 30 10 150", "output": "20" }, { "input": "6\n90 30 90 30 90 30", "output": "60" }, { "input": "4\n70 80 110 100", "output": "20" }, { "input": "7\n35 45 70 100 10 10 90", "output": "0" }, { "input": "6\n50 90 10 90 20 100", "output": "20" }, { "input": "6\n10 155 162 1 26 6", "output": "18" }, { "input": "7\n80 90 80 45 10 10 45", "output": "20" }, { "input": "4\n18 36 162 144", "output": "36" }, { "input": "5\n20 50 50 160 80", "output": "40" }, { "input": "5\n10 30 140 20 160", "output": "0" }, { "input": "6\n90 80 60 50 40 40", "output": "20" }, { "input": "9\n40 20 20 20 20 20 20 40 160", "output": "40" }, { "input": "4\n90 54 90 126", "output": "72" }, { "input": "4\n150 170 30 10", "output": "20" }, { "input": "8\n130 12 13 85 41 67 5 7", "output": "26" }, { "input": "7\n70 170 20 10 30 30 30", "output": "20" }, { "input": "8\n100 100 50 50 15 15 15 15", "output": "40" }, { "input": "4\n100 70 80 110", "output": "20" }, { "input": "5\n160 130 40 20 10", "output": "20" }, { "input": "4\n20 149 151 40", "output": "22" }, { "input": "4\n100 10 100 150", "output": "60" }, { "input": "6\n19 64 105 168 1 3", "output": "16" }, { "input": "8\n10 10 70 70 90 90 10 10", "output": "0" } ]
1,511,757,505
2,147,483,647
Python 3
OK
TESTS
93
498
5,632,000
n=int(input()) from itertools import permutations a=list(map(int,input().split())) b=361 for i in range(n): for j in range(i,n): b=min(b,abs(sum(a[::])-sum(a[i:j])*2)) print(b)
Title: Pizza Separation Time Limit: None seconds Memory Limit: None megabytes Problem Description: Students Vasya and Petya are studying at the BSU (Byteland State University). At one of the breaks they decided to order a pizza. In this problem pizza is a circle of some radius. The pizza was delivered already cut into *n* pieces. The *i*-th piece is a sector of angle equal to *a**i*. Vasya and Petya want to divide all pieces of pizza into two continuous sectors in such way that the difference between angles of these sectors is minimal. Sector angle is sum of angles of all pieces in it. Pay attention, that one of sectors can be empty. Input Specification: The first line contains one integer *n* (1<=≀<=*n*<=≀<=360) Β β€” the number of pieces into which the delivered pizza was cut. The second line contains *n* integers *a**i* (1<=≀<=*a**i*<=≀<=360) Β β€” the angles of the sectors into which the pizza was cut. The sum of all *a**i* is 360. Output Specification: Print one integer Β β€” the minimal difference between angles of sectors that will go to Vasya and Petya. Demo Input: ['4\n90 90 90 90\n', '3\n100 100 160\n', '1\n360\n', '4\n170 30 150 10\n'] Demo Output: ['0\n', '40\n', '360\n', '0\n'] Note: In first sample Vasya can take 1 and 2 pieces, Petya can take 3 and 4 pieces. Then the answer is |(90 + 90) - (90 + 90)| = 0. In third sample there is only one piece of pizza that can be taken by only one from Vasya and Petya. So the answer is |360 - 0| = 360. In fourth sample Vasya can take 1 and 4 pieces, then Petya will take 2 and 3 pieces. So the answer is |(170 + 10) - (30 + 150)| = 0. Picture explaning fourth sample: <img class="tex-graphics" src="https://espresso.codeforces.com/4bb3450aca241f92fedcba5479bf1b6d22cf813d.png" style="max-width: 100.0%;max-height: 100.0%;"/> Both red and green sectors consist of two adjacent pieces of pizza. So Vasya can take green sector, then Petya will take red sector.
```python n=int(input()) from itertools import permutations a=list(map(int,input().split())) b=361 for i in range(n): for j in range(i,n): b=min(b,abs(sum(a[::])-sum(a[i:j])*2)) print(b) ```
3
770
A
New Password
PROGRAMMING
800
[ "*special", "implementation" ]
null
null
Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help. Innokentiy decides that new password should satisfy the following conditions: - the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct. Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions.
The first line contains two positive integers *n* and *k* (2<=≀<=*n*<=≀<=100, 2<=≀<=*k*<=≀<=*min*(*n*,<=26)) β€” the length of the password and the number of distinct symbols in it. Pay attention that a desired new password always exists.
Print any password which satisfies all conditions given by Innokentiy.
[ "4 3\n", "6 6\n", "5 2\n" ]
[ "java\n", "python\n", "phphp\n" ]
In the first test there is one of the appropriate new passwords β€” java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it. In the second test there is one of the appropriate new passwords β€” python, because its length is equal to 6 and it consists of 6 distinct lowercase letters. In the third test there is one of the appropriate new passwords β€” phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it. Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests.
500
[ { "input": "4 3", "output": "abca" }, { "input": "6 6", "output": "abcdef" }, { "input": "5 2", "output": "ababa" }, { "input": "3 2", "output": "aba" }, { "input": "10 2", "output": "ababababab" }, { "input": "26 13", "output": "abcdefghijklmabcdefghijklm" }, { "input": "100 2", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababab" }, { "input": "100 10", "output": "abcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij" }, { "input": "3 3", "output": "abc" }, { "input": "6 3", "output": "abcabc" }, { "input": "10 3", "output": "abcabcabca" }, { "input": "50 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab" }, { "input": "90 2", "output": "ababababababababababababababababababababababababababababababababababababababababababababab" }, { "input": "6 2", "output": "ababab" }, { "input": "99 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabc" }, { "input": "4 2", "output": "abab" }, { "input": "100 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca" }, { "input": "40 22", "output": "abcdefghijklmnopqrstuvabcdefghijklmnopqr" }, { "input": "13 8", "output": "abcdefghabcde" }, { "input": "16 15", "output": "abcdefghijklmnoa" }, { "input": "17 17", "output": "abcdefghijklmnopq" }, { "input": "19 4", "output": "abcdabcdabcdabcdabc" }, { "input": "100 26", "output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv" }, { "input": "100 25", "output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxy" }, { "input": "26 26", "output": "abcdefghijklmnopqrstuvwxyz" }, { "input": "27 26", "output": "abcdefghijklmnopqrstuvwxyza" }, { "input": "2 2", "output": "ab" }, { "input": "26 25", "output": "abcdefghijklmnopqrstuvwxya" }, { "input": "99 2", "output": "abababababababababababababababababababababababababababababababababababababababababababababababababa" }, { "input": "99 26", "output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstu" }, { "input": "4 4", "output": "abcd" }, { "input": "5 3", "output": "abcab" }, { "input": "5 4", "output": "abcda" }, { "input": "5 5", "output": "abcde" }, { "input": "24 22", "output": "abcdefghijklmnopqrstuvab" }, { "input": "26 14", "output": "abcdefghijklmnabcdefghijkl" }, { "input": "26 15", "output": "abcdefghijklmnoabcdefghijk" }, { "input": "30 12", "output": "abcdefghijklabcdefghijklabcdef" }, { "input": "35 4", "output": "abcdabcdabcdabcdabcdabcdabcdabcdabc" }, { "input": "79 3", "output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca" }, { "input": "79 14", "output": "abcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghi" }, { "input": "85 13", "output": "abcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefg" }, { "input": "90 25", "output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmno" }, { "input": "90 19", "output": "abcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmn" }, { "input": "26 24", "output": "abcdefghijklmnopqrstuvwxab" }, { "input": "100 17", "output": "abcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmno" }, { "input": "26 2", "output": "ababababababababababababab" } ]
1,685,119,950
2,147,483,647
Python 3
OK
TESTS
47
61
1,126,400
import string import random n , k = map(int , input().split()) def generate(n , k): p = '' r = string.ascii_letters[:k] while(True): if len(p) < n: p +=r else: break return p[:n] print(generate(n,k))
Title: New Password Time Limit: None seconds Memory Limit: None megabytes Problem Description: Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help. Innokentiy decides that new password should satisfy the following conditions: - the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct. Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions. Input Specification: The first line contains two positive integers *n* and *k* (2<=≀<=*n*<=≀<=100, 2<=≀<=*k*<=≀<=*min*(*n*,<=26)) β€” the length of the password and the number of distinct symbols in it. Pay attention that a desired new password always exists. Output Specification: Print any password which satisfies all conditions given by Innokentiy. Demo Input: ['4 3\n', '6 6\n', '5 2\n'] Demo Output: ['java\n', 'python\n', 'phphp\n'] Note: In the first test there is one of the appropriate new passwords β€” java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it. In the second test there is one of the appropriate new passwords β€” python, because its length is equal to 6 and it consists of 6 distinct lowercase letters. In the third test there is one of the appropriate new passwords β€” phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it. Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests.
```python import string import random n , k = map(int , input().split()) def generate(n , k): p = '' r = string.ascii_letters[:k] while(True): if len(p) < n: p +=r else: break return p[:n] print(generate(n,k)) ```
3
688
B
Lovely Palindromes
PROGRAMMING
1,000
[ "constructive algorithms", "math" ]
null
null
Pari has a friend who loves palindrome numbers. A palindrome number is a number that reads the same forward or backward. For example 12321, 100001 and 1 are palindrome numbers, while 112 and 1021 are not. Pari is trying to love them too, but only very special and gifted people can understand the beauty behind palindrome numbers. Pari loves integers with even length (i.e. the numbers with even number of digits), so she tries to see a lot of big palindrome numbers with even length (like a 2-digit 11 or 6-digit 122221), so maybe she could see something in them. Now Pari asks you to write a program that gets a huge integer *n* from the input and tells what is the *n*-th even-length positive palindrome number?
The only line of the input contains a single integer *n* (1<=≀<=*n*<=≀<=10100<=000).
Print the *n*-th even-length palindrome number.
[ "1\n", "10\n" ]
[ "11\n", "1001\n" ]
The first 10 even-length palindrome numbers are 11, 22, 33, ... , 88, 99 and 1001.
1,000
[ { "input": "1", "output": "11" }, { "input": "10", "output": "1001" }, { "input": "11", "output": "1111" }, { "input": "12", "output": "1221" }, { "input": "100", "output": "100001" }, { "input": "1321", "output": "13211231" }, { "input": "2", "output": "22" }, { "input": "3", "output": "33" }, { "input": "4", "output": "44" }, { "input": "5", "output": "55" }, { "input": "6", "output": "66" }, { "input": "7", "output": "77" }, { "input": "8", "output": "88" }, { "input": "9", "output": "99" }, { "input": "13", "output": "1331" }, { "input": "14", "output": "1441" }, { "input": "15", "output": "1551" }, { "input": "16", "output": "1661" }, { "input": "17", "output": "1771" }, { "input": "18", "output": "1881" }, { "input": "19", "output": "1991" }, { "input": "20", "output": "2002" }, { "input": "26550", "output": "2655005562" }, { "input": "16137", "output": "1613773161" }, { "input": "91471", "output": "9147117419" }, { "input": "41242", "output": "4124224214" }, { "input": "30866", "output": "3086666803" }, { "input": "4442231232741003009964183199713851566466079882929007253443848371978048610682180431295671905105980116", "output": "44422312327410030099641831997138515664660798829290072534438483719780486106821804312956719051059801166110895015091765921340812860168408791738483443527009292889706646651583179913814699003001472321322444" }, { "input": "7806526084732010742850470902979267046151204705563201965818390803445852115032119297648697933316807252", "output": "78065260847320107428504709029792670461512047055632019658183908034458521150321192976486979333168072522527086133397968467929112305112585443080938185691023655074021516407629792090740582470102374806256087" }, { "input": "2244399823612183124978103773977739948197709395321563148611877999503840818596183803323258317041875913", "output": "22443998236121831249781037739777399481977093953215631486118779995038408185961838033232583170418759133195781407138523233083816958180483059997781168413651235939077918499377793773018794213812163289934422" }, { "input": "123451", "output": "123451154321" } ]
1,636,193,611
2,147,483,647
PyPy 3
OK
TESTS
40
109
22,835,200
s = input() res = ['0'] * (2* len(s)) for i in range(len(s)): res[i] = res[len(res)-1-i] = s[i] print(''.join(res))
Title: Lovely Palindromes Time Limit: None seconds Memory Limit: None megabytes Problem Description: Pari has a friend who loves palindrome numbers. A palindrome number is a number that reads the same forward or backward. For example 12321, 100001 and 1 are palindrome numbers, while 112 and 1021 are not. Pari is trying to love them too, but only very special and gifted people can understand the beauty behind palindrome numbers. Pari loves integers with even length (i.e. the numbers with even number of digits), so she tries to see a lot of big palindrome numbers with even length (like a 2-digit 11 or 6-digit 122221), so maybe she could see something in them. Now Pari asks you to write a program that gets a huge integer *n* from the input and tells what is the *n*-th even-length positive palindrome number? Input Specification: The only line of the input contains a single integer *n* (1<=≀<=*n*<=≀<=10100<=000). Output Specification: Print the *n*-th even-length palindrome number. Demo Input: ['1\n', '10\n'] Demo Output: ['11\n', '1001\n'] Note: The first 10 even-length palindrome numbers are 11, 22, 33, ... , 88, 99 and 1001.
```python s = input() res = ['0'] * (2* len(s)) for i in range(len(s)): res[i] = res[len(res)-1-i] = s[i] print(''.join(res)) ```
3
228
A
Is your horseshoe on the other hoof?
PROGRAMMING
800
[ "implementation" ]
null
null
Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party.
The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≀<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≀<=109) β€” the colors of horseshoes Valera has. Consider all possible colors indexed with integers.
Print a single integer β€” the minimum number of horseshoes Valera needs to buy.
[ "1 7 3 3\n", "7 7 7 7\n" ]
[ "1\n", "3\n" ]
none
500
[ { "input": "1 7 3 3", "output": "1" }, { "input": "7 7 7 7", "output": "3" }, { "input": "81170865 673572653 756938629 995577259", "output": "0" }, { "input": "3491663 217797045 522540872 715355328", "output": "0" }, { "input": "251590420 586975278 916631563 586975278", "output": "1" }, { "input": "259504825 377489979 588153796 377489979", "output": "1" }, { "input": "652588203 931100304 931100304 652588203", "output": "2" }, { "input": "391958720 651507265 391958720 651507265", "output": "2" }, { "input": "90793237 90793237 90793237 90793237", "output": "3" }, { "input": "551651653 551651653 551651653 551651653", "output": "3" }, { "input": "156630260 609654355 668943582 973622757", "output": "0" }, { "input": "17061017 110313588 434481173 796661222", "output": "0" }, { "input": "24975422 256716298 337790533 690960249", "output": "0" }, { "input": "255635360 732742923 798648949 883146723", "output": "0" }, { "input": "133315691 265159773 734556507 265159773", "output": "1" }, { "input": "28442865 741657755 978106882 978106882", "output": "1" }, { "input": "131245479 174845575 497483467 131245479", "output": "1" }, { "input": "139159884 616215581 958341883 616215581", "output": "1" }, { "input": "147784432 947653080 947653080 947653080", "output": "2" }, { "input": "94055790 756126496 756126496 94055790", "output": "2" }, { "input": "240458500 511952208 240458500 511952208", "output": "2" }, { "input": "681828506 972810624 972810624 681828506", "output": "2" }, { "input": "454961014 454961014 454961014 454961014", "output": "3" }, { "input": "915819430 915819430 915819430 915819430", "output": "3" }, { "input": "671645142 671645142 671645142 671645142", "output": "3" }, { "input": "132503558 132503558 132503558 132503558", "output": "3" }, { "input": "5 5 999999 6", "output": "1" }, { "input": "1 1 2 5", "output": "1" }, { "input": "2 1 2 3", "output": "1" }, { "input": "1 1 3 5", "output": "1" }, { "input": "1 1 3 3", "output": "2" }, { "input": "2 2 2 1", "output": "2" }, { "input": "3 1 1 1", "output": "2" }, { "input": "1 2 2 2", "output": "2" } ]
1,690,865,071
2,147,483,647
Python 3
OK
TESTS
34
92
0
def minimum_horseshoes_to_buy(colors): unique_colors = len(set(colors)) return max(0, 4 - unique_colors) colors = list(map(int, input().split())) output_result = minimum_horseshoes_to_buy(colors) print(output_result)
Title: Is your horseshoe on the other hoof? Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party. Input Specification: The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≀<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≀<=109) β€” the colors of horseshoes Valera has. Consider all possible colors indexed with integers. Output Specification: Print a single integer β€” the minimum number of horseshoes Valera needs to buy. Demo Input: ['1 7 3 3\n', '7 7 7 7\n'] Demo Output: ['1\n', '3\n'] Note: none
```python def minimum_horseshoes_to_buy(colors): unique_colors = len(set(colors)) return max(0, 4 - unique_colors) colors = list(map(int, input().split())) output_result = minimum_horseshoes_to_buy(colors) print(output_result) ```
3
268
A
Games
PROGRAMMING
800
[ "brute force" ]
null
null
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*Β·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
The first line contains an integer *n* (2<=≀<=*n*<=≀<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≀<=*h**i*,<=*a**i*<=≀<=100) β€” the colors of the *i*-th team's home and guest uniforms, respectively.
In a single line print the number of games where the host team is going to play in the guest uniform.
[ "3\n1 2\n2 4\n3 4\n", "4\n100 42\n42 100\n5 42\n100 5\n", "2\n1 2\n1 2\n" ]
[ "1\n", "5\n", "0\n" ]
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
500
[ { "input": "3\n1 2\n2 4\n3 4", "output": "1" }, { "input": "4\n100 42\n42 100\n5 42\n100 5", "output": "5" }, { "input": "2\n1 2\n1 2", "output": "0" }, { "input": "7\n4 7\n52 55\n16 4\n55 4\n20 99\n3 4\n7 52", "output": "6" }, { "input": "10\n68 42\n1 35\n25 70\n59 79\n65 63\n46 6\n28 82\n92 62\n43 96\n37 28", "output": "1" }, { "input": "30\n10 39\n89 1\n78 58\n75 99\n36 13\n77 50\n6 97\n79 28\n27 52\n56 5\n93 96\n40 21\n33 74\n26 37\n53 59\n98 56\n61 65\n42 57\n9 7\n25 63\n74 34\n96 84\n95 47\n12 23\n34 21\n71 6\n27 13\n15 47\n64 14\n12 77", "output": "6" }, { "input": "30\n46 100\n87 53\n34 84\n44 66\n23 20\n50 34\n90 66\n17 39\n13 22\n94 33\n92 46\n63 78\n26 48\n44 61\n3 19\n41 84\n62 31\n65 89\n23 28\n58 57\n19 85\n26 60\n75 66\n69 67\n76 15\n64 15\n36 72\n90 89\n42 69\n45 35", "output": "4" }, { "input": "2\n46 6\n6 46", "output": "2" }, { "input": "29\n8 18\n33 75\n69 22\n97 95\n1 97\n78 10\n88 18\n13 3\n19 64\n98 12\n79 92\n41 72\n69 15\n98 31\n57 74\n15 56\n36 37\n15 66\n63 100\n16 42\n47 56\n6 4\n73 15\n30 24\n27 71\n12 19\n88 69\n85 6\n50 11", "output": "10" }, { "input": "23\n43 78\n31 28\n58 80\n66 63\n20 4\n51 95\n40 20\n50 14\n5 34\n36 39\n77 42\n64 97\n62 89\n16 56\n8 34\n58 16\n37 35\n37 66\n8 54\n50 36\n24 8\n68 48\n85 33", "output": "6" }, { "input": "13\n76 58\n32 85\n99 79\n23 58\n96 59\n72 35\n53 43\n96 55\n41 78\n75 10\n28 11\n72 7\n52 73", "output": "0" }, { "input": "18\n6 90\n70 79\n26 52\n67 81\n29 95\n41 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 2", "output": "1" }, { "input": "18\n6 90\n100 79\n26 100\n67 100\n29 100\n100 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 100", "output": "8" }, { "input": "30\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "450" }, { "input": "30\n100 99\n58 59\n56 57\n54 55\n52 53\n50 51\n48 49\n46 47\n44 45\n42 43\n40 41\n38 39\n36 37\n34 35\n32 33\n30 31\n28 29\n26 27\n24 25\n22 23\n20 21\n18 19\n16 17\n14 15\n12 13\n10 11\n8 9\n6 7\n4 5\n2 3", "output": "0" }, { "input": "15\n9 3\n2 6\n7 6\n5 10\n9 5\n8 1\n10 5\n2 8\n4 5\n9 8\n5 3\n3 8\n9 8\n4 10\n8 5", "output": "20" }, { "input": "15\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n1 2", "output": "108" }, { "input": "25\n2 1\n1 2\n1 2\n1 2\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n1 2\n2 1\n2 1\n2 1\n2 1\n1 2", "output": "312" }, { "input": "25\n91 57\n2 73\n54 57\n2 57\n23 57\n2 6\n57 54\n57 23\n91 54\n91 23\n57 23\n91 57\n54 2\n6 91\n57 54\n2 57\n57 91\n73 91\n57 23\n91 57\n2 73\n91 2\n23 6\n2 73\n23 6", "output": "96" }, { "input": "28\n31 66\n31 91\n91 31\n97 66\n31 66\n31 66\n66 91\n91 31\n97 31\n91 97\n97 31\n66 31\n66 97\n91 31\n31 66\n31 66\n66 31\n31 97\n66 97\n97 31\n31 91\n66 91\n91 66\n31 66\n91 66\n66 31\n66 31\n91 97", "output": "210" }, { "input": "29\n78 27\n50 68\n24 26\n68 43\n38 78\n26 38\n78 28\n28 26\n27 24\n23 38\n24 26\n24 43\n61 50\n38 78\n27 23\n61 26\n27 28\n43 23\n28 78\n43 27\n43 78\n27 61\n28 38\n61 78\n50 26\n43 27\n26 78\n28 50\n43 78", "output": "73" }, { "input": "29\n80 27\n69 80\n27 80\n69 80\n80 27\n80 27\n80 27\n80 69\n27 69\n80 69\n80 27\n27 69\n69 27\n80 69\n27 69\n69 80\n27 69\n80 69\n80 27\n69 27\n27 69\n27 80\n80 27\n69 80\n27 69\n80 69\n69 80\n69 80\n27 80", "output": "277" }, { "input": "30\n19 71\n7 89\n89 71\n21 7\n19 21\n7 89\n19 71\n89 8\n89 21\n19 8\n21 7\n8 89\n19 89\n7 21\n19 8\n19 7\n7 19\n8 21\n71 21\n71 89\n7 19\n7 19\n21 7\n21 19\n21 19\n71 8\n21 8\n71 19\n19 71\n8 21", "output": "154" }, { "input": "30\n44 17\n44 17\n44 17\n17 44\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n44 17\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n17 44\n44 17\n44 17\n44 17\n17 44\n17 44\n44 17\n17 44\n44 17\n44 17\n44 17", "output": "418" }, { "input": "22\n78 92\n15 92\n92 78\n78 80\n92 16\n24 80\n92 16\n16 92\n78 16\n24 78\n80 78\n92 80\n16 80\n80 78\n15 78\n92 16\n24 15\n24 80\n80 16\n16 80\n92 80\n24 80", "output": "74" }, { "input": "24\n9 83\n90 31\n83 3\n83 3\n21 31\n83 3\n32 31\n12 21\n31 21\n90 32\n32 21\n12 9\n12 31\n9 83\n83 12\n32 3\n32 83\n90 31\n9 32\n31 21\n83 90\n32 21\n21 3\n32 9", "output": "59" }, { "input": "30\n67 21\n85 39\n85 87\n21 39\n66 85\n10 95\n10 21\n87 85\n82 21\n67 21\n95 10\n21 39\n82 21\n21 66\n66 39\n95 30\n67 85\n66 82\n85 82\n21 66\n10 39\n67 10\n21 85\n10 82\n85 95\n10 85\n21 39\n85 39\n39 10\n95 67", "output": "100" }, { "input": "4\n8 7\n8 7\n7 8\n7 8", "output": "8" }, { "input": "6\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1", "output": "10" }, { "input": "12\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1", "output": "72" }, { "input": "4\n1 2\n1 2\n2 1\n2 1", "output": "8" } ]
1,682,385,119
2,147,483,647
Python 3
OK
TESTS
31
92
0
ls = [] counter = 0 for i in range(int(input())): ls_temp = [int(x) for x in input().split()] ls.append(ls_temp) for home in ls : for away in ls : if home[0]==away[1] : counter += 1 print(counter)
Title: Games Time Limit: None seconds Memory Limit: None megabytes Problem Description: Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different. There are *n* teams taking part in the national championship. The championship consists of *n*Β·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number. You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question. Input Specification: The first line contains an integer *n* (2<=≀<=*n*<=≀<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≀<=*h**i*,<=*a**i*<=≀<=100) β€” the colors of the *i*-th team's home and guest uniforms, respectively. Output Specification: In a single line print the number of games where the host team is going to play in the guest uniform. Demo Input: ['3\n1 2\n2 4\n3 4\n', '4\n100 42\n42 100\n5 42\n100 5\n', '2\n1 2\n1 2\n'] Demo Output: ['1\n', '5\n', '0\n'] Note: In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2. In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
```python ls = [] counter = 0 for i in range(int(input())): ls_temp = [int(x) for x in input().split()] ls.append(ls_temp) for home in ls : for away in ls : if home[0]==away[1] : counter += 1 print(counter) ```
3
912
B
New Year's Eve
PROGRAMMING
1,300
[ "bitmasks", "constructive algorithms", "number theory" ]
null
null
Since Grisha behaved well last year, at New Year's Eve he was visited by Ded Moroz who brought an enormous bag of gifts with him! The bag contains *n* sweet candies from the good ol' bakery, each labeled from 1 to *n* corresponding to its tastiness. No two candies have the same tastiness. The choice of candies has a direct effect on Grisha's happiness. One can assume that he should take the tastiest onesΒ β€” but no, the holiday magic turns things upside down. It is the xor-sum of tastinesses that matters, not the ordinary sum! A xor-sum of a sequence of integers *a*1,<=*a*2,<=...,<=*a**m* is defined as the bitwise XOR of all its elements: , here denotes the bitwise XOR operation; more about bitwise XOR can be found [here.](https://en.wikipedia.org/wiki/Bitwise_operation#XOR) Ded Moroz warned Grisha he has more houses to visit, so Grisha can take no more than *k* candies from the bag. Help Grisha determine the largest xor-sum (largest xor-sum means maximum happiness!) he can obtain.
The sole string contains two integers *n* and *k* (1<=≀<=*k*<=≀<=*n*<=≀<=1018).
Output one numberΒ β€” the largest possible xor-sum.
[ "4 3\n", "6 6\n" ]
[ "7\n", "7\n" ]
In the first sample case, one optimal answer is 1, 2 and 4, giving the xor-sum of 7. In the second sample case, one can, for example, take all six candies and obtain the xor-sum of 7.
1,000
[ { "input": "4 3", "output": "7" }, { "input": "6 6", "output": "7" }, { "input": "2 2", "output": "3" }, { "input": "1022 10", "output": "1023" }, { "input": "415853337373441 52", "output": "562949953421311" }, { "input": "75 12", "output": "127" }, { "input": "1000000000000000000 1000000000000000000", "output": "1152921504606846975" }, { "input": "1 1", "output": "1" }, { "input": "1000000000000000000 2", "output": "1152921504606846975" }, { "input": "49194939 22", "output": "67108863" }, { "input": "228104606 17", "output": "268435455" }, { "input": "817034381 7", "output": "1073741823" }, { "input": "700976748 4", "output": "1073741823" }, { "input": "879886415 9", "output": "1073741823" }, { "input": "18007336 10353515", "output": "33554431" }, { "input": "196917003 154783328", "output": "268435455" }, { "input": "785846777 496205300", "output": "1073741823" }, { "input": "964756444 503568330", "output": "1073741823" }, { "input": "848698811 317703059", "output": "1073741823" }, { "input": "676400020444788 1", "output": "676400020444788" }, { "input": "502643198528213 1", "output": "502643198528213" }, { "input": "815936580997298686 684083143940282566", "output": "1152921504606846975" }, { "input": "816762824175382110 752185261508428780", "output": "1152921504606846975" }, { "input": "327942415253132295 222598158321260499", "output": "576460752303423487" }, { "input": "328768654136248423 284493129147496637", "output": "576460752303423487" }, { "input": "329594893019364551 25055600080496801", "output": "576460752303423487" }, { "input": "921874985256864012 297786684518764536", "output": "1152921504606846975" }, { "input": "922701224139980141 573634416190460758", "output": "1152921504606846975" }, { "input": "433880815217730325 45629641110945892", "output": "576460752303423487" }, { "input": "434707058395813749 215729375494216481", "output": "576460752303423487" }, { "input": "435533301573897173 34078453236225189", "output": "576460752303423487" }, { "input": "436359544751980597 199220719961060641", "output": "576460752303423487" }, { "input": "437185783635096725 370972992240105630", "output": "576460752303423487" }, { "input": "438012026813180149 111323110116193830", "output": "576460752303423487" }, { "input": "438838269991263573 295468957052046146", "output": "576460752303423487" }, { "input": "439664513169346997 46560240538186155", "output": "576460752303423487" }, { "input": "440490752052463125 216165966013438147", "output": "576460752303423487" }, { "input": "441316995230546549 401964286420555423", "output": "576460752303423487" }, { "input": "952496582013329437 673506882352402278", "output": "1152921504606846975" }, { "input": "1000000000000000000 1", "output": "1000000000000000000" }, { "input": "2147483647 1", "output": "2147483647" }, { "input": "2147483647 2", "output": "2147483647" }, { "input": "2147483647 31", "output": "2147483647" }, { "input": "8 2", "output": "15" }, { "input": "3 3", "output": "3" }, { "input": "4 1", "output": "4" }, { "input": "10 2", "output": "15" }, { "input": "288230376151711743 2", "output": "288230376151711743" }, { "input": "5 2", "output": "7" }, { "input": "576460752303423487 2", "output": "576460752303423487" }, { "input": "36028797018963967 123", "output": "36028797018963967" }, { "input": "1125899906842623 2", "output": "1125899906842623" }, { "input": "576460752303423489 5", "output": "1152921504606846975" }, { "input": "288230376151711743 3", "output": "288230376151711743" }, { "input": "36028797018963967 345", "output": "36028797018963967" }, { "input": "18014398509481984 30", "output": "36028797018963967" }, { "input": "8 8", "output": "15" }, { "input": "8 1", "output": "8" } ]
1,518,550,434
2,147,483,647
PyPy 3
OK
TESTS
58
77
19,968,000
n, k = [int(f) for f in input().split(' ') if f] if k == 1: print(n) else: l = 0 while n > 0: l += 1 n //= 2 print(2 ** l - 1)
Title: New Year's Eve Time Limit: None seconds Memory Limit: None megabytes Problem Description: Since Grisha behaved well last year, at New Year's Eve he was visited by Ded Moroz who brought an enormous bag of gifts with him! The bag contains *n* sweet candies from the good ol' bakery, each labeled from 1 to *n* corresponding to its tastiness. No two candies have the same tastiness. The choice of candies has a direct effect on Grisha's happiness. One can assume that he should take the tastiest onesΒ β€” but no, the holiday magic turns things upside down. It is the xor-sum of tastinesses that matters, not the ordinary sum! A xor-sum of a sequence of integers *a*1,<=*a*2,<=...,<=*a**m* is defined as the bitwise XOR of all its elements: , here denotes the bitwise XOR operation; more about bitwise XOR can be found [here.](https://en.wikipedia.org/wiki/Bitwise_operation#XOR) Ded Moroz warned Grisha he has more houses to visit, so Grisha can take no more than *k* candies from the bag. Help Grisha determine the largest xor-sum (largest xor-sum means maximum happiness!) he can obtain. Input Specification: The sole string contains two integers *n* and *k* (1<=≀<=*k*<=≀<=*n*<=≀<=1018). Output Specification: Output one numberΒ β€” the largest possible xor-sum. Demo Input: ['4 3\n', '6 6\n'] Demo Output: ['7\n', '7\n'] Note: In the first sample case, one optimal answer is 1, 2 and 4, giving the xor-sum of 7. In the second sample case, one can, for example, take all six candies and obtain the xor-sum of 7.
```python n, k = [int(f) for f in input().split(' ') if f] if k == 1: print(n) else: l = 0 while n > 0: l += 1 n //= 2 print(2 ** l - 1) ```
3
275
B
Convex Shape
PROGRAMMING
1,700
[ "constructive algorithms", "implementation" ]
null
null
Consider an *n*<=Γ—<=*m* grid. Initially all the cells of the grid are colored white. Lenny has painted some of the cells (at least one) black. We call a painted grid convex if one can walk from any black cell to any another black cell using a path of side-adjacent black cells changing his direction at most once during the path. In the figure below, the left grid is convex while the right one is not convex, because there exist two cells which need more than one time to change direction in their path. You're given a painted grid in the input. Tell Lenny if the grid is convex or not.
The first line of the input contains two integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=50) β€” the size of the grid. Each of the next *n* lines contains *m* characters "B" or "W". Character "B" denotes a black cell of the grid and "W" denotes a white cell of the grid. It's guaranteed that the grid has at least one black cell.
On the only line of the output print "YES" if the grid is convex, otherwise print "NO". Do not print quotes.
[ "3 4\nWWBW\nBWWW\nWWWB\n", "3 1\nB\nB\nW\n" ]
[ "NO\n", "YES\n" ]
none
1,000
[ { "input": "3 4\nWWBW\nBWWW\nWWWB", "output": "NO" }, { "input": "3 1\nB\nB\nW", "output": "YES" }, { "input": "1 1\nB", "output": "YES" }, { "input": "1 2\nBB", "output": "YES" }, { "input": "2 1\nB\nB", "output": "YES" }, { "input": "1 2\nBW", "output": "YES" }, { "input": "2 1\nW\nB", "output": "YES" }, { "input": "5 5\nWBBBW\nWBBBW\nWBBWW\nWBBBW\nWWWWW", "output": "NO" }, { "input": "5 5\nWBBWW\nBBBWW\nBBBWW\nBBBWW\nBBBBB", "output": "YES" }, { "input": "5 5\nWWWBB\nBBBBB\nWWWBB\nWWWBB\nWWWBW", "output": "YES" }, { "input": "5 5\nWBBBW\nWBBWW\nWBBWW\nBBBWW\nBBWWW", "output": "NO" }, { "input": "5 5\nWBBBB\nWBBBB\nWBBBB\nBBBBB\nBBBBB", "output": "YES" }, { "input": "5 5\nWWWWB\nWBBBB\nBBBBB\nBBBBB\nWBBBB", "output": "YES" }, { "input": "5 5\nWWBWW\nWWBWW\nWWBBB\nBBBBB\nWWWWW", "output": "YES" }, { "input": "50 1\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nB\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW", "output": "YES" }, { "input": "1 50\nWWWWWWWWWWWWWWWWWWWWWBBBBBBBBBBBBBBBBBBBBBBBWWWWWW", "output": "YES" }, { "input": "50 2\nWW\nWW\nWW\nWW\nWW\nWW\nWW\nWW\nWW\nWW\nWW\nWW\nWW\nWW\nWW\nWB\nWB\nWB\nWB\nWB\nWB\nWB\nWB\nWB\nWB\nBB\nBB\nBB\nBB\nBB\nBB\nBB\nBB\nBB\nBB\nBB\nBB\nBB\nBB\nBB\nBW\nBW\nBW\nBW\nBW\nBW\nBW\nWW\nWW\nWW", "output": "NO" }, { "input": "5 5\nWWWWW\nWWWWW\nWWWWW\nWWWWW\nWWBWW", "output": "YES" }, { "input": "5 5\nWWWWW\nWWWWW\nWWWWW\nWBBBB\nWWWWW", "output": "YES" }, { "input": "5 5\nWWWWW\nWWWBW\nWWWBW\nWWWBB\nWWWWW", "output": "YES" }, { "input": "5 5\nWWWWB\nWWWWB\nWBBBB\nWWWWW\nWWWWW", "output": "YES" }, { "input": "5 5\nWWWWW\nBBBWW\nBBBBW\nWWWWW\nWWWWW", "output": "YES" }, { "input": "5 5\nWWWWW\nBBBBW\nWWWBB\nWWWWW\nWWWWW", "output": "NO" }, { "input": "5 5\nWBWWW\nBBWWW\nWWWWW\nWWWWW\nWWWWW", "output": "YES" }, { "input": "5 5\nWWBBB\nWWBBB\nWWBBB\nWWBBB\nWWBBW", "output": "YES" }, { "input": "5 5\nWWWWB\nWWWBB\nWWWBB\nWWWBB\nWWWBW", "output": "NO" }, { "input": "2 5\nBWWWB\nBBBBB", "output": "NO" } ]
1,658,010,145
2,147,483,647
PyPy 3-64
OK
TESTS
46
280
3,993,600
import bisect import itertools import sys import collections n, m = map(int, input().split()) grid = [list(input()) for _ in range(n)] # print('\n'.join(map(str, grid))) # row check good = True for i in range(n): b = False w = False for j in range(m): if grid[i][j] == 'B' and not b: b = True elif grid[i][j] == 'W' and b and not w: w = True elif grid[i][j] == 'B' and b and w: good = False # print('rowcheck', i, j) break if not good: break # col check if good: for j in range(m): b = False w = False for i in range(n): if grid[i][j] == 'B' and not b and not w: b = True elif grid[i][j] == 'W' and b and not w: w = True elif grid[i][j] == 'B' and b and w: good = False # print('colcheck', i, j) break if not good: break # 2 change check if good: points = [(i, j) for i in range(n) for j in range(m) if grid[i][j] == 'B'] for (i1, j1), (i2, j2) in itertools.combinations(points, 2): if grid[i1][j2] == 'W' and grid[i2][j1] == 'W': # print('2change', i1, j1, i2, j2) good = False break print("YES" if good else "NO")
Title: Convex Shape Time Limit: None seconds Memory Limit: None megabytes Problem Description: Consider an *n*<=Γ—<=*m* grid. Initially all the cells of the grid are colored white. Lenny has painted some of the cells (at least one) black. We call a painted grid convex if one can walk from any black cell to any another black cell using a path of side-adjacent black cells changing his direction at most once during the path. In the figure below, the left grid is convex while the right one is not convex, because there exist two cells which need more than one time to change direction in their path. You're given a painted grid in the input. Tell Lenny if the grid is convex or not. Input Specification: The first line of the input contains two integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=50) β€” the size of the grid. Each of the next *n* lines contains *m* characters "B" or "W". Character "B" denotes a black cell of the grid and "W" denotes a white cell of the grid. It's guaranteed that the grid has at least one black cell. Output Specification: On the only line of the output print "YES" if the grid is convex, otherwise print "NO". Do not print quotes. Demo Input: ['3 4\nWWBW\nBWWW\nWWWB\n', '3 1\nB\nB\nW\n'] Demo Output: ['NO\n', 'YES\n'] Note: none
```python import bisect import itertools import sys import collections n, m = map(int, input().split()) grid = [list(input()) for _ in range(n)] # print('\n'.join(map(str, grid))) # row check good = True for i in range(n): b = False w = False for j in range(m): if grid[i][j] == 'B' and not b: b = True elif grid[i][j] == 'W' and b and not w: w = True elif grid[i][j] == 'B' and b and w: good = False # print('rowcheck', i, j) break if not good: break # col check if good: for j in range(m): b = False w = False for i in range(n): if grid[i][j] == 'B' and not b and not w: b = True elif grid[i][j] == 'W' and b and not w: w = True elif grid[i][j] == 'B' and b and w: good = False # print('colcheck', i, j) break if not good: break # 2 change check if good: points = [(i, j) for i in range(n) for j in range(m) if grid[i][j] == 'B'] for (i1, j1), (i2, j2) in itertools.combinations(points, 2): if grid[i1][j2] == 'W' and grid[i2][j1] == 'W': # print('2change', i1, j1, i2, j2) good = False break print("YES" if good else "NO") ```
3
667
A
Pouring Rain
PROGRAMMING
1,100
[ "geometry", "math" ]
null
null
A lot of people in Berland hates rain, but you do not. Rain pacifies, puts your thoughts in order. By these years you have developed a good tradition β€” when it rains, you go on the street and stay silent for a moment, contemplate all around you, enjoy freshness, think about big deeds you have to do. Today everything had changed quietly. You went on the street with a cup contained water, your favorite drink. In a moment when you were drinking a water you noticed that the process became quite long: the cup still contained water because of rain. You decided to make a formal model of what was happening and to find if it was possible to drink all water in that situation. Thus, your cup is a cylinder with diameter equals *d* centimeters. Initial level of water in cup equals *h* centimeters from the bottom. You drink a water with a speed equals *v* milliliters per second. But rain goes with such speed that if you do not drink a water from the cup, the level of water increases on *e* centimeters per second. The process of drinking water from the cup and the addition of rain to the cup goes evenly and continuously. Find the time needed to make the cup empty or find that it will never happen. It is guaranteed that if it is possible to drink all water, it will happen not later than after 104 seconds. Note one milliliter equals to one cubic centimeter.
The only line of the input contains four integer numbers *d*,<=*h*,<=*v*,<=*e* (1<=≀<=*d*,<=*h*,<=*v*,<=*e*<=≀<=104), where: - *d* β€” the diameter of your cylindrical cup, - *h* β€” the initial level of water in the cup, - *v* β€” the speed of drinking process from the cup in milliliters per second, - *e* β€” the growth of water because of rain if you do not drink from the cup.
If it is impossible to make the cup empty, print "NO" (without quotes). Otherwise print "YES" (without quotes) in the first line. In the second line print a real number β€” time in seconds needed the cup will be empty. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=4. It is guaranteed that if the answer exists, it doesn't exceed 104.
[ "1 2 3 100\n", "1 1 1 1\n" ]
[ "NO\n", "YES\n3.659792366325\n" ]
In the first example the water fills the cup faster than you can drink from it. In the second example area of the cup's bottom equals to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/419dc74dcd7bc392019c9fe748fe1fdb08ab521a.png" style="max-width: 100.0%;max-height: 100.0%;"/>, thus we can conclude that you decrease the level of water by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e8edb237e1f805fe83c2f47e48d3a9d03f2ee304.png" style="max-width: 100.0%;max-height: 100.0%;"/> centimeters per second. At the same time water level increases by 1 centimeter per second due to rain. Thus, cup will be empty in <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9dae615d7e2c5c7c03cb478848fb06aba1a8942e.png" style="max-width: 100.0%;max-height: 100.0%;"/> seconds.
500
[ { "input": "1 2 3 100", "output": "NO" }, { "input": "1 1 1 1", "output": "YES\n3.659792366325" }, { "input": "48 7946 7992 72", "output": "NO" }, { "input": "72 6791 8546 46", "output": "NO" }, { "input": "100 5635 9099 23", "output": "NO" }, { "input": "20 287 3845 5", "output": "YES\n39.646277165210" }, { "input": "48 6428 9807 83", "output": "NO" }, { "input": "72 5272 4552 64", "output": "NO" }, { "input": "100 4117 5106 34", "output": "NO" }, { "input": "20 2961 9852 15", "output": "YES\n180.991437129723" }, { "input": "48 1805 3109 93", "output": "NO" }, { "input": "72 8534 7042 65", "output": "NO" }, { "input": "1 47 80 68", "output": "YES\n1.388102806810" }, { "input": "4 495 8813 1", "output": "YES\n0.706823517575" }, { "input": "5 2797 5925 9", "output": "YES\n9.553973511669" }, { "input": "1 8324 4362 23", "output": "YES\n1.505007106354" }, { "input": "6 1976 8455 3", "output": "YES\n6.674898722265" }, { "input": "7 2644 8080 5", "output": "YES\n12.900417790197" }, { "input": "3 4183 5491 98", "output": "YES\n6.162185601824" }, { "input": "2 8591 320 101", "output": "YES\n9999.259991757254" }, { "input": "10000 10000 10000 10000", "output": "NO" }, { "input": "2 5000 12 3", "output": "YES\n6099.653943875812" }, { "input": "10 1000 100 1", "output": "YES\n3659.792366325487" } ]
1,462,210,801
2,147,483,647
Python 3
OK
TESTS
23
62
5,120,000
d,h,v,e = map(int,input().split(' ')) PI = 3.1415926 S = (d/2)*(d/2)*PI V = h*S V2 = e*S if(V2 >= v): print("NO") exit else: print("YES") print(abs(V/(V2-v)))
Title: Pouring Rain Time Limit: None seconds Memory Limit: None megabytes Problem Description: A lot of people in Berland hates rain, but you do not. Rain pacifies, puts your thoughts in order. By these years you have developed a good tradition β€” when it rains, you go on the street and stay silent for a moment, contemplate all around you, enjoy freshness, think about big deeds you have to do. Today everything had changed quietly. You went on the street with a cup contained water, your favorite drink. In a moment when you were drinking a water you noticed that the process became quite long: the cup still contained water because of rain. You decided to make a formal model of what was happening and to find if it was possible to drink all water in that situation. Thus, your cup is a cylinder with diameter equals *d* centimeters. Initial level of water in cup equals *h* centimeters from the bottom. You drink a water with a speed equals *v* milliliters per second. But rain goes with such speed that if you do not drink a water from the cup, the level of water increases on *e* centimeters per second. The process of drinking water from the cup and the addition of rain to the cup goes evenly and continuously. Find the time needed to make the cup empty or find that it will never happen. It is guaranteed that if it is possible to drink all water, it will happen not later than after 104 seconds. Note one milliliter equals to one cubic centimeter. Input Specification: The only line of the input contains four integer numbers *d*,<=*h*,<=*v*,<=*e* (1<=≀<=*d*,<=*h*,<=*v*,<=*e*<=≀<=104), where: - *d* β€” the diameter of your cylindrical cup, - *h* β€” the initial level of water in the cup, - *v* β€” the speed of drinking process from the cup in milliliters per second, - *e* β€” the growth of water because of rain if you do not drink from the cup. Output Specification: If it is impossible to make the cup empty, print "NO" (without quotes). Otherwise print "YES" (without quotes) in the first line. In the second line print a real number β€” time in seconds needed the cup will be empty. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=4. It is guaranteed that if the answer exists, it doesn't exceed 104. Demo Input: ['1 2 3 100\n', '1 1 1 1\n'] Demo Output: ['NO\n', 'YES\n3.659792366325\n'] Note: In the first example the water fills the cup faster than you can drink from it. In the second example area of the cup's bottom equals to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/419dc74dcd7bc392019c9fe748fe1fdb08ab521a.png" style="max-width: 100.0%;max-height: 100.0%;"/>, thus we can conclude that you decrease the level of water by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e8edb237e1f805fe83c2f47e48d3a9d03f2ee304.png" style="max-width: 100.0%;max-height: 100.0%;"/> centimeters per second. At the same time water level increases by 1 centimeter per second due to rain. Thus, cup will be empty in <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9dae615d7e2c5c7c03cb478848fb06aba1a8942e.png" style="max-width: 100.0%;max-height: 100.0%;"/> seconds.
```python d,h,v,e = map(int,input().split(' ')) PI = 3.1415926 S = (d/2)*(d/2)*PI V = h*S V2 = e*S if(V2 >= v): print("NO") exit else: print("YES") print(abs(V/(V2-v))) ```
3
166
A
Rank List
PROGRAMMING
1,100
[ "binary search", "implementation", "sortings" ]
null
null
Another programming contest is over. You got hold of the contest's final results table. The table has the following data. For each team we are shown two numbers: the number of problems and the total penalty time. However, for no team we are shown its final place. You know the rules of comparing the results of two given teams very well. Let's say that team *a* solved *p**a* problems with total penalty time *t**a* and team *b* solved *p**b* problems with total penalty time *t**b*. Team *a* gets a higher place than team *b* in the end, if it either solved more problems on the contest, or solved the same number of problems but in less total time. In other words, team *a* gets a higher place than team *b* in the final results' table if either *p**a*<=&gt;<=*p**b*, or *p**a*<==<=*p**b* and *t**a*<=&lt;<=*t**b*. It is considered that the teams that solve the same number of problems with the same penalty time share all corresponding places. More formally, let's say there is a group of *x* teams that solved the same number of problems with the same penalty time. Let's also say that *y* teams performed better than the teams from this group. In this case all teams from the group share places *y*<=+<=1, *y*<=+<=2, ..., *y*<=+<=*x*. The teams that performed worse than the teams from this group, get their places in the results table starting from the *y*<=+<=*x*<=+<=1-th place. Your task is to count what number of teams from the given list shared the *k*-th place.
The first line contains two integers *n* and *k* (1<=≀<=*k*<=≀<=*n*<=≀<=50). Then *n* lines contain the description of the teams: the *i*-th line contains two integers *p**i* and *t**i* (1<=≀<=*p**i*,<=*t**i*<=≀<=50) β€” the number of solved problems and the total penalty time of the *i*-th team, correspondingly. All numbers in the lines are separated by spaces.
In the only line print the sought number of teams that got the *k*-th place in the final results' table.
[ "7 2\n4 10\n4 10\n4 10\n3 20\n2 1\n2 1\n1 10\n", "5 4\n3 1\n3 1\n5 3\n3 1\n3 1\n" ]
[ "3\n", "4\n" ]
The final results' table for the first sample is: - 1-3 places β€” 4 solved problems, the penalty time equals 10 - 4 place β€” 3 solved problems, the penalty time equals 20 - 5-6 places β€” 2 solved problems, the penalty time equals 1 - 7 place β€” 1 solved problem, the penalty time equals 10 The table shows that the second place is shared by the teams that solved 4 problems with penalty time 10. There are 3 such teams. The final table for the second sample is: - 1 place β€” 5 solved problems, the penalty time equals 3 - 2-5 places β€” 3 solved problems, the penalty time equals 1 The table shows that the fourth place is shared by the teams that solved 3 problems with penalty time 1. There are 4 such teams.
500
[ { "input": "7 2\n4 10\n4 10\n4 10\n3 20\n2 1\n2 1\n1 10", "output": "3" }, { "input": "5 4\n3 1\n3 1\n5 3\n3 1\n3 1", "output": "4" }, { "input": "5 1\n2 2\n1 1\n1 1\n1 1\n2 2", "output": "2" }, { "input": "6 3\n2 2\n3 1\n2 2\n4 5\n2 2\n4 5", "output": "1" }, { "input": "5 5\n3 1\n10 2\n2 2\n1 10\n10 2", "output": "1" }, { "input": "3 2\n3 3\n3 3\n3 3", "output": "3" }, { "input": "4 3\n10 3\n6 10\n5 2\n5 2", "output": "2" }, { "input": "5 3\n10 10\n10 10\n1 1\n10 10\n4 3", "output": "3" }, { "input": "3 1\n2 1\n1 1\n1 2", "output": "1" }, { "input": "1 1\n28 28", "output": "1" }, { "input": "2 2\n1 2\n1 2", "output": "2" }, { "input": "5 3\n2 3\n4 2\n5 3\n2 4\n3 5", "output": "1" }, { "input": "50 22\n4 9\n8 1\n3 7\n1 2\n3 8\n9 8\n8 5\n2 10\n5 8\n1 3\n1 8\n2 3\n7 9\n10 2\n9 9\n7 3\n8 6\n10 6\n5 4\n8 1\n1 5\n6 8\n9 5\n9 5\n3 2\n3 3\n3 8\n7 5\n4 5\n8 10\n8 2\n3 5\n3 2\n1 1\n7 2\n2 7\n6 8\n10 4\n7 5\n1 7\n6 5\n3 1\n4 9\n2 3\n3 6\n5 8\n4 10\n10 7\n7 10\n9 8", "output": "1" }, { "input": "50 6\n11 20\n18 13\n1 13\n3 11\n4 17\n15 10\n15 8\n9 16\n11 17\n16 3\n3 20\n14 13\n12 15\n9 10\n14 2\n12 12\n13 17\n6 10\n20 9\n2 8\n13 7\n7 20\n15 3\n1 20\n2 13\n2 5\n14 7\n10 13\n15 12\n15 5\n17 6\n9 11\n18 5\n10 1\n15 14\n3 16\n6 12\n4 1\n14 9\n7 14\n8 17\n17 13\n4 6\n19 16\n5 6\n3 15\n4 19\n15 20\n2 10\n20 10", "output": "1" }, { "input": "50 12\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "50" }, { "input": "50 28\n2 2\n1 1\n2 1\n1 2\n1 1\n1 1\n1 1\n2 2\n2 2\n2 2\n2 1\n2 2\n2 1\n2 1\n1 2\n1 2\n1 2\n1 1\n2 2\n1 2\n2 2\n2 2\n2 1\n1 1\n1 2\n1 2\n1 1\n1 1\n1 1\n2 2\n2 1\n2 1\n2 2\n1 2\n1 2\n1 2\n1 1\n2 2\n1 2\n1 1\n2 2\n2 2\n1 1\n2 1\n2 1\n1 1\n2 2\n2 2\n2 2\n2 2", "output": "13" }, { "input": "50 40\n2 3\n3 1\n2 1\n2 1\n2 1\n3 1\n1 1\n1 2\n2 3\n1 3\n1 3\n2 1\n3 1\n1 1\n3 1\n3 1\n2 2\n1 1\n3 3\n3 1\n3 2\n2 3\n3 3\n3 1\n1 3\n2 3\n2 1\n3 2\n3 3\n3 1\n2 1\n2 2\n1 3\n3 3\n1 1\n3 2\n1 2\n2 3\n2 1\n2 2\n3 2\n1 3\n3 1\n1 1\n3 3\n2 3\n2 1\n2 3\n2 3\n1 2", "output": "5" }, { "input": "50 16\n2 1\n3 2\n5 2\n2 2\n3 4\n4 4\n3 3\n4 1\n2 3\n1 5\n4 1\n2 2\n1 5\n3 2\n2 1\n5 4\n5 2\n5 4\n1 1\n3 5\n2 1\n4 5\n5 1\n5 5\n5 4\n2 4\n1 2\n5 5\n4 4\n1 5\n4 2\n5 1\n2 4\n2 5\n2 2\n3 4\n3 1\n1 1\n5 5\n2 2\n3 4\n2 4\n5 2\n4 1\n3 1\n1 1\n4 1\n4 4\n1 4\n1 3", "output": "1" }, { "input": "50 32\n6 6\n4 2\n5 5\n1 1\n2 4\n6 5\n2 3\n6 5\n2 3\n6 3\n1 4\n1 6\n3 3\n2 4\n3 2\n6 2\n4 1\n3 3\n3 1\n5 5\n1 2\n2 1\n5 4\n3 1\n4 4\n5 6\n4 1\n2 5\n3 1\n4 6\n2 3\n1 1\n6 5\n2 6\n3 3\n2 6\n2 3\n2 6\n3 4\n2 6\n4 5\n5 4\n1 6\n3 2\n5 1\n4 1\n4 6\n4 2\n1 2\n5 2", "output": "1" }, { "input": "50 48\n5 1\n6 4\n3 2\n2 1\n4 7\n3 6\n7 1\n7 5\n6 5\n5 6\n4 7\n5 7\n5 7\n5 5\n7 3\n3 5\n4 3\n5 4\n6 2\n1 6\n6 3\n6 5\n5 2\n4 2\n3 1\n1 1\n5 6\n1 3\n6 5\n3 7\n1 5\n7 5\n6 5\n3 6\n2 7\n5 3\n5 3\n4 7\n5 2\n6 5\n5 7\n7 1\n2 3\n5 5\n2 6\n4 1\n6 2\n6 5\n3 3\n1 6", "output": "1" }, { "input": "50 8\n5 3\n7 3\n4 3\n7 4\n2 2\n4 4\n5 4\n1 1\n7 7\n4 8\n1 1\n6 3\n1 5\n7 3\n6 5\n4 5\n8 6\n3 6\n2 1\n3 2\n2 5\n7 6\n5 8\n1 3\n5 5\n8 4\n4 5\n4 4\n8 8\n7 2\n7 2\n3 6\n2 8\n8 3\n3 2\n4 5\n8 1\n3 2\n8 7\n6 3\n2 3\n5 1\n3 4\n7 2\n6 3\n7 3\n3 3\n6 4\n2 2\n5 1", "output": "3" }, { "input": "20 16\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "20" }, { "input": "20 20\n1 2\n2 2\n1 1\n2 1\n2 2\n1 1\n1 1\n2 1\n1 1\n1 2\n2 2\n1 2\n1 2\n2 2\n2 2\n1 2\n2 1\n2 1\n1 2\n2 2", "output": "6" }, { "input": "30 16\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "30" }, { "input": "30 22\n2 1\n1 2\n2 1\n2 2\n2 1\n1 2\n2 2\n1 2\n2 2\n1 2\n2 2\n1 2\n1 2\n2 1\n1 2\n2 2\n2 2\n1 2\n2 1\n1 1\n1 2\n1 2\n1 1\n1 2\n1 2\n2 2\n1 2\n2 2\n2 1\n1 1", "output": "13" }, { "input": "30 22\n1 1\n1 3\n2 3\n3 1\n2 3\n3 1\n1 2\n3 3\n2 1\n2 1\n2 2\n3 1\n3 2\n2 3\n3 1\n1 3\n2 3\n3 1\n1 2\n1 2\n2 3\n2 1\n3 3\n3 2\n1 3\n3 3\n3 3\n3 3\n3 3\n3 1", "output": "5" }, { "input": "50 16\n2 1\n3 2\n5 2\n2 2\n3 4\n4 4\n3 3\n4 1\n2 3\n1 5\n4 1\n2 2\n1 5\n3 2\n2 1\n5 4\n5 2\n5 4\n1 1\n3 5\n2 1\n4 5\n5 1\n5 5\n5 4\n2 4\n1 2\n5 5\n4 4\n1 5\n4 2\n5 1\n2 4\n2 5\n2 2\n3 4\n3 1\n1 1\n5 5\n2 2\n3 4\n2 4\n5 2\n4 1\n3 1\n1 1\n4 1\n4 4\n1 4\n1 3", "output": "1" }, { "input": "50 22\n4 9\n8 1\n3 7\n1 2\n3 8\n9 8\n8 5\n2 10\n5 8\n1 3\n1 8\n2 3\n7 9\n10 2\n9 9\n7 3\n8 6\n10 6\n5 4\n8 1\n1 5\n6 8\n9 5\n9 5\n3 2\n3 3\n3 8\n7 5\n4 5\n8 10\n8 2\n3 5\n3 2\n1 1\n7 2\n2 7\n6 8\n10 4\n7 5\n1 7\n6 5\n3 1\n4 9\n2 3\n3 6\n5 8\n4 10\n10 7\n7 10\n9 8", "output": "1" }, { "input": "50 22\n29 15\n18 10\n6 23\n38 28\n34 40\n40 1\n16 26\n22 33\n14 30\n26 7\n15 16\n22 40\n14 15\n6 28\n32 27\n33 3\n38 22\n40 17\n16 27\n21 27\n34 26\n5 15\n34 9\n38 23\n7 36\n17 6\n19 37\n40 1\n10 28\n9 14\n8 31\n40 8\n14 2\n24 16\n38 33\n3 37\n2 9\n21 21\n40 26\n28 33\n24 31\n10 12\n27 27\n17 4\n38 5\n21 31\n5 12\n29 7\n39 12\n26 14", "output": "1" }, { "input": "50 14\n4 20\n37 50\n46 19\n20 25\n47 10\n6 34\n12 41\n47 9\n22 28\n41 34\n47 40\n12 42\n9 4\n15 15\n27 8\n38 9\n4 17\n8 13\n47 7\n9 38\n30 48\n50 7\n41 34\n23 11\n16 37\n2 32\n18 46\n37 48\n47 41\n13 9\n24 50\n46 14\n33 49\n9 50\n35 30\n49 44\n42 49\n39 15\n33 42\n3 18\n44 15\n44 28\n9 17\n16 4\n10 36\n4 22\n47 17\n24 12\n2 31\n6 30", "output": "2" }, { "input": "2 1\n50 50\n50 50", "output": "2" }, { "input": "2 2\n50 50\n50 50", "output": "2" }, { "input": "2 1\n50 50\n50 49", "output": "1" }, { "input": "2 2\n50 50\n50 49", "output": "1" }, { "input": "50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50", "output": "50" }, { "input": "50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n49 50", "output": "1" }, { "input": "50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 49", "output": "49" }, { "input": "10 1\n3 1\n3 2\n3 2\n2 3\n2 3\n2 3\n2 4\n2 4\n2 4\n2 4", "output": "1" }, { "input": "4 3\n1 1\n1 2\n2 1\n2 2", "output": "1" }, { "input": "4 2\n1 2\n1 3\n1 5\n1 2", "output": "2" }, { "input": "6 1\n4 3\n4 2\n5 1\n5 2\n5 3\n5 3", "output": "1" }, { "input": "5 3\n2 1\n1 3\n1 2\n1 1\n1 1", "output": "2" }, { "input": "3 1\n1 1\n1 2\n1 3", "output": "1" }, { "input": "10 10\n3 1\n3 2\n3 2\n2 3\n2 3\n2 3\n2 4\n2 4\n2 4\n2 4", "output": "4" }, { "input": "5 1\n5 5\n5 6\n5 7\n5 8\n5 5", "output": "2" }, { "input": "4 1\n1 1\n1 1\n1 2\n1 3", "output": "2" } ]
1,669,179,464
2,147,483,647
PyPy 3
OK
TESTS
46
186
307,200
from collections import defaultdict import sys, os, io input = io.BytesIO(os.read(0, os.fstat(0).st_size)).readline n, k = map(int, input().split()) x = [] for _ in range(n): p, t = map(int, input().split()) x.append(50 * p + 50 - t) x.sort() cnt = defaultdict(lambda : 0) for i in x: cnt[i] += 1 ans = cnt[x[-k]] print(ans)
Title: Rank List Time Limit: None seconds Memory Limit: None megabytes Problem Description: Another programming contest is over. You got hold of the contest's final results table. The table has the following data. For each team we are shown two numbers: the number of problems and the total penalty time. However, for no team we are shown its final place. You know the rules of comparing the results of two given teams very well. Let's say that team *a* solved *p**a* problems with total penalty time *t**a* and team *b* solved *p**b* problems with total penalty time *t**b*. Team *a* gets a higher place than team *b* in the end, if it either solved more problems on the contest, or solved the same number of problems but in less total time. In other words, team *a* gets a higher place than team *b* in the final results' table if either *p**a*<=&gt;<=*p**b*, or *p**a*<==<=*p**b* and *t**a*<=&lt;<=*t**b*. It is considered that the teams that solve the same number of problems with the same penalty time share all corresponding places. More formally, let's say there is a group of *x* teams that solved the same number of problems with the same penalty time. Let's also say that *y* teams performed better than the teams from this group. In this case all teams from the group share places *y*<=+<=1, *y*<=+<=2, ..., *y*<=+<=*x*. The teams that performed worse than the teams from this group, get their places in the results table starting from the *y*<=+<=*x*<=+<=1-th place. Your task is to count what number of teams from the given list shared the *k*-th place. Input Specification: The first line contains two integers *n* and *k* (1<=≀<=*k*<=≀<=*n*<=≀<=50). Then *n* lines contain the description of the teams: the *i*-th line contains two integers *p**i* and *t**i* (1<=≀<=*p**i*,<=*t**i*<=≀<=50) β€” the number of solved problems and the total penalty time of the *i*-th team, correspondingly. All numbers in the lines are separated by spaces. Output Specification: In the only line print the sought number of teams that got the *k*-th place in the final results' table. Demo Input: ['7 2\n4 10\n4 10\n4 10\n3 20\n2 1\n2 1\n1 10\n', '5 4\n3 1\n3 1\n5 3\n3 1\n3 1\n'] Demo Output: ['3\n', '4\n'] Note: The final results' table for the first sample is: - 1-3 places β€” 4 solved problems, the penalty time equals 10 - 4 place β€” 3 solved problems, the penalty time equals 20 - 5-6 places β€” 2 solved problems, the penalty time equals 1 - 7 place β€” 1 solved problem, the penalty time equals 10 The table shows that the second place is shared by the teams that solved 4 problems with penalty time 10. There are 3 such teams. The final table for the second sample is: - 1 place β€” 5 solved problems, the penalty time equals 3 - 2-5 places β€” 3 solved problems, the penalty time equals 1 The table shows that the fourth place is shared by the teams that solved 3 problems with penalty time 1. There are 4 such teams.
```python from collections import defaultdict import sys, os, io input = io.BytesIO(os.read(0, os.fstat(0).st_size)).readline n, k = map(int, input().split()) x = [] for _ in range(n): p, t = map(int, input().split()) x.append(50 * p + 50 - t) x.sort() cnt = defaultdict(lambda : 0) for i in x: cnt[i] += 1 ans = cnt[x[-k]] print(ans) ```
3
386
A
Second-Price Auction
PROGRAMMING
800
[ "implementation" ]
null
null
In this problem we consider a special type of an auction, which is called the second-price auction. As in regular auction *n* bidders place a bid which is price a bidder ready to pay. The auction is closed, that is, each bidder secretly informs the organizer of the auction price he is willing to pay. After that, the auction winner is the participant who offered the highest price. However, he pay not the price he offers, but the highest price among the offers of other participants (hence the name: the second-price auction). Write a program that reads prices offered by bidders and finds the winner and the price he will pay. Consider that all of the offered prices are different.
The first line of the input contains *n* (2<=≀<=*n*<=≀<=1000) β€” number of bidders. The second line contains *n* distinct integer numbers *p*1,<=*p*2,<=... *p**n*, separated by single spaces (1<=≀<=*p**i*<=≀<=10000), where *p**i* stands for the price offered by the *i*-th bidder.
The single output line should contain two integers: index of the winner and the price he will pay. Indices are 1-based.
[ "2\n5 7\n", "3\n10 2 8\n", "6\n3 8 2 9 4 14\n" ]
[ "2 5\n", "1 8\n", "6 9\n" ]
none
500
[ { "input": "2\n5 7", "output": "2 5" }, { "input": "3\n10 2 8", "output": "1 8" }, { "input": "6\n3 8 2 9 4 14", "output": "6 9" }, { "input": "4\n4707 7586 4221 5842", "output": "2 5842" }, { "input": "5\n3304 4227 4869 6937 6002", "output": "4 6002" }, { "input": "6\n5083 3289 7708 5362 9031 7458", "output": "5 7708" }, { "input": "7\n9038 6222 3392 1706 3778 1807 2657", "output": "1 6222" }, { "input": "8\n7062 2194 4481 3864 7470 1814 8091 733", "output": "7 7470" }, { "input": "9\n2678 5659 9199 2628 7906 7496 4524 2663 3408", "output": "3 7906" }, { "input": "2\n3458 1504", "output": "1 1504" }, { "input": "50\n9237 3904 407 9052 6657 9229 9752 3888 7732 2512 4614 1055 2355 7108 6506 6849 2529 8862 159 8630 7906 7941 960 8470 333 8659 54 9475 3163 5625 6393 6814 2656 3388 169 7918 4881 8468 9983 6281 6340 280 5108 2996 101 7617 3313 8172 326 1991", "output": "39 9752" }, { "input": "100\n2515 3324 7975 6171 4240 1217 4829 5203 8603 6900 3031 4699 4732 6070 4221 3228 6497 7359 9130 4346 4619 1109 3945 5442 3271 16 9711 2045 6410 2301 3406 8125 6003 1892 1260 9661 3940 6692 4708 7027 4930 6925 1979 5361 4263 3144 867 8639 6230 5562 9714 3676 4231 3347 4733 4920 4881 3431 1059 7313 8912 3038 9308 72 9583 7009 3034 7425 2398 6141 3245 2495 2933 6710 8289 9806 1226 8393 7349 6462 1618 9613 3546 6012 2964 9995 1578 210 2123 4874 1252 8625 348 8020 803 7244 9080 5088 706 2602", "output": "86 9806" }, { "input": "2\n2 1", "output": "1 1" }, { "input": "2\n1 2", "output": "2 1" }, { "input": "3\n10 20 30", "output": "3 20" }, { "input": "3\n10 30 20", "output": "2 20" }, { "input": "3\n20 10 30", "output": "3 20" }, { "input": "3\n20 30 10", "output": "2 20" }, { "input": "3\n30 10 20", "output": "1 20" }, { "input": "3\n30 20 10", "output": "1 20" }, { "input": "2\n1 10000", "output": "2 1" }, { "input": "2\n10000 999", "output": "1 999" }, { "input": "3\n3 4 1", "output": "2 3" }, { "input": "6\n1 2 24 6 5 7", "output": "3 7" } ]
1,641,466,731
2,147,483,647
PyPy 3-64
OK
TESTS
42
108
0
n = int(input()) arr = list(map(int, input().split())) arr2 = [i for i in arr] arr2.sort() x = arr2[-1] y = arr2[-2] print(arr.index(x)+1, end = " ") print(y)
Title: Second-Price Auction Time Limit: None seconds Memory Limit: None megabytes Problem Description: In this problem we consider a special type of an auction, which is called the second-price auction. As in regular auction *n* bidders place a bid which is price a bidder ready to pay. The auction is closed, that is, each bidder secretly informs the organizer of the auction price he is willing to pay. After that, the auction winner is the participant who offered the highest price. However, he pay not the price he offers, but the highest price among the offers of other participants (hence the name: the second-price auction). Write a program that reads prices offered by bidders and finds the winner and the price he will pay. Consider that all of the offered prices are different. Input Specification: The first line of the input contains *n* (2<=≀<=*n*<=≀<=1000) β€” number of bidders. The second line contains *n* distinct integer numbers *p*1,<=*p*2,<=... *p**n*, separated by single spaces (1<=≀<=*p**i*<=≀<=10000), where *p**i* stands for the price offered by the *i*-th bidder. Output Specification: The single output line should contain two integers: index of the winner and the price he will pay. Indices are 1-based. Demo Input: ['2\n5 7\n', '3\n10 2 8\n', '6\n3 8 2 9 4 14\n'] Demo Output: ['2 5\n', '1 8\n', '6 9\n'] Note: none
```python n = int(input()) arr = list(map(int, input().split())) arr2 = [i for i in arr] arr2.sort() x = arr2[-1] y = arr2[-2] print(arr.index(x)+1, end = " ") print(y) ```
3
964
A
Splits
PROGRAMMING
800
[ "math" ]
null
null
Let's define a split of $n$ as a nonincreasing sequence of positive integers, the sum of which is $n$. For example, the following sequences are splits of $8$: $[4, 4]$, $[3, 3, 2]$, $[2, 2, 1, 1, 1, 1]$, $[5, 2, 1]$. The following sequences aren't splits of $8$: $[1, 7]$, $[5, 4]$, $[11, -3]$, $[1, 1, 4, 1, 1]$. The weight of a split is the number of elements in the split that are equal to the first element. For example, the weight of the split $[1, 1, 1, 1, 1]$ is $5$, the weight of the split $[5, 5, 3, 3, 3]$ is $2$ and the weight of the split $[9]$ equals $1$. For a given $n$, find out the number of different weights of its splits.
The first line contains one integer $n$ ($1 \leq n \leq 10^9$).
Output one integerΒ β€” the answer to the problem.
[ "7\n", "8\n", "9\n" ]
[ "4\n", "5\n", "5\n" ]
In the first sample, there are following possible weights of splits of $7$: Weight 1: [$\textbf 7$] Weight 2: [$\textbf 3$, $\textbf 3$, 1] Weight 3: [$\textbf 2$, $\textbf 2$, $\textbf 2$, 1] Weight 7: [$\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$]
500
[ { "input": "7", "output": "4" }, { "input": "8", "output": "5" }, { "input": "9", "output": "5" }, { "input": "1", "output": "1" }, { "input": "286", "output": "144" }, { "input": "48", "output": "25" }, { "input": "941", "output": "471" }, { "input": "45154", "output": "22578" }, { "input": "60324", "output": "30163" }, { "input": "91840", "output": "45921" }, { "input": "41909", "output": "20955" }, { "input": "58288", "output": "29145" }, { "input": "91641", "output": "45821" }, { "input": "62258", "output": "31130" }, { "input": "79811", "output": "39906" }, { "input": "88740", "output": "44371" }, { "input": "12351", "output": "6176" }, { "input": "1960", "output": "981" }, { "input": "29239", "output": "14620" }, { "input": "85801", "output": "42901" }, { "input": "43255", "output": "21628" }, { "input": "13439", "output": "6720" }, { "input": "35668", "output": "17835" }, { "input": "19122", "output": "9562" }, { "input": "60169", "output": "30085" }, { "input": "50588", "output": "25295" }, { "input": "2467", "output": "1234" }, { "input": "39315", "output": "19658" }, { "input": "29950", "output": "14976" }, { "input": "17286", "output": "8644" }, { "input": "7359066", "output": "3679534" }, { "input": "1016391", "output": "508196" }, { "input": "7928871", "output": "3964436" }, { "input": "3968891", "output": "1984446" }, { "input": "2636452", "output": "1318227" }, { "input": "5076901", "output": "2538451" }, { "input": "9870265", "output": "4935133" }, { "input": "2453786", "output": "1226894" }, { "input": "7263670", "output": "3631836" }, { "input": "1890845", "output": "945423" }, { "input": "574128507", "output": "287064254" }, { "input": "648476655", "output": "324238328" }, { "input": "97349542", "output": "48674772" }, { "input": "716489761", "output": "358244881" }, { "input": "858771038", "output": "429385520" }, { "input": "520778784", "output": "260389393" }, { "input": "439004204", "output": "219502103" }, { "input": "589992198", "output": "294996100" }, { "input": "371106544", "output": "185553273" }, { "input": "894241590", "output": "447120796" }, { "input": "123957268", "output": "61978635" }, { "input": "234149297", "output": "117074649" }, { "input": "789954052", "output": "394977027" }, { "input": "667978920", "output": "333989461" }, { "input": "154647261", "output": "77323631" }, { "input": "751453521", "output": "375726761" }, { "input": "848862308", "output": "424431155" }, { "input": "323926781", "output": "161963391" }, { "input": "576768825", "output": "288384413" }, { "input": "31293802", "output": "15646902" }, { "input": "2", "output": "2" }, { "input": "1000000000", "output": "500000001" }, { "input": "3", "output": "2" } ]
1,540,256,287
2,147,483,647
Python 3
OK
TESTS
63
124
0
q = int(input()) a = q//2 print(a+1)
Title: Splits Time Limit: None seconds Memory Limit: None megabytes Problem Description: Let's define a split of $n$ as a nonincreasing sequence of positive integers, the sum of which is $n$. For example, the following sequences are splits of $8$: $[4, 4]$, $[3, 3, 2]$, $[2, 2, 1, 1, 1, 1]$, $[5, 2, 1]$. The following sequences aren't splits of $8$: $[1, 7]$, $[5, 4]$, $[11, -3]$, $[1, 1, 4, 1, 1]$. The weight of a split is the number of elements in the split that are equal to the first element. For example, the weight of the split $[1, 1, 1, 1, 1]$ is $5$, the weight of the split $[5, 5, 3, 3, 3]$ is $2$ and the weight of the split $[9]$ equals $1$. For a given $n$, find out the number of different weights of its splits. Input Specification: The first line contains one integer $n$ ($1 \leq n \leq 10^9$). Output Specification: Output one integerΒ β€” the answer to the problem. Demo Input: ['7\n', '8\n', '9\n'] Demo Output: ['4\n', '5\n', '5\n'] Note: In the first sample, there are following possible weights of splits of $7$: Weight 1: [$\textbf 7$] Weight 2: [$\textbf 3$, $\textbf 3$, 1] Weight 3: [$\textbf 2$, $\textbf 2$, $\textbf 2$, 1] Weight 7: [$\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$]
```python q = int(input()) a = q//2 print(a+1) ```
3
520
A
Pangram
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
A word or a sentence in some language is called a pangram if all the characters of the alphabet of this language appear in it at least once. Pangrams are often used to demonstrate fonts in printing or test the output devices. You are given a string consisting of lowercase and uppercase Latin letters. Check whether this string is a pangram. We say that the string contains a letter of the Latin alphabet if this letter occurs in the string in uppercase or lowercase.
The first line contains a single integer *n* (1<=≀<=*n*<=≀<=100)Β β€” the number of characters in the string. The second line contains the string. The string consists only of uppercase and lowercase Latin letters.
Output "YES", if the string is a pangram and "NO" otherwise.
[ "12\ntoosmallword\n", "35\nTheQuickBrownFoxJumpsOverTheLazyDog\n" ]
[ "NO\n", "YES\n" ]
none
500
[ { "input": "12\ntoosmallword", "output": "NO" }, { "input": "35\nTheQuickBrownFoxJumpsOverTheLazyDog", "output": "YES" }, { "input": "1\na", "output": "NO" }, { "input": "26\nqwertyuiopasdfghjklzxcvbnm", "output": "YES" }, { "input": "26\nABCDEFGHIJKLMNOPQRSTUVWXYZ", "output": "YES" }, { "input": "48\nthereisasyetinsufficientdataforameaningfulanswer", "output": "NO" }, { "input": "30\nToBeOrNotToBeThatIsTheQuestion", "output": "NO" }, { "input": "30\njackdawslovemybigsphinxofquarz", "output": "NO" }, { "input": "31\nTHEFIVEBOXINGWIZARDSJUMPQUICKLY", "output": "YES" }, { "input": "26\naaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "NO" }, { "input": "26\nMGJYIZDKsbhpVeNFlquRTcWoAx", "output": "YES" }, { "input": "26\nfWMOhAPsbIVtyUEZrGNQXDklCJ", "output": "YES" }, { "input": "26\nngPMVFSThiRCwLEuyOAbKxQzDJ", "output": "YES" }, { "input": "25\nnxYTzLFwzNolAumjgcAboyxAj", "output": "NO" }, { "input": "26\npRWdodGdxUESvcScPGbUoooZsC", "output": "NO" }, { "input": "66\nBovdMlDzTaqKllZILFVfxbLGsRnzmtVVTmqiIDTYrossLEPlmsPrkUYtWEsGHVOnFj", "output": "NO" }, { "input": "100\nmKtsiDRJypUieHIkvJaMFkwaKxcCIbBszZQLIyPpCDCjhNpAnYFngLjRpnKWpKWtGnwoSteeZXuFHWQxxxOpFlNeYTwKocsXuCoa", "output": "YES" }, { "input": "26\nEoqxUbsLjPytUHMiFnvcGWZdRK", "output": "NO" }, { "input": "26\nvCUFRKElZOnjmXGylWQaHDiPst", "output": "NO" }, { "input": "26\nWtrPuaHdXLKJMsnvQfgOiJZBEY", "output": "NO" }, { "input": "26\npGiFluRteQwkaVoPszJyNBChxM", "output": "NO" }, { "input": "26\ncTUpqjPmANrdbzSFhlWIoKxgVY", "output": "NO" }, { "input": "26\nLndjgvAEuICHKxPwqYztosrmBN", "output": "NO" }, { "input": "26\nMdaXJrCipnOZLykfqHWEStevbU", "output": "NO" }, { "input": "26\nEjDWsVxfKTqGXRnUMOLYcIzPba", "output": "NO" }, { "input": "26\nxKwzRMpunYaqsdfaBgJcVElTHo", "output": "NO" }, { "input": "26\nnRYUQsTwCPLZkgshfEXvBdoiMa", "output": "NO" }, { "input": "26\nHNCQPfJutyAlDGsvRxZWMEbIdO", "output": "NO" }, { "input": "26\nDaHJIpvKznQcmUyWsTGObXRFDe", "output": "NO" }, { "input": "26\nkqvAnFAiRhzlJbtyuWedXSPcOG", "output": "NO" }, { "input": "26\nhlrvgdwsIOyjcmUZXtAKEqoBpF", "output": "NO" }, { "input": "26\njLfXXiMhBTcAwQVReGnpKzdsYu", "output": "NO" }, { "input": "26\nlNMcVuwItjxRBGAekjhyDsQOzf", "output": "NO" }, { "input": "26\nRkSwbNoYldUGtAZvpFMcxhIJFE", "output": "NO" }, { "input": "26\nDqspXZJTuONYieKgaHLMBwfVSC", "output": "NO" }, { "input": "26\necOyUkqNljFHRVXtIpWabGMLDz", "output": "NO" }, { "input": "26\nEKAvqZhBnPmVCDRlgWJfOusxYI", "output": "NO" }, { "input": "26\naLbgqeYchKdMrsZxIPFvTOWNjA", "output": "NO" }, { "input": "26\nxfpBLsndiqtacOCHGmeWUjRkYz", "output": "NO" }, { "input": "26\nXsbRKtqleZPNIVCdfUhyagAomJ", "output": "NO" }, { "input": "26\nAmVtbrwquEthZcjKPLiyDgSoNF", "output": "NO" }, { "input": "26\nOhvXDcwqAUmSEPRZGnjFLiKtNB", "output": "NO" }, { "input": "26\nEKWJqCFLRmstxVBdYuinpbhaOg", "output": "NO" }, { "input": "26\nmnbvcxxlkjhgfdsapoiuytrewq", "output": "NO" }, { "input": "26\naAbcdefghijklmnopqrstuvwxy", "output": "NO" }, { "input": "30\nABCDEFGHTYRIOPLabcdefghtyriopl", "output": "NO" }, { "input": "25\nabcdefghijklmnopqrstuvwxy", "output": "NO" }, { "input": "26\nabcdefhijklmnopqrstVxyzABC", "output": "NO" }, { "input": "25\nqwertyuiopasdfghjklxcvbnm", "output": "NO" }, { "input": "34\nTheQuickBrownFoxJumpsOverTheLayDog", "output": "NO" }, { "input": "26\nabcdefghigklmnopqrstuvwxyz", "output": "NO" }, { "input": "26\nabcdefghijklmnopqrstuvwxyA", "output": "NO" }, { "input": "50\nqazwsxedcrfvtgbyhnujmikolQWERTYUIOASDFGHJKLZXCVBNM", "output": "NO" }, { "input": "35\nTheQuickBrownFoxJumpsOverTheLasyDog", "output": "NO" }, { "input": "25\nbcdefghijklmnopqrstuvwxyz", "output": "NO" }, { "input": "38\nAbCdEfGhIjKlMnOpQrStVwXyZzzzzzzaaaaaaa", "output": "NO" }, { "input": "26\nabcdefghiklmnopqrstvxyzABC", "output": "NO" }, { "input": "26\nabcdefghijklmnopqrstuvwxzZ", "output": "NO" }, { "input": "50\nabcdefghijklmnopqrstuvwxyABCDEFGHIJKLMNOPQRSTUVWXY", "output": "NO" } ]
1,699,895,122
2,147,483,647
Python 3
OK
TESTS
59
46
0
n = int(input()) string = input().lower() # Convert the string to lowercase and create a set of unique letters unique_letters = set(string) # Check if the count of unique letters is 26 if len(unique_letters) == 26: print("YES") else: print("NO")
Title: Pangram Time Limit: None seconds Memory Limit: None megabytes Problem Description: A word or a sentence in some language is called a pangram if all the characters of the alphabet of this language appear in it at least once. Pangrams are often used to demonstrate fonts in printing or test the output devices. You are given a string consisting of lowercase and uppercase Latin letters. Check whether this string is a pangram. We say that the string contains a letter of the Latin alphabet if this letter occurs in the string in uppercase or lowercase. Input Specification: The first line contains a single integer *n* (1<=≀<=*n*<=≀<=100)Β β€” the number of characters in the string. The second line contains the string. The string consists only of uppercase and lowercase Latin letters. Output Specification: Output "YES", if the string is a pangram and "NO" otherwise. Demo Input: ['12\ntoosmallword\n', '35\nTheQuickBrownFoxJumpsOverTheLazyDog\n'] Demo Output: ['NO\n', 'YES\n'] Note: none
```python n = int(input()) string = input().lower() # Convert the string to lowercase and create a set of unique letters unique_letters = set(string) # Check if the count of unique letters is 26 if len(unique_letters) == 26: print("YES") else: print("NO") ```
3
867
A
Between the Offices
PROGRAMMING
800
[ "implementation" ]
null
null
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane. You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
The first line of input contains single integer *n* (2<=≀<=*n*<=≀<=100)Β β€” the number of days. The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise. You can print each letter in any case (upper or lower).
[ "4\nFSSF\n", "2\nSF\n", "10\nFFFFFFFFFF\n", "10\nSSFFSFFSFF\n" ]
[ "NO\n", "YES\n", "NO\n", "YES\n" ]
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO". In the second example you just flew from Seattle to San Francisco, so the answer is "YES". In the third example you stayed the whole period in San Francisco, so the answer is "NO". In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of Ο€ in binary representation. Not very useful information though.
500
[ { "input": "4\nFSSF", "output": "NO" }, { "input": "2\nSF", "output": "YES" }, { "input": "10\nFFFFFFFFFF", "output": "NO" }, { "input": "10\nSSFFSFFSFF", "output": "YES" }, { "input": "20\nSFSFFFFSSFFFFSSSSFSS", "output": "NO" }, { "input": "20\nSSFFFFFSFFFFFFFFFFFF", "output": "YES" }, { "input": "20\nSSFSFSFSFSFSFSFSSFSF", "output": "YES" }, { "input": "20\nSSSSFSFSSFSFSSSSSSFS", "output": "NO" }, { "input": "100\nFFFSFSFSFSSFSFFSSFFFFFSSSSFSSFFFFSFFFFFSFFFSSFSSSFFFFSSFFSSFSFFSSFSSSFSFFSFSFFSFSFFSSFFSFSSSSFSFSFSS", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFSS", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFFSFFFFFFFFFSFSSFFFFFFFFFFFFFFFFFFFFFFSFFSFFFFFSFFFFFFFFSFFFFFFFFFFFFFSFFFFFFFFSFFFFFFFSF", "output": "NO" }, { "input": "100\nSFFSSFFFFFFSSFFFSSFSFFFFFSSFFFSFFFFFFSFSSSFSFSFFFFSFSSFFFFFFFFSFFFFFSFFFFFSSFFFSFFSFSFFFFSFFSFFFFFFF", "output": "YES" }, { "input": "100\nFFFFSSSSSFFSSSFFFSFFFFFSFSSFSFFSFFSSFFSSFSFFFFFSFSFSFSFFFFFFFFFSFSFFSFFFFSFSFFFFFFFFFFFFSFSSFFSSSSFF", "output": "NO" }, { "input": "100\nFFFFFFFFFFFFSSFFFFSFSFFFSFSSSFSSSSSFSSSSFFSSFFFSFSFSSFFFSSSFFSFSFSSFSFSSFSFFFSFFFFFSSFSFFFSSSFSSSFFS", "output": "NO" }, { "input": "100\nFFFSSSFSFSSSSFSSFSFFSSSFFSSFSSFFSSFFSFSSSSFFFSFFFSFSFSSSFSSFSFSFSFFSSSSSFSSSFSFSFFSSFSFSSFFSSFSFFSFS", "output": "NO" }, { "input": "100\nFFSSSSFSSSFSSSSFSSSFFSFSSFFSSFSSSFSSSFFSFFSSSSSSSSSSSSFSSFSSSSFSFFFSSFFFFFFSFSFSSSSSSFSSSFSFSSFSSFSS", "output": "NO" }, { "input": "100\nSSSFFFSSSSFFSSSSSFSSSSFSSSFSSSSSFSSSSSSSSFSFFSSSFFSSFSSSSFFSSSSSSFFSSSSFSSSSSSFSSSFSSSSSSSFSSSSFSSSS", "output": "NO" }, { "input": "100\nFSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSSSSSSFSSSSSSSSSSSSSFSSFSSSSSFSSFSSSSSSSSSFFSSSSSFSFSSSFFSSSSSSSSSSSSS", "output": "NO" }, { "input": "100\nSSSSSSSSSSSSSFSSSSSSSSSSSSFSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSFS", "output": "NO" }, { "input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS", "output": "NO" }, { "input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "YES" }, { "input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFSFFFFFFFFFFFSFSFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFF", "output": "YES" }, { "input": "100\nSFFFFFFFFFFFFSSFFFFSFFFFFFFFFFFFFFFFFFFSFFFSSFFFFSFSFFFSFFFFFFFFFFFFFFFSSFFFFFFFFSSFFFFFFFFFFFFFFSFF", "output": "YES" }, { "input": "100\nSFFSSSFFSFSFSFFFFSSFFFFSFFFFFFFFSFSFFFSFFFSFFFSFFFFSFSFFFFFFFSFFFFFFFFFFSFFSSSFFSSFFFFSFFFFSFFFFSFFF", "output": "YES" }, { "input": "100\nSFFFSFFFFSFFFSSFFFSFSFFFSFFFSSFSFFFFFSFFFFFFFFSFSFSFFSFFFSFSSFSFFFSFSFFSSFSFSSSFFFFFFSSFSFFSFFFFFFFF", "output": "YES" }, { "input": "100\nSSSSFFFFSFFFFFFFSFFFFSFSFFFFSSFFFFFFFFFSFFSSFFFFFFSFSFSSFSSSFFFFFFFSFSFFFSSSFFFFFFFSFFFSSFFFFSSFFFSF", "output": "YES" }, { "input": "100\nSSSFSSFFFSFSSSSFSSFSSSSFSSFFFFFSFFSSSSFFSSSFSSSFSSSSFSSSSFSSSSSSSFSFSSFFFSSFFSFFSSSSFSSFFSFSSFSFFFSF", "output": "YES" }, { "input": "100\nSFFSFSSSSSSSFFSSSFSSSSFSFSSFFFSSSSSSFSSSSFSSFSSSFSSSSSSSFSSFSFFFSSFSSFSFSFSSSSSSSSSSSSFFFFSSSSSFSFFF", "output": "YES" }, { "input": "100\nSSSFSFFSFSFFSSSSSFSSSFSSSFFFSSSSSSSSSFSFSFSSSSFSFSSFFFFFSSSSSSSSSSSSSSSSSSSFFSSSSSFSFSSSSFFSSSSFSSSF", "output": "YES" }, { "input": "100\nSSSFSSSSSSSSSSFSSSSFSSSSSSFSSSSSSFSSSSSSSSSSSSSSFSSSFSSSFSSSSSSSSSSSFSSSSSSFSFSSSSFSSSSSSFSSSSSSSSFF", "output": "YES" }, { "input": "100\nSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFFSSSSSSSSSFSSSSSSSSSSSSSSSSSF", "output": "YES" }, { "input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSF", "output": "YES" }, { "input": "2\nSS", "output": "NO" } ]
1,639,978,022
2,147,483,647
PyPy 3-64
OK
TESTS
34
124
0
# import sys # sys.stdout = open('DSA/Stacks/output.txt', 'w') # sys.stdin = open('DSA/Stacks/input.txt', 'r') n = int(input()) ll = list(input()) se = 0 sf = 0 for i in range(len(ll)-1): if ll[i]=='S' and ll[i+1]=="F": sf+=1 elif ll[i]=='F' and ll[i+1]=="S": se+=1 if sf>se: print("YES") else: print("NO")
Title: Between the Offices Time Limit: None seconds Memory Limit: None megabytes Problem Description: As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane. You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not. Input Specification: The first line of input contains single integer *n* (2<=≀<=*n*<=≀<=100)Β β€” the number of days. The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence. Output Specification: Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise. You can print each letter in any case (upper or lower). Demo Input: ['4\nFSSF\n', '2\nSF\n', '10\nFFFFFFFFFF\n', '10\nSSFFSFFSFF\n'] Demo Output: ['NO\n', 'YES\n', 'NO\n', 'YES\n'] Note: In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO". In the second example you just flew from Seattle to San Francisco, so the answer is "YES". In the third example you stayed the whole period in San Francisco, so the answer is "NO". In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of Ο€ in binary representation. Not very useful information though.
```python # import sys # sys.stdout = open('DSA/Stacks/output.txt', 'w') # sys.stdin = open('DSA/Stacks/input.txt', 'r') n = int(input()) ll = list(input()) se = 0 sf = 0 for i in range(len(ll)-1): if ll[i]=='S' and ll[i+1]=="F": sf+=1 elif ll[i]=='F' and ll[i+1]=="S": se+=1 if sf>se: print("YES") else: print("NO") ```
3
399
B
Red and Blue Balls
PROGRAMMING
0
[]
null
null
User ainta has a stack of *n* red and blue balls. He can apply a certain operation which changes the colors of the balls inside the stack. - While the top ball inside the stack is red, pop the ball from the top of the stack. - Then replace the blue ball on the top with a red ball. - And finally push some blue balls to the stack until the stack has total of *n* balls inside. If there are no blue balls inside the stack, ainta can't apply this operation. Given the initial state of the stack, ainta wants to know the maximum number of operations he can repeatedly apply.
The first line contains an integer *n* (1<=≀<=*n*<=≀<=50) β€” the number of balls inside the stack. The second line contains a string *s* (|*s*|<==<=*n*) describing the initial state of the stack. The *i*-th character of the string *s* denotes the color of the *i*-th ball (we'll number the balls from top to bottom of the stack). If the character is "R", the color is red. If the character is "B", the color is blue.
Print the maximum number of operations ainta can repeatedly apply. Please, do not write the %lld specifier to read or write 64-bit integers in Π‘++. It is preferred to use the cin, cout streams or the %I64d specifier.
[ "3\nRBR\n", "4\nRBBR\n", "5\nRBBRR\n" ]
[ "2\n", "6\n", "6\n" ]
The first example is depicted below. The explanation how user ainta applies the first operation. He pops out one red ball, changes the color of the ball in the middle from blue to red, and pushes one blue ball. The explanation how user ainta applies the second operation. He will not pop out red balls, he simply changes the color of the ball on the top from blue to red. From now on, ainta can't apply any operation because there are no blue balls inside the stack. ainta applied two operations, so the answer is 2. The second example is depicted below. The blue arrow denotes a single operation.
1,000
[ { "input": "3\nRBR", "output": "2" }, { "input": "4\nRBBR", "output": "6" }, { "input": "5\nRBBRR", "output": "6" }, { "input": "5\nRBRBR", "output": "10" }, { "input": "10\nRRBRRBBRRR", "output": "100" }, { "input": "10\nBRBRRRRRRR", "output": "5" }, { "input": "10\nBRRRRRRRRR", "output": "1" }, { "input": "20\nBRBRRRRRRRRRRRRRRRRR", "output": "5" }, { "input": "30\nRRBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "1073741820" }, { "input": "50\nBRRRBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "1125899906842609" }, { "input": "20\nRRRBRBBBBBRRRRRRRRRR", "output": "1000" }, { "input": "20\nRRBRBBBBBRRRRRRRRRRR", "output": "500" }, { "input": "1\nR", "output": "0" }, { "input": "1\nB", "output": "1" }, { "input": "2\nRR", "output": "0" }, { "input": "2\nBR", "output": "1" }, { "input": "50\nRRRRRRRRRRBBBBBBRRBBRRRBRRBBBRRRRRRRRRRRRRRRRRRRRR", "output": "479001600" }, { "input": "50\nRBRRRRRBRBRRBBBBBBRRRBRRRRRBBBRRBRRRRRBBBRRRRRRRRR", "output": "1929382195842" }, { "input": "48\nRBRBRRRRBRBRRBRRRRRRRBBBRRBRBRRRBBRRRRRRRRRRRRRR", "output": "13235135754" }, { "input": "30\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR", "output": "0" }, { "input": "50\nRRBBBBBBBBBBBBBBBBRBRRBBBRBBRBBBRRBRBBBBBRBBRBBRBR", "output": "402373705727996" }, { "input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB", "output": "1125899906842623" }, { "input": "19\nRRRRRBRRBRRRRBRBBBB", "output": "500000" }, { "input": "32\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBR", "output": "2147483647" }, { "input": "3\nBBB", "output": "7" }, { "input": "3\nBBR", "output": "3" }, { "input": "3\nBRB", "output": "5" }, { "input": "3\nBRR", "output": "1" }, { "input": "3\nRBB", "output": "6" }, { "input": "3\nRBR", "output": "2" }, { "input": "3\nRRB", "output": "4" }, { "input": "3\nRRR", "output": "0" }, { "input": "2\nRB", "output": "2" }, { "input": "2\nBB", "output": "3" } ]
1,566,686,277
2,147,483,647
Python 3
OK
TESTS
34
109
0
def do(): n = int(input()) stack = [s for s in input()][::-1] b = stack.count("B") res = 0 while b > 0: while stack and stack[-1] == "R": stack.pop() stack[-1] = "R" b -= 1 if len(stack) < n: res += (1 << (n - len(stack))) - 1 stack += ["R"] * (n - len(stack)) res += 1 return res print(do())
Title: Red and Blue Balls Time Limit: None seconds Memory Limit: None megabytes Problem Description: User ainta has a stack of *n* red and blue balls. He can apply a certain operation which changes the colors of the balls inside the stack. - While the top ball inside the stack is red, pop the ball from the top of the stack. - Then replace the blue ball on the top with a red ball. - And finally push some blue balls to the stack until the stack has total of *n* balls inside. If there are no blue balls inside the stack, ainta can't apply this operation. Given the initial state of the stack, ainta wants to know the maximum number of operations he can repeatedly apply. Input Specification: The first line contains an integer *n* (1<=≀<=*n*<=≀<=50) β€” the number of balls inside the stack. The second line contains a string *s* (|*s*|<==<=*n*) describing the initial state of the stack. The *i*-th character of the string *s* denotes the color of the *i*-th ball (we'll number the balls from top to bottom of the stack). If the character is "R", the color is red. If the character is "B", the color is blue. Output Specification: Print the maximum number of operations ainta can repeatedly apply. Please, do not write the %lld specifier to read or write 64-bit integers in Π‘++. It is preferred to use the cin, cout streams or the %I64d specifier. Demo Input: ['3\nRBR\n', '4\nRBBR\n', '5\nRBBRR\n'] Demo Output: ['2\n', '6\n', '6\n'] Note: The first example is depicted below. The explanation how user ainta applies the first operation. He pops out one red ball, changes the color of the ball in the middle from blue to red, and pushes one blue ball. The explanation how user ainta applies the second operation. He will not pop out red balls, he simply changes the color of the ball on the top from blue to red. From now on, ainta can't apply any operation because there are no blue balls inside the stack. ainta applied two operations, so the answer is 2. The second example is depicted below. The blue arrow denotes a single operation.
```python def do(): n = int(input()) stack = [s for s in input()][::-1] b = stack.count("B") res = 0 while b > 0: while stack and stack[-1] == "R": stack.pop() stack[-1] = "R" b -= 1 if len(stack) < n: res += (1 << (n - len(stack))) - 1 stack += ["R"] * (n - len(stack)) res += 1 return res print(do()) ```
3
500
A
New Year Transportation
PROGRAMMING
1,000
[ "dfs and similar", "graphs", "implementation" ]
null
null
New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=Γ—<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells. So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≀<=*i*<=≀<=*n*<=-<=1 the condition 1<=≀<=*a**i*<=≀<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≀<=*i*<=≀<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≀<=*a**i*<=≀<=*n*<=-<=*i* one can't leave the Line World using portals. Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system.
The first line contains two space-separated integers *n* (3<=≀<=*n*<=≀<=3<=Γ—<=104) and *t* (2<=≀<=*t*<=≀<=*n*) β€” the number of cells, and the index of the cell which I want to go to. The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≀<=*a**i*<=≀<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World.
If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO".
[ "8 4\n1 2 1 2 1 2 1\n", "8 5\n1 2 1 2 1 1 1\n" ]
[ "YES\n", "NO\n" ]
In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4. In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit.
500
[ { "input": "8 4\n1 2 1 2 1 2 1", "output": "YES" }, { "input": "8 5\n1 2 1 2 1 1 1", "output": "NO" }, { "input": "20 19\n13 16 7 6 12 1 5 7 8 6 5 7 5 5 3 3 2 2 1", "output": "YES" }, { "input": "50 49\n11 7 1 41 26 36 19 16 38 14 36 35 37 27 20 27 3 6 21 2 27 11 18 17 19 16 22 8 8 9 1 7 5 12 5 6 13 6 11 2 6 3 1 5 1 1 2 2 1", "output": "YES" }, { "input": "120 104\n41 15 95 85 34 11 25 42 65 39 77 80 74 17 66 73 21 14 36 63 63 79 45 24 65 7 63 80 51 21 2 19 78 28 71 2 15 23 17 68 62 18 54 39 43 70 3 46 34 23 41 65 32 10 13 18 10 3 16 48 54 18 57 28 3 24 44 50 15 2 20 22 45 44 3 29 2 27 11 2 12 25 25 31 1 2 32 4 11 30 13 16 26 21 1 13 21 8 15 5 18 13 5 15 3 8 13 6 5 1 9 7 1 2 4 1 1 2 1", "output": "NO" }, { "input": "10 3\n8 3 5 4 2 3 2 2 1", "output": "NO" }, { "input": "10 9\n8 3 5 4 2 3 2 2 1", "output": "YES" }, { "input": "3 2\n1 1", "output": "YES" }, { "input": "3 2\n2 1", "output": "NO" }, { "input": "4 2\n2 1 1", "output": "NO" }, { "input": "4 4\n2 2 1", "output": "YES" }, { "input": "8 8\n1 2 1 2 1 2 1", "output": "YES" }, { "input": "3 3\n1 1", "output": "YES" }, { "input": "8 8\n1 2 1 2 1 1 1", "output": "YES" }, { "input": "3 3\n2 1", "output": "YES" }, { "input": "4 4\n1 1 1", "output": "YES" }, { "input": "8 8\n1 1 1 1 1 1 1", "output": "YES" }, { "input": "5 5\n1 1 1 1", "output": "YES" } ]
1,662,471,387
2,147,483,647
Python 3
OK
TESTS
34
46
1,740,800
import math import sys # s,n=map(int,input().split()) # t=True # for m in range(int(input())): # n=int(input()) # s=input() n,k=map(int,input().split()) # ar=[a,b] arr=list(map(int,input().split())) ans=0 while(ans<k-1): ans+=arr[ans] if(ans==k-1): print("YES") else: print("NO")
Title: New Year Transportation Time Limit: None seconds Memory Limit: None megabytes Problem Description: New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=Γ—<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells. So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≀<=*i*<=≀<=*n*<=-<=1 the condition 1<=≀<=*a**i*<=≀<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≀<=*i*<=≀<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≀<=*a**i*<=≀<=*n*<=-<=*i* one can't leave the Line World using portals. Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system. Input Specification: The first line contains two space-separated integers *n* (3<=≀<=*n*<=≀<=3<=Γ—<=104) and *t* (2<=≀<=*t*<=≀<=*n*) β€” the number of cells, and the index of the cell which I want to go to. The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≀<=*a**i*<=≀<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World. Output Specification: If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO". Demo Input: ['8 4\n1 2 1 2 1 2 1\n', '8 5\n1 2 1 2 1 1 1\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4. In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit.
```python import math import sys # s,n=map(int,input().split()) # t=True # for m in range(int(input())): # n=int(input()) # s=input() n,k=map(int,input().split()) # ar=[a,b] arr=list(map(int,input().split())) ans=0 while(ans<k-1): ans+=arr[ans] if(ans==k-1): print("YES") else: print("NO") ```
3
935
A
Fafa and his Company
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
Fafa owns a company that works on huge projects. There are *n* employees in Fafa's company. Whenever the company has a new project to start working on, Fafa has to divide the tasks of this project among all the employees. Fafa finds doing this every time is very tiring for him. So, he decided to choose the best *l* employees in his company as team leaders. Whenever there is a new project, Fafa will divide the tasks among only the team leaders and each team leader will be responsible of some positive number of employees to give them the tasks. To make this process fair for the team leaders, each one of them should be responsible for the same number of employees. Moreover, every employee, who is not a team leader, has to be under the responsibility of exactly one team leader, and no team leader is responsible for another team leader. Given the number of employees *n*, find in how many ways Fafa could choose the number of team leaders *l* in such a way that it is possible to divide employees between them evenly.
The input consists of a single line containing a positive integer *n* (2<=≀<=*n*<=≀<=105) β€” the number of employees in Fafa's company.
Print a single integer representing the answer to the problem.
[ "2\n", "10\n" ]
[ "1\n", "3\n" ]
In the second sample Fafa has 3 ways: - choose only 1 employee as a team leader with 9 employees under his responsibility. - choose 2 employees as team leaders with 4 employees under the responsibility of each of them. - choose 5 employees as team leaders with 1 employee under the responsibility of each of them.
500
[ { "input": "2", "output": "1" }, { "input": "10", "output": "3" }, { "input": "3", "output": "1" }, { "input": "4", "output": "2" }, { "input": "6", "output": "3" }, { "input": "13", "output": "1" }, { "input": "100000", "output": "35" }, { "input": "1024", "output": "10" }, { "input": "99999", "output": "11" }, { "input": "10007", "output": "1" }, { "input": "4096", "output": "12" }, { "input": "65536", "output": "16" }, { "input": "40320", "output": "95" }, { "input": "30030", "output": "63" }, { "input": "161", "output": "3" }, { "input": "1000", "output": "15" }, { "input": "10000", "output": "24" }, { "input": "777", "output": "7" }, { "input": "121", "output": "2" }, { "input": "25", "output": "2" }, { "input": "40000", "output": "34" }, { "input": "99990", "output": "47" }, { "input": "98765", "output": "3" }, { "input": "56789", "output": "3" }, { "input": "13579", "output": "3" }, { "input": "97531", "output": "3" }, { "input": "12345", "output": "7" }, { "input": "54321", "output": "7" }, { "input": "83160", "output": "127" }, { "input": "9", "output": "2" }, { "input": "21", "output": "3" }, { "input": "11", "output": "1" }, { "input": "15", "output": "3" } ]
1,670,776,470
2,147,483,647
PyPy 3-64
OK
TESTS
33
62
1,331,200
# FAFA and his Company n = int(input()) w = 0 for i in range(1, n+1): if n-i != 0: if (n-i) % i == 0: w = w+1 print(w)
Title: Fafa and his Company Time Limit: None seconds Memory Limit: None megabytes Problem Description: Fafa owns a company that works on huge projects. There are *n* employees in Fafa's company. Whenever the company has a new project to start working on, Fafa has to divide the tasks of this project among all the employees. Fafa finds doing this every time is very tiring for him. So, he decided to choose the best *l* employees in his company as team leaders. Whenever there is a new project, Fafa will divide the tasks among only the team leaders and each team leader will be responsible of some positive number of employees to give them the tasks. To make this process fair for the team leaders, each one of them should be responsible for the same number of employees. Moreover, every employee, who is not a team leader, has to be under the responsibility of exactly one team leader, and no team leader is responsible for another team leader. Given the number of employees *n*, find in how many ways Fafa could choose the number of team leaders *l* in such a way that it is possible to divide employees between them evenly. Input Specification: The input consists of a single line containing a positive integer *n* (2<=≀<=*n*<=≀<=105) β€” the number of employees in Fafa's company. Output Specification: Print a single integer representing the answer to the problem. Demo Input: ['2\n', '10\n'] Demo Output: ['1\n', '3\n'] Note: In the second sample Fafa has 3 ways: - choose only 1 employee as a team leader with 9 employees under his responsibility. - choose 2 employees as team leaders with 4 employees under the responsibility of each of them. - choose 5 employees as team leaders with 1 employee under the responsibility of each of them.
```python # FAFA and his Company n = int(input()) w = 0 for i in range(1, n+1): if n-i != 0: if (n-i) % i == 0: w = w+1 print(w) ```
3
509
A
Maximum in Table
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
An *n*<=Γ—<=*n* table *a* is defined as follows: - The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1. These conditions define all the values in the table. You are given a number *n*. You need to determine the maximum value in the *n*<=Γ—<=*n* table defined by the rules above.
The only line of input contains a positive integer *n* (1<=≀<=*n*<=≀<=10) β€” the number of rows and columns of the table.
Print a single line containing a positive integer *m* β€” the maximum value in the table.
[ "1\n", "5\n" ]
[ "1", "70" ]
In the second test the rows of the table look as follows:
0
[ { "input": "1", "output": "1" }, { "input": "5", "output": "70" }, { "input": "2", "output": "2" }, { "input": "3", "output": "6" }, { "input": "4", "output": "20" }, { "input": "6", "output": "252" }, { "input": "7", "output": "924" }, { "input": "9", "output": "12870" }, { "input": "10", "output": "48620" }, { "input": "8", "output": "3432" } ]
1,595,171,881
2,147,483,647
Python 3
OK
TESTS
10
108
6,963,200
t=int(input()) n=[[1 for x in range(t)]for x in range(t)] for x in range(t-1): for y in range(t-1-x): n[x+1][y+x+1]=n[x+1][y+x]+n[x][y+x+1] n[y+x+1][x+1]=n[x+y][x+1]+n[y+x+1][x] print(n[-1][-1])
Title: Maximum in Table Time Limit: None seconds Memory Limit: None megabytes Problem Description: An *n*<=Γ—<=*n* table *a* is defined as follows: - The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1. These conditions define all the values in the table. You are given a number *n*. You need to determine the maximum value in the *n*<=Γ—<=*n* table defined by the rules above. Input Specification: The only line of input contains a positive integer *n* (1<=≀<=*n*<=≀<=10) β€” the number of rows and columns of the table. Output Specification: Print a single line containing a positive integer *m* β€” the maximum value in the table. Demo Input: ['1\n', '5\n'] Demo Output: ['1', '70'] Note: In the second test the rows of the table look as follows:
```python t=int(input()) n=[[1 for x in range(t)]for x in range(t)] for x in range(t-1): for y in range(t-1-x): n[x+1][y+x+1]=n[x+1][y+x]+n[x][y+x+1] n[y+x+1][x+1]=n[x+y][x+1]+n[y+x+1][x] print(n[-1][-1]) ```
3
577
A
Multiplication Table
PROGRAMMING
1,000
[ "implementation", "number theory" ]
null
null
Let's consider a table consisting of *n* rows and *n* columns. The cell located at the intersection of *i*-th row and *j*-th column contains number *i*<=Γ—<=*j*. The rows and columns are numbered starting from 1. You are given a positive integer *x*. Your task is to count the number of cells in a table that contain number *x*.
The single line contains numbers *n* and *x* (1<=≀<=*n*<=≀<=105, 1<=≀<=*x*<=≀<=109) β€” the size of the table and the number that we are looking for in the table.
Print a single number: the number of times *x* occurs in the table.
[ "10 5\n", "6 12\n", "5 13\n" ]
[ "2\n", "4\n", "0\n" ]
A table for the second sample test is given below. The occurrences of number 12 are marked bold.
500
[ { "input": "10 5", "output": "2" }, { "input": "6 12", "output": "4" }, { "input": "5 13", "output": "0" }, { "input": "1 1", "output": "1" }, { "input": "2 1", "output": "1" }, { "input": "100000 1", "output": "1" }, { "input": "1 1000000000", "output": "0" }, { "input": "100000 1000000000", "output": "16" }, { "input": "100000 362880", "output": "154" }, { "input": "1 4", "output": "0" }, { "input": "9 12", "output": "4" }, { "input": "10 123", "output": "0" }, { "input": "9551 975275379", "output": "0" }, { "input": "17286 948615687", "output": "0" }, { "input": "58942 936593001", "output": "0" }, { "input": "50000 989460910", "output": "4" }, { "input": "22741 989460910", "output": "0" }, { "input": "22740 989460910", "output": "0" }, { "input": "100000 989460910", "output": "4" }, { "input": "100000 98280", "output": "128" }, { "input": "100000 997920", "output": "222" }, { "input": "100000 720720", "output": "226" }, { "input": "100000 2162160", "output": "282" }, { "input": "100000 4324320", "output": "320" }, { "input": "100000 8648640", "output": "348" }, { "input": "100000 183783600", "output": "438" }, { "input": "100000 551350800", "output": "392" }, { "input": "40000 551350800", "output": "150" }, { "input": "20000 400000000", "output": "1" }, { "input": "19999 400000000", "output": "0" }, { "input": "19999 399960001", "output": "1" }, { "input": "31621 999887641", "output": "1" }, { "input": "31622 999887641", "output": "1" }, { "input": "31620 999887641", "output": "0" }, { "input": "100000 999887641", "output": "3" }, { "input": "100000 25", "output": "3" }, { "input": "100000 1", "output": "1" }, { "input": "100000 3628800", "output": "220" }, { "input": "100000 39916800", "output": "328" }, { "input": "100000 479001600", "output": "254" }, { "input": "4 9", "output": "1" }, { "input": "2 6", "output": "0" }, { "input": "20 100", "output": "3" }, { "input": "10 3", "output": "2" }, { "input": "4 4", "output": "3" }, { "input": "2 4", "output": "1" }, { "input": "89874 1", "output": "1" } ]
1,673,359,209
2,147,483,647
Python 3
OK
TESTS
47
78
0
n,x=[int(x) for x in input().split()] res=0 for k in range(1,n+1): if k*k<=x and x<=k*n and x%k==0: if x==k*k: res+=1 else: res+=2 print(res)
Title: Multiplication Table Time Limit: None seconds Memory Limit: None megabytes Problem Description: Let's consider a table consisting of *n* rows and *n* columns. The cell located at the intersection of *i*-th row and *j*-th column contains number *i*<=Γ—<=*j*. The rows and columns are numbered starting from 1. You are given a positive integer *x*. Your task is to count the number of cells in a table that contain number *x*. Input Specification: The single line contains numbers *n* and *x* (1<=≀<=*n*<=≀<=105, 1<=≀<=*x*<=≀<=109) β€” the size of the table and the number that we are looking for in the table. Output Specification: Print a single number: the number of times *x* occurs in the table. Demo Input: ['10 5\n', '6 12\n', '5 13\n'] Demo Output: ['2\n', '4\n', '0\n'] Note: A table for the second sample test is given below. The occurrences of number 12 are marked bold.
```python n,x=[int(x) for x in input().split()] res=0 for k in range(1,n+1): if k*k<=x and x<=k*n and x%k==0: if x==k*k: res+=1 else: res+=2 print(res) ```
3
596
B
Wilbur and Array
PROGRAMMING
1,100
[ "greedy", "implementation" ]
null
null
Wilbur the pig is tinkering with arrays again. He has the array *a*1,<=*a*2,<=...,<=*a**n* initially consisting of *n* zeros. At one step, he can choose any index *i* and either add 1 to all elements *a**i*,<=*a**i*<=+<=1,<=... ,<=*a**n* or subtract 1 from all elements *a**i*,<=*a**i*<=+<=1,<=...,<=*a**n*. His goal is to end up with the array *b*1,<=*b*2,<=...,<=*b**n*. Of course, Wilbur wants to achieve this goal in the minimum number of steps and asks you to compute this value.
The first line of the input contains a single integer *n* (1<=≀<=*n*<=≀<=200<=000)Β β€” the length of the array *a**i*. Initially *a**i*<==<=0 for every position *i*, so this array is not given in the input. The second line of the input contains *n* integers *b*1,<=*b*2,<=...,<=*b**n* (<=-<=109<=≀<=*b**i*<=≀<=109).
Print the minimum number of steps that Wilbur needs to make in order to achieve *a**i*<==<=*b**i* for all *i*.
[ "5\n1 2 3 4 5\n", "4\n1 2 2 1\n" ]
[ "5", "3" ]
In the first sample, Wilbur may successively choose indices 1, 2, 3, 4, and 5, and add 1 to corresponding suffixes. In the second sample, Wilbur first chooses indices 1 and 2 and adds 1 to corresponding suffixes, then he chooses index 4 and subtract 1.
1,000
[ { "input": "5\n1 2 3 4 5", "output": "5" }, { "input": "4\n1 2 2 1", "output": "3" }, { "input": "3\n1 2 4", "output": "4" }, { "input": "6\n1 2 3 6 5 4", "output": "8" }, { "input": "10\n2 1 4 3 6 5 8 7 10 9", "output": "19" }, { "input": "7\n12 6 12 13 4 3 2", "output": "36" }, { "input": "15\n15 14 13 1 2 3 12 11 10 4 5 6 9 8 7", "output": "55" }, { "input": "16\n1 2 3 4 13 14 15 16 9 10 11 12 5 6 7 8", "output": "36" }, { "input": "6\n1000 1 2000 1 3000 1", "output": "11995" }, { "input": "1\n0", "output": "0" }, { "input": "5\n1000000000 1 1000000000 1 1000000000", "output": "4999999996" }, { "input": "5\n1000000000 0 1000000000 0 1000000000", "output": "5000000000" }, { "input": "10\n1000000000 0 1000000000 0 1000000000 0 1000000000 0 1000000000 0", "output": "10000000000" }, { "input": "10\n1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000", "output": "19000000000" }, { "input": "7\n0 1000000000 0 1000000000 0 1000000000 0", "output": "6000000000" }, { "input": "4\n1000000000 -1000000000 1000000000 -1000000000", "output": "7000000000" }, { "input": "20\n1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000", "output": "39000000000" }, { "input": "11\n1000000000 0 1000000000 0 1000000000 0 1000000000 0 1000000000 0 1000000000", "output": "11000000000" }, { "input": "5\n1000000000 -1000000000 1000000000 -1000000000 1000000000", "output": "9000000000" }, { "input": "22\n1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000", "output": "43000000000" } ]
1,447,606,024
724
Python 3
OK
TESTS
76
218
18,022,400
n = int(input()) ans = 0 a = [0] + list(map(int, input().split())) for i in range(n): ans += abs(a[i + 1] - a[i]) print(ans)
Title: Wilbur and Array Time Limit: None seconds Memory Limit: None megabytes Problem Description: Wilbur the pig is tinkering with arrays again. He has the array *a*1,<=*a*2,<=...,<=*a**n* initially consisting of *n* zeros. At one step, he can choose any index *i* and either add 1 to all elements *a**i*,<=*a**i*<=+<=1,<=... ,<=*a**n* or subtract 1 from all elements *a**i*,<=*a**i*<=+<=1,<=...,<=*a**n*. His goal is to end up with the array *b*1,<=*b*2,<=...,<=*b**n*. Of course, Wilbur wants to achieve this goal in the minimum number of steps and asks you to compute this value. Input Specification: The first line of the input contains a single integer *n* (1<=≀<=*n*<=≀<=200<=000)Β β€” the length of the array *a**i*. Initially *a**i*<==<=0 for every position *i*, so this array is not given in the input. The second line of the input contains *n* integers *b*1,<=*b*2,<=...,<=*b**n* (<=-<=109<=≀<=*b**i*<=≀<=109). Output Specification: Print the minimum number of steps that Wilbur needs to make in order to achieve *a**i*<==<=*b**i* for all *i*. Demo Input: ['5\n1 2 3 4 5\n', '4\n1 2 2 1\n'] Demo Output: ['5', '3'] Note: In the first sample, Wilbur may successively choose indices 1, 2, 3, 4, and 5, and add 1 to corresponding suffixes. In the second sample, Wilbur first chooses indices 1 and 2 and adds 1 to corresponding suffixes, then he chooses index 4 and subtract 1.
```python n = int(input()) ans = 0 a = [0] + list(map(int, input().split())) for i in range(n): ans += abs(a[i + 1] - a[i]) print(ans) ```
3
472
A
Design Tutorial: Learn from Math
PROGRAMMING
800
[ "math", "number theory" ]
null
null
One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that. For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem. You are given an integer *n* no less than 12, express it as a sum of two composite numbers.
The only line contains an integer *n* (12<=≀<=*n*<=≀<=106).
Output two composite integers *x* and *y* (1<=&lt;<=*x*,<=*y*<=&lt;<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them.
[ "12\n", "15\n", "23\n", "1000000\n" ]
[ "4 8\n", "6 9\n", "8 15\n", "500000 500000\n" ]
In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well. In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number.
500
[ { "input": "12", "output": "4 8" }, { "input": "15", "output": "6 9" }, { "input": "23", "output": "8 15" }, { "input": "1000000", "output": "500000 500000" }, { "input": "63874", "output": "4 63870" }, { "input": "14568", "output": "4 14564" }, { "input": "192", "output": "4 188" }, { "input": "86", "output": "4 82" }, { "input": "46220", "output": "4 46216" }, { "input": "57114", "output": "4 57110" }, { "input": "869", "output": "4 865" }, { "input": "738457", "output": "4 738453" }, { "input": "58113", "output": "6 58107" }, { "input": "4864", "output": "4 4860" }, { "input": "15", "output": "6 9" }, { "input": "74752", "output": "4 74748" }, { "input": "6073", "output": "4 6069" }, { "input": "1289", "output": "4 1285" }, { "input": "20", "output": "4 16" }, { "input": "58134", "output": "4 58130" }, { "input": "57756", "output": "4 57752" }, { "input": "765", "output": "6 759" }, { "input": "59", "output": "4 55" }, { "input": "991666", "output": "4 991662" }, { "input": "70761", "output": "4 70757" }, { "input": "13", "output": "4 9" }, { "input": "999999", "output": "4 999995" }, { "input": "17", "output": "8 9" }, { "input": "21", "output": "6 15" }, { "input": "19", "output": "4 15" }, { "input": "100007", "output": "6 100001" }, { "input": "999987", "output": "6 999981" }, { "input": "22", "output": "4 18" } ]
1,691,250,844
2,147,483,647
Python 3
OK
TESTS
33
46
0
def prime(x): if x <= 1: return False for i in range(2, int(x**0.5) + 1): if x % i == 0: return False return True n = int(input()) x = 4 # Start with the smallest possible composite number verif = True while x < n and verif: x += 1 if not prime(x) and not prime(n - x): print(x, n - x) verif = False
Title: Design Tutorial: Learn from Math Time Limit: None seconds Memory Limit: None megabytes Problem Description: One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that. For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem. You are given an integer *n* no less than 12, express it as a sum of two composite numbers. Input Specification: The only line contains an integer *n* (12<=≀<=*n*<=≀<=106). Output Specification: Output two composite integers *x* and *y* (1<=&lt;<=*x*,<=*y*<=&lt;<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them. Demo Input: ['12\n', '15\n', '23\n', '1000000\n'] Demo Output: ['4 8\n', '6 9\n', '8 15\n', '500000 500000\n'] Note: In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well. In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number.
```python def prime(x): if x <= 1: return False for i in range(2, int(x**0.5) + 1): if x % i == 0: return False return True n = int(input()) x = 4 # Start with the smallest possible composite number verif = True while x < n and verif: x += 1 if not prime(x) and not prime(n - x): print(x, n - x) verif = False ```
3
155
A
I_love_\%username\%
PROGRAMMING
800
[ "brute force" ]
null
null
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him. One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number β€” the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously). Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
The first line contains the single integer *n* (1<=≀<=*n*<=≀<=1000) β€” the number of contests where the coder participated. The next line contains *n* space-separated non-negative integer numbers β€” they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
Print the single number β€” the number of amazing performances the coder has had during his whole history of participating in the contests.
[ "5\n100 50 200 150 200\n", "10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n" ]
[ "2\n", "4\n" ]
In the first sample the performances number 2 and 3 are amazing. In the second sample the performances number 2, 4, 9 and 10 are amazing.
500
[ { "input": "5\n100 50 200 150 200", "output": "2" }, { "input": "10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242", "output": "4" }, { "input": "1\n6", "output": "0" }, { "input": "2\n2 1", "output": "1" }, { "input": "5\n100 36 53 7 81", "output": "2" }, { "input": "5\n7 36 53 81 100", "output": "4" }, { "input": "5\n100 81 53 36 7", "output": "4" }, { "input": "10\n8 6 3 4 9 10 7 7 1 3", "output": "5" }, { "input": "10\n1627 1675 1488 1390 1812 1137 1746 1324 1952 1862", "output": "6" }, { "input": "10\n1 3 3 4 6 7 7 8 9 10", "output": "7" }, { "input": "10\n1952 1862 1812 1746 1675 1627 1488 1390 1324 1137", "output": "9" }, { "input": "25\n1448 4549 2310 2725 2091 3509 1565 2475 2232 3989 4231 779 2967 2702 608 3739 721 1552 2767 530 3114 665 1940 48 4198", "output": "5" }, { "input": "33\n1097 1132 1091 1104 1049 1038 1023 1080 1104 1029 1035 1061 1049 1060 1088 1106 1105 1087 1063 1076 1054 1103 1047 1041 1028 1120 1126 1063 1117 1110 1044 1093 1101", "output": "5" }, { "input": "34\n821 5536 2491 6074 7216 9885 764 1603 778 8736 8987 771 617 1587 8943 7922 439 7367 4115 8886 7878 6899 8811 5752 3184 3401 9760 9400 8995 4681 1323 6637 6554 6498", "output": "7" }, { "input": "68\n6764 6877 6950 6768 6839 6755 6726 6778 6699 6805 6777 6985 6821 6801 6791 6805 6940 6761 6677 6999 6911 6699 6959 6933 6903 6843 6972 6717 6997 6756 6789 6668 6735 6852 6735 6880 6723 6834 6810 6694 6780 6679 6698 6857 6826 6896 6979 6968 6957 6988 6960 6700 6919 6892 6984 6685 6813 6678 6715 6857 6976 6902 6780 6686 6777 6686 6842 6679", "output": "9" }, { "input": "60\n9000 9014 9034 9081 9131 9162 9174 9199 9202 9220 9221 9223 9229 9235 9251 9260 9268 9269 9270 9298 9307 9309 9313 9323 9386 9399 9407 9495 9497 9529 9531 9544 9614 9615 9627 9627 9643 9654 9656 9657 9685 9699 9701 9736 9745 9758 9799 9827 9843 9845 9854 9854 9885 9891 9896 9913 9942 9963 9986 9992", "output": "57" }, { "input": "100\n7 61 12 52 41 16 34 99 30 44 48 89 31 54 21 1 48 52 61 15 35 87 21 76 64 92 44 81 16 93 84 92 32 15 68 76 53 39 26 4 11 26 7 4 99 99 61 65 55 85 65 67 47 39 2 74 63 49 98 87 5 94 22 30 25 42 31 84 49 23 89 60 16 26 92 27 9 57 75 61 94 35 83 47 99 100 63 24 91 88 79 10 15 45 22 64 3 11 89 83", "output": "4" }, { "input": "100\n9999 9999 9999 9998 9998 9998 9997 9996 9996 9995 9993 9993 9991 9990 9989 9986 9984 9984 9983 9981 9981 9980 9980 9980 9979 9977 9977 9977 9977 9977 9976 9976 9975 9975 9973 9972 9972 9972 9972 9971 9969 9969 9969 9968 9967 9965 9962 9962 9962 9962 9960 9958 9958 9955 9954 9954 9954 9954 9950 9949 9949 9947 9943 9943 9940 9940 9939 9937 9937 9937 9936 9935 9932 9932 9931 9929 9927 9927 9926 9923 9919 9919 9918 9918 9918 9917 9917 9916 9916 9915 9914 9911 9910 9907 9907 9906 9905 9905 9904 9901", "output": "57" }, { "input": "100\n158 159 157 156 155 154 160 153 161 152 162 163 151 164 150 165 149 148 147 166 146 167 145 144 143 142 168 141 169 170 140 139 138 137 171 136 135 134 172 173 174 133 175 132 177 178 131 179 180 130 129 181 128 127 182 126 183 125 124 184 123 122 121 120 119 118 117 185 186 187 188 189 116 190 115 191 192 193 114 113 112 111 110 109 108 194 195 107 106 105 196 197 104 198 199 103 102 200 101 100", "output": "99" }, { "input": "2\n0 10000", "output": "1" }, { "input": "2\n5 5", "output": "0" }, { "input": "2\n1 1", "output": "0" }, { "input": "2\n10 10", "output": "0" }, { "input": "1\n0", "output": "0" } ]
1,696,897,798
2,147,483,647
Python 3
OK
TESTS
37
124
204,800
n = input() com = [int(i) for i in input().split()] # print(com) rez = 0 k = 1 while k < len(com): # print(com[:k]) if com[k] > max(com[:k]) or com[k] < min(com[:k]): rez += 1 k += 1 print(rez)
Title: I_love_\%username\% Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him. One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number β€” the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously). Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him. Input Specification: The first line contains the single integer *n* (1<=≀<=*n*<=≀<=1000) β€” the number of contests where the coder participated. The next line contains *n* space-separated non-negative integer numbers β€” they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000. Output Specification: Print the single number β€” the number of amazing performances the coder has had during his whole history of participating in the contests. Demo Input: ['5\n100 50 200 150 200\n', '10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n'] Demo Output: ['2\n', '4\n'] Note: In the first sample the performances number 2 and 3 are amazing. In the second sample the performances number 2, 4, 9 and 10 are amazing.
```python n = input() com = [int(i) for i in input().split()] # print(com) rez = 0 k = 1 while k < len(com): # print(com[:k]) if com[k] > max(com[:k]) or com[k] < min(com[:k]): rez += 1 k += 1 print(rez) ```
3
408
B
Garland
PROGRAMMING
1,200
[ "implementation" ]
null
null
Once little Vasya read an article in a magazine on how to make beautiful handmade garland from colored paper. Vasya immediately went to the store and bought *n* colored sheets of paper, the area of each sheet is 1 square meter. The garland must consist of exactly *m* pieces of colored paper of arbitrary area, each piece should be of a certain color. To make the garland, Vasya can arbitrarily cut his existing colored sheets into pieces. Vasya is not obliged to use all the sheets to make the garland. Vasya wants the garland to be as attractive as possible, so he wants to maximize the total area of ​​*m* pieces of paper in the garland. Calculate what the maximum total area of ​​the pieces of paper in the garland Vasya can get.
The first line contains a non-empty sequence of *n* (1<=≀<=*n*<=≀<=1000) small English letters ("a"..."z"). Each letter means that Vasya has a sheet of paper of the corresponding color. The second line contains a non-empty sequence of *m* (1<=≀<=*m*<=≀<=1000) small English letters that correspond to the colors of the pieces of paper in the garland that Vasya wants to make.
Print an integer that is the maximum possible total area of the pieces of paper in the garland Vasya wants to get or -1, if it is impossible to make the garland from the sheets he's got. It is guaranteed that the answer is always an integer.
[ "aaabbac\naabbccac\n", "a\nz\n" ]
[ "6\n", "-1" ]
In the first test sample Vasya can make an garland of area 6: he can use both sheets of color *b*, three (but not four) sheets of color *a* and cut a single sheet of color *c* in three, for example, equal pieces. Vasya can use the resulting pieces to make a garland of area 6. In the second test sample Vasya cannot make a garland at all β€” he doesn't have a sheet of color *z*.
1,000
[ { "input": "aaabbac\naabbccac", "output": "6" }, { "input": "a\nz", "output": "-1" }, { "input": "r\nr", "output": "1" }, { "input": "stnsdn\nndnndsn", "output": "4" }, { "input": "yqfqfp\ntttwtqq", "output": "-1" }, { "input": "zzbbrrtrtzr\ntbbtrrrzr", "output": "9" }, { "input": "ivvfisvsvii\npaihjinno", "output": "-1" }, { "input": "zbvwnlgkshqerxptyod\nz", "output": "1" }, { "input": "xlktwjymocqrahnbesf\nfoo", "output": "2" }, { "input": "bbzmzqazmbambnmzaabznmbabzqnaabmabmnnabbmnzaanzzezebzabqaabzqaemeqqammmbazmmz\naznnbbmeebmanbeemzmemqbaeebnqenqzzbanebmnzqqebqmmnmqqzmmeqqqaaezemmazqqmqaqnnqqzbzeeazammmenbbamzbmnaenemenaaaebnmanebqmqnznqbenmqqnnnaeaebqmamennmqqeaaqqbammnzqmnmqnqbbezmemznqmanzmmqzzzzembqnzqbanamezqaqbazenenqqznqaebzaeezbqqbmeeaqnmmbnqbbnmaqqemaeaezaabmbnbzzaae", "output": "77" }, { "input": "lccfdfnfflncddlksndcwnfcllnnaswcdnldafcalssfcdnkkaklwnnacsncfwanwnwfadawcsdcfwflnnlfsfclkfknlaldna\nuaaldlllhedgugugueahddhedbuddaedhaaeugdubaealbgbagedldbl", "output": "-1" }, { "input": "hvewdvwdwudrwarwmddwnazmwauzatrmwptwwevavpmwrtruwnpwantewrnwmepdwvtmnveanunrvrtwpvhhnuhnmpptdttzmmndtvudmzhhannmmnahdpzamuvhzaavnhtnumwrwvttdetvuewaaennddwuvzvaptdzrzhtetwwzmzedrwuvrwznprhdvnavrruvvhzuwpdtmpwmzrwvermrhdamv\nuvzhwtpuputnahwwarduzddhpnwwvettprwavdmnztdnrddmarmvuevtdezndnezvarhmppwwnmvnrtddzhhnzrwuhvpwmezuurundarwdazwptrpeurrnwautddnhdmhtwhwvvtavdzezumetzezpazndhuentmrhamutrtttpevtuutemdnvwnwnmnvmznatneweuaahdavmaddhnrdenwwztrwh", "output": "199" }, { "input": "aaccddff\nabcdf", "output": "-1" } ]
1,659,616,967
2,147,483,647
Python 3
OK
TESTS
21
46
0
x=input() y=input() d1={} d2={} count=0 for i in x: d1[i]=x.count(i) for i in y: d2[i]=y.count(i) for i in d2.keys(): if i in d1.keys(): if d1[i]<d2[i]: count+=d1[i] else: count+=d2[i] else: count=-1 break print(count)
Title: Garland Time Limit: None seconds Memory Limit: None megabytes Problem Description: Once little Vasya read an article in a magazine on how to make beautiful handmade garland from colored paper. Vasya immediately went to the store and bought *n* colored sheets of paper, the area of each sheet is 1 square meter. The garland must consist of exactly *m* pieces of colored paper of arbitrary area, each piece should be of a certain color. To make the garland, Vasya can arbitrarily cut his existing colored sheets into pieces. Vasya is not obliged to use all the sheets to make the garland. Vasya wants the garland to be as attractive as possible, so he wants to maximize the total area of ​​*m* pieces of paper in the garland. Calculate what the maximum total area of ​​the pieces of paper in the garland Vasya can get. Input Specification: The first line contains a non-empty sequence of *n* (1<=≀<=*n*<=≀<=1000) small English letters ("a"..."z"). Each letter means that Vasya has a sheet of paper of the corresponding color. The second line contains a non-empty sequence of *m* (1<=≀<=*m*<=≀<=1000) small English letters that correspond to the colors of the pieces of paper in the garland that Vasya wants to make. Output Specification: Print an integer that is the maximum possible total area of the pieces of paper in the garland Vasya wants to get or -1, if it is impossible to make the garland from the sheets he's got. It is guaranteed that the answer is always an integer. Demo Input: ['aaabbac\naabbccac\n', 'a\nz\n'] Demo Output: ['6\n', '-1'] Note: In the first test sample Vasya can make an garland of area 6: he can use both sheets of color *b*, three (but not four) sheets of color *a* and cut a single sheet of color *c* in three, for example, equal pieces. Vasya can use the resulting pieces to make a garland of area 6. In the second test sample Vasya cannot make a garland at all β€” he doesn't have a sheet of color *z*.
```python x=input() y=input() d1={} d2={} count=0 for i in x: d1[i]=x.count(i) for i in y: d2[i]=y.count(i) for i in d2.keys(): if i in d1.keys(): if d1[i]<d2[i]: count+=d1[i] else: count+=d2[i] else: count=-1 break print(count) ```
3
596
A
Wilbur and Swimming Pool
PROGRAMMING
1,100
[ "geometry", "implementation" ]
null
null
After making bad dives into swimming pools, Wilbur wants to build a swimming pool in the shape of a rectangle in his backyard. He has set up coordinate axes, and he wants the sides of the rectangle to be parallel to them. Of course, the area of the rectangle must be positive. Wilbur had all four vertices of the planned pool written on a paper, until his friend came along and erased some of the vertices. Now Wilbur is wondering, if the remaining *n* vertices of the initial rectangle give enough information to restore the area of the planned swimming pool.
The first line of the input contains a single integer *n* (1<=≀<=*n*<=≀<=4)Β β€” the number of vertices that were not erased by Wilbur's friend. Each of the following *n* lines contains two integers *x**i* and *y**i* (<=-<=1000<=≀<=*x**i*,<=*y**i*<=≀<=1000)Β β€”the coordinates of the *i*-th vertex that remains. Vertices are given in an arbitrary order. It's guaranteed that these points are distinct vertices of some rectangle, that has positive area and which sides are parallel to the coordinate axes.
Print the area of the initial rectangle if it could be uniquely determined by the points remaining. Otherwise, print <=-<=1.
[ "2\n0 0\n1 1\n", "1\n1 1\n" ]
[ "1\n", "-1\n" ]
In the first sample, two opposite corners of the initial rectangle are given, and that gives enough information to say that the rectangle is actually a unit square. In the second sample there is only one vertex left and this is definitely not enough to uniquely define the area.
500
[ { "input": "2\n0 0\n1 1", "output": "1" }, { "input": "1\n1 1", "output": "-1" }, { "input": "1\n-188 17", "output": "-1" }, { "input": "1\n71 -740", "output": "-1" }, { "input": "4\n-56 -858\n-56 -174\n778 -858\n778 -174", "output": "570456" }, { "input": "2\n14 153\n566 -13", "output": "91632" }, { "input": "2\n-559 894\n314 127", "output": "669591" }, { "input": "1\n-227 -825", "output": "-1" }, { "input": "2\n-187 583\n25 13", "output": "120840" }, { "input": "2\n-337 451\n32 -395", "output": "312174" }, { "input": "4\n-64 -509\n-64 960\n634 -509\n634 960", "output": "1025362" }, { "input": "2\n-922 -505\n712 -683", "output": "290852" }, { "input": "2\n-1000 -1000\n-1000 0", "output": "-1" }, { "input": "2\n-1000 -1000\n0 -1000", "output": "-1" }, { "input": "4\n-414 -891\n-414 896\n346 -891\n346 896", "output": "1358120" }, { "input": "2\n56 31\n704 -121", "output": "98496" }, { "input": "4\n-152 198\n-152 366\n458 198\n458 366", "output": "102480" }, { "input": "3\n-890 778\n-418 296\n-890 296", "output": "227504" }, { "input": "4\n852 -184\n852 724\n970 -184\n970 724", "output": "107144" }, { "input": "1\n858 -279", "output": "-1" }, { "input": "2\n-823 358\n446 358", "output": "-1" }, { "input": "2\n-739 -724\n-739 443", "output": "-1" }, { "input": "2\n686 664\n686 -590", "output": "-1" }, { "input": "3\n-679 301\n240 -23\n-679 -23", "output": "297756" }, { "input": "2\n-259 -978\n978 -978", "output": "-1" }, { "input": "1\n627 -250", "output": "-1" }, { "input": "3\n-281 598\n679 -990\n-281 -990", "output": "1524480" }, { "input": "2\n-414 -431\n-377 -688", "output": "9509" }, { "input": "3\n-406 566\n428 426\n-406 426", "output": "116760" }, { "input": "3\n-686 695\n-547 308\n-686 308", "output": "53793" }, { "input": "1\n-164 -730", "output": "-1" }, { "input": "2\n980 -230\n980 592", "output": "-1" }, { "input": "4\n-925 306\n-925 602\n398 306\n398 602", "output": "391608" }, { "input": "3\n576 -659\n917 -739\n576 -739", "output": "27280" }, { "input": "1\n720 -200", "output": "-1" }, { "input": "4\n-796 -330\n-796 758\n171 -330\n171 758", "output": "1052096" }, { "input": "2\n541 611\n-26 611", "output": "-1" }, { "input": "3\n-487 838\n134 691\n-487 691", "output": "91287" }, { "input": "2\n-862 -181\n-525 -181", "output": "-1" }, { "input": "1\n-717 916", "output": "-1" }, { "input": "1\n-841 -121", "output": "-1" }, { "input": "4\n259 153\n259 999\n266 153\n266 999", "output": "5922" }, { "input": "2\n295 710\n295 254", "output": "-1" }, { "input": "4\n137 -184\n137 700\n712 -184\n712 700", "output": "508300" }, { "input": "2\n157 994\n377 136", "output": "188760" }, { "input": "1\n193 304", "output": "-1" }, { "input": "4\n5 -952\n5 292\n553 -952\n553 292", "output": "681712" }, { "input": "2\n-748 697\n671 575", "output": "173118" }, { "input": "2\n-457 82\n260 -662", "output": "533448" }, { "input": "2\n-761 907\n967 907", "output": "-1" }, { "input": "3\n-639 51\n-321 -539\n-639 -539", "output": "187620" }, { "input": "2\n-480 51\n89 -763", "output": "463166" }, { "input": "4\n459 -440\n459 -94\n872 -440\n872 -94", "output": "142898" }, { "input": "2\n380 -849\n68 -849", "output": "-1" }, { "input": "2\n-257 715\n102 715", "output": "-1" }, { "input": "2\n247 -457\n434 -921", "output": "86768" }, { "input": "4\n-474 -894\n-474 -833\n-446 -894\n-446 -833", "output": "1708" }, { "input": "3\n-318 831\n450 31\n-318 31", "output": "614400" }, { "input": "3\n-282 584\n696 488\n-282 488", "output": "93888" }, { "input": "3\n258 937\n395 856\n258 856", "output": "11097" }, { "input": "1\n-271 -499", "output": "-1" }, { "input": "2\n-612 208\n326 -559", "output": "719446" }, { "input": "2\n115 730\n562 -546", "output": "570372" }, { "input": "2\n-386 95\n-386 750", "output": "-1" }, { "input": "3\n0 0\n0 1\n1 0", "output": "1" }, { "input": "3\n0 4\n3 4\n3 1", "output": "9" }, { "input": "3\n1 1\n1 2\n2 1", "output": "1" }, { "input": "3\n1 4\n4 4\n4 1", "output": "9" }, { "input": "3\n1 1\n2 1\n1 2", "output": "1" }, { "input": "3\n0 0\n1 0\n1 1", "output": "1" }, { "input": "3\n0 0\n0 5\n5 0", "output": "25" }, { "input": "3\n0 0\n0 1\n1 1", "output": "1" }, { "input": "4\n0 0\n1 0\n1 1\n0 1", "output": "1" }, { "input": "3\n4 4\n1 4\n4 1", "output": "9" }, { "input": "3\n0 0\n2 0\n2 1", "output": "2" }, { "input": "3\n0 0\n2 0\n0 2", "output": "4" }, { "input": "3\n0 0\n0 1\n5 0", "output": "5" }, { "input": "3\n1 1\n1 3\n3 1", "output": "4" }, { "input": "4\n0 0\n1 0\n0 1\n1 1", "output": "1" }, { "input": "2\n1 0\n2 1", "output": "1" }, { "input": "3\n0 0\n1 0\n0 1", "output": "1" }, { "input": "3\n1 0\n0 0\n0 1", "output": "1" }, { "input": "3\n0 0\n0 5\n5 5", "output": "25" }, { "input": "3\n1 0\n5 0\n5 10", "output": "40" }, { "input": "3\n0 0\n1 0\n1 2", "output": "2" }, { "input": "4\n0 1\n0 0\n1 0\n1 1", "output": "1" }, { "input": "3\n0 0\n2 0\n0 1", "output": "2" }, { "input": "3\n-2 -1\n-1 -1\n-1 -2", "output": "1" }, { "input": "2\n1 0\n0 1", "output": "1" }, { "input": "4\n1 1\n3 3\n3 1\n1 3", "output": "4" }, { "input": "3\n2 1\n1 2\n2 2", "output": "1" }, { "input": "3\n0 0\n0 3\n3 0", "output": "9" }, { "input": "2\n0 3\n3 3", "output": "-1" }, { "input": "4\n2 0\n2 8\n5 8\n5 0", "output": "24" }, { "input": "2\n0 999\n100 250", "output": "74900" }, { "input": "3\n1 1\n1 5\n5 1", "output": "16" }, { "input": "3\n0 1\n0 0\n1 1", "output": "1" }, { "input": "3\n0 0\n10 0\n0 10", "output": "100" }, { "input": "2\n0 0\n-1 -1", "output": "1" }, { "input": "3\n1 5\n2 2\n2 5", "output": "3" }, { "input": "3\n0 0\n0 1\n2 0", "output": "2" }, { "input": "3\n0 1\n1 0\n0 0", "output": "1" }, { "input": "3\n0 0\n0 -1\n1 -1", "output": "1" }, { "input": "3\n0 1\n1 0\n1 1", "output": "1" }, { "input": "3\n3 5\n3 2\n7 2", "output": "12" }, { "input": "3\n1 2\n1 3\n2 2", "output": "1" }, { "input": "3\n5 0\n0 0\n0 5", "output": "25" }, { "input": "3\n1 0\n1 3\n5 0", "output": "12" }, { "input": "3\n0 0\n0 2\n2 0", "output": "4" }, { "input": "3\n1 1\n0 0\n1 0", "output": "1" }, { "input": "3\n1 2\n1 3\n2 3", "output": "1" }, { "input": "4\n0 0\n0 1\n1 1\n1 0", "output": "1" }, { "input": "2\n-3 0\n3 3", "output": "18" }, { "input": "3\n1 1\n0 1\n1 0", "output": "1" }, { "input": "3\n0 0\n5 0\n5 5", "output": "25" }, { "input": "3\n79 79\n79 158\n158 79", "output": "6241" }, { "input": "3\n1 0\n1 -1\n0 0", "output": "1" }, { "input": "3\n1 1\n1 2\n2 2", "output": "1" }, { "input": "3\n0 1\n0 0\n1 0", "output": "1" }, { "input": "3\n2 1\n2 4\n6 1", "output": "12" }, { "input": "3\n5 0\n0 0\n5 5", "output": "25" } ]
1,472,735,494
2,147,483,647
Python 3
OK
TESTS
121
93
307,200
if __name__ == '__main__': n = int(input()) lines = list() for i in range(n): line = str(input()).split() line = [int(it) for it in line] lines.append(line) if n == 1 or n == 2 and (lines[0][0] == lines[1][0] or lines[0][1] == lines[1][1]): print(-1) elif n == 2: print(abs((lines[1][0] - lines[0][0]) * (lines[1][1] - lines[0][1]))) else: zones = list() if lines[1][0] == lines[0][0] or lines[1][1] == lines[0][1]: zones.append(abs(lines[1][0] - lines[0][0]) + abs(lines[1][1] - lines[0][1])) if lines[1][0] == lines[2][0] or lines[1][1] == lines[2][1]: zones.append(abs(lines[1][0] - lines[2][0]) + abs(lines[1][1] - lines[2][1])) if lines[0][0] == lines[2][0] or lines[0][1] == lines[2][1]: zones.append(abs(lines[0][0] - lines[2][0]) + abs(lines[0][1] - lines[2][1])) print(zones[0] * zones[1])
Title: Wilbur and Swimming Pool Time Limit: None seconds Memory Limit: None megabytes Problem Description: After making bad dives into swimming pools, Wilbur wants to build a swimming pool in the shape of a rectangle in his backyard. He has set up coordinate axes, and he wants the sides of the rectangle to be parallel to them. Of course, the area of the rectangle must be positive. Wilbur had all four vertices of the planned pool written on a paper, until his friend came along and erased some of the vertices. Now Wilbur is wondering, if the remaining *n* vertices of the initial rectangle give enough information to restore the area of the planned swimming pool. Input Specification: The first line of the input contains a single integer *n* (1<=≀<=*n*<=≀<=4)Β β€” the number of vertices that were not erased by Wilbur's friend. Each of the following *n* lines contains two integers *x**i* and *y**i* (<=-<=1000<=≀<=*x**i*,<=*y**i*<=≀<=1000)Β β€”the coordinates of the *i*-th vertex that remains. Vertices are given in an arbitrary order. It's guaranteed that these points are distinct vertices of some rectangle, that has positive area and which sides are parallel to the coordinate axes. Output Specification: Print the area of the initial rectangle if it could be uniquely determined by the points remaining. Otherwise, print <=-<=1. Demo Input: ['2\n0 0\n1 1\n', '1\n1 1\n'] Demo Output: ['1\n', '-1\n'] Note: In the first sample, two opposite corners of the initial rectangle are given, and that gives enough information to say that the rectangle is actually a unit square. In the second sample there is only one vertex left and this is definitely not enough to uniquely define the area.
```python if __name__ == '__main__': n = int(input()) lines = list() for i in range(n): line = str(input()).split() line = [int(it) for it in line] lines.append(line) if n == 1 or n == 2 and (lines[0][0] == lines[1][0] or lines[0][1] == lines[1][1]): print(-1) elif n == 2: print(abs((lines[1][0] - lines[0][0]) * (lines[1][1] - lines[0][1]))) else: zones = list() if lines[1][0] == lines[0][0] or lines[1][1] == lines[0][1]: zones.append(abs(lines[1][0] - lines[0][0]) + abs(lines[1][1] - lines[0][1])) if lines[1][0] == lines[2][0] or lines[1][1] == lines[2][1]: zones.append(abs(lines[1][0] - lines[2][0]) + abs(lines[1][1] - lines[2][1])) if lines[0][0] == lines[2][0] or lines[0][1] == lines[2][1]: zones.append(abs(lines[0][0] - lines[2][0]) + abs(lines[0][1] - lines[2][1])) print(zones[0] * zones[1]) ```
3
119
A
Epic Game
PROGRAMMING
800
[ "implementation" ]
null
null
Simon and Antisimon play a game. Initially each player receives one fixed positive integer that doesn't change throughout the game. Simon receives number *a* and Antisimon receives number *b*. They also have a heap of *n* stones. The players take turns to make a move and Simon starts. During a move a player should take from the heap the number of stones equal to the greatest common divisor of the fixed number he has received and the number of stones left in the heap. A player loses when he cannot take the required number of stones (i. e. the heap has strictly less stones left than one needs to take). Your task is to determine by the given *a*, *b* and *n* who wins the game.
The only string contains space-separated integers *a*, *b* and *n* (1<=≀<=*a*,<=*b*,<=*n*<=≀<=100) β€” the fixed numbers Simon and Antisimon have received correspondingly and the initial number of stones in the pile.
If Simon wins, print "0" (without the quotes), otherwise print "1" (without the quotes).
[ "3 5 9\n", "1 1 100\n" ]
[ "0", "1" ]
The greatest common divisor of two non-negative integers *a* and *b* is such maximum positive integer *k*, that *a* is divisible by *k* without remainder and similarly, *b* is divisible by *k* without remainder. Let *gcd*(*a*, *b*) represent the operation of calculating the greatest common divisor of numbers *a* and *b*. Specifically, *gcd*(*x*, 0) = *gcd*(0, *x*) = *x*. In the first sample the game will go like that: - Simon should take *gcd*(3, 9) = 3 stones from the heap. After his move the heap has 6 stones left.- Antisimon should take *gcd*(5, 6) = 1 stone from the heap. After his move the heap has 5 stones left.- Simon should take *gcd*(3, 5) = 1 stone from the heap. After his move the heap has 4 stones left.- Antisimon should take *gcd*(5, 4) = 1 stone from the heap. After his move the heap has 3 stones left.- Simon should take *gcd*(3, 3) = 3 stones from the heap. After his move the heap has 0 stones left.- Antisimon should take *gcd*(5, 0) = 5 stones from the heap. As 0 &lt; 5, it is impossible and Antisimon loses. In the second sample each player during each move takes one stone from the heap. As *n* is even, Antisimon takes the last stone and Simon can't make a move after that.
500
[ { "input": "3 5 9", "output": "0" }, { "input": "1 1 100", "output": "1" }, { "input": "23 12 16", "output": "1" }, { "input": "95 26 29", "output": "1" }, { "input": "73 32 99", "output": "1" }, { "input": "1 1 1", "output": "0" }, { "input": "41 12 65", "output": "1" }, { "input": "13 61 100", "output": "1" }, { "input": "100 100 10", "output": "0" }, { "input": "12 24 26", "output": "1" }, { "input": "73 21 96", "output": "1" }, { "input": "17 22 81", "output": "1" }, { "input": "14 88 97", "output": "1" }, { "input": "42 81 17", "output": "0" }, { "input": "34 36 19", "output": "1" }, { "input": "21 87 12", "output": "1" }, { "input": "97 92 98", "output": "1" }, { "input": "49 25 62", "output": "1" }, { "input": "29 17 44", "output": "1" }, { "input": "10 1 10", "output": "0" }, { "input": "99 98 100", "output": "1" }, { "input": "100 100 1", "output": "0" }, { "input": "11 99 55", "output": "0" }, { "input": "8 13 21", "output": "0" }, { "input": "34 55 89", "output": "0" }, { "input": "21 34 55", "output": "1" }, { "input": "13 21 34", "output": "1" }, { "input": "34 21 55", "output": "0" }, { "input": "10 20 84", "output": "1" }, { "input": "4 2 5", "output": "0" }, { "input": "3 2 3", "output": "0" }, { "input": "31 23 1", "output": "0" }, { "input": "100 100 100", "output": "0" }, { "input": "100 1 100", "output": "0" }, { "input": "1 100 100", "output": "1" }, { "input": "1 1 100", "output": "1" }, { "input": "17 23 100", "output": "1" }, { "input": "99 98 100", "output": "1" }, { "input": "1 1 2", "output": "1" }, { "input": "2 1 1", "output": "0" }, { "input": "1 2 1", "output": "0" }, { "input": "2 1 2", "output": "0" }, { "input": "10 10 3", "output": "1" }, { "input": "2 2 1", "output": "0" }, { "input": "9 5 1", "output": "0" } ]
1,672,083,371
2,147,483,647
Python 3
OK
TESTS
45
92
0
def gcd(a, b): while a!= 0 and b != 0: if a >b: a %= b else: b %= a return a + b nums = list(map(int, input().split())) a = nums[0] b = nums[1] n = nums[2] turn = 1 while n > 0: turn = 1 - turn if turn == 0: n -= gcd(n, a) else: n -= gcd(n, b) print(turn)
Title: Epic Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Simon and Antisimon play a game. Initially each player receives one fixed positive integer that doesn't change throughout the game. Simon receives number *a* and Antisimon receives number *b*. They also have a heap of *n* stones. The players take turns to make a move and Simon starts. During a move a player should take from the heap the number of stones equal to the greatest common divisor of the fixed number he has received and the number of stones left in the heap. A player loses when he cannot take the required number of stones (i. e. the heap has strictly less stones left than one needs to take). Your task is to determine by the given *a*, *b* and *n* who wins the game. Input Specification: The only string contains space-separated integers *a*, *b* and *n* (1<=≀<=*a*,<=*b*,<=*n*<=≀<=100) β€” the fixed numbers Simon and Antisimon have received correspondingly and the initial number of stones in the pile. Output Specification: If Simon wins, print "0" (without the quotes), otherwise print "1" (without the quotes). Demo Input: ['3 5 9\n', '1 1 100\n'] Demo Output: ['0', '1'] Note: The greatest common divisor of two non-negative integers *a* and *b* is such maximum positive integer *k*, that *a* is divisible by *k* without remainder and similarly, *b* is divisible by *k* without remainder. Let *gcd*(*a*, *b*) represent the operation of calculating the greatest common divisor of numbers *a* and *b*. Specifically, *gcd*(*x*, 0) = *gcd*(0, *x*) = *x*. In the first sample the game will go like that: - Simon should take *gcd*(3, 9) = 3 stones from the heap. After his move the heap has 6 stones left.- Antisimon should take *gcd*(5, 6) = 1 stone from the heap. After his move the heap has 5 stones left.- Simon should take *gcd*(3, 5) = 1 stone from the heap. After his move the heap has 4 stones left.- Antisimon should take *gcd*(5, 4) = 1 stone from the heap. After his move the heap has 3 stones left.- Simon should take *gcd*(3, 3) = 3 stones from the heap. After his move the heap has 0 stones left.- Antisimon should take *gcd*(5, 0) = 5 stones from the heap. As 0 &lt; 5, it is impossible and Antisimon loses. In the second sample each player during each move takes one stone from the heap. As *n* is even, Antisimon takes the last stone and Simon can't make a move after that.
```python def gcd(a, b): while a!= 0 and b != 0: if a >b: a %= b else: b %= a return a + b nums = list(map(int, input().split())) a = nums[0] b = nums[1] n = nums[2] turn = 1 while n > 0: turn = 1 - turn if turn == 0: n -= gcd(n, a) else: n -= gcd(n, b) print(turn) ```
3
217
A
Ice Skating
PROGRAMMING
1,200
[ "brute force", "dfs and similar", "dsu", "graphs" ]
null
null
Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created. We assume that Bajtek can only heap up snow drifts at integer coordinates.
The first line of input contains a single integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≀<=*x**i*,<=*y**i*<=≀<=1000) β€” the coordinates of the *i*-th snow drift. Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct.
Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one.
[ "2\n2 1\n1 2\n", "2\n2 1\n4 1\n" ]
[ "1\n", "0\n" ]
none
500
[ { "input": "2\n2 1\n1 2", "output": "1" }, { "input": "2\n2 1\n4 1", "output": "0" }, { "input": "24\n171 35\n261 20\n4 206\n501 446\n961 912\n581 748\n946 978\n463 514\n841 889\n341 466\n842 967\n54 102\n235 261\n925 889\n682 672\n623 636\n268 94\n635 710\n474 510\n697 794\n586 663\n182 184\n806 663\n468 459", "output": "21" }, { "input": "17\n660 646\n440 442\n689 618\n441 415\n922 865\n950 972\n312 366\n203 229\n873 860\n219 199\n344 308\n169 176\n961 992\n153 84\n201 230\n987 938\n834 815", "output": "16" }, { "input": "11\n798 845\n722 911\n374 270\n629 537\n748 856\n831 885\n486 641\n751 829\n609 492\n98 27\n654 663", "output": "10" }, { "input": "1\n321 88", "output": "0" }, { "input": "9\n811 859\n656 676\n76 141\n945 951\n497 455\n18 55\n335 294\n267 275\n656 689", "output": "7" }, { "input": "7\n948 946\n130 130\n761 758\n941 938\n971 971\n387 385\n509 510", "output": "6" }, { "input": "6\n535 699\n217 337\n508 780\n180 292\n393 112\n732 888", "output": "5" }, { "input": "14\n25 23\n499 406\n193 266\n823 751\n219 227\n101 138\n978 992\n43 74\n997 932\n237 189\n634 538\n774 740\n842 767\n742 802", "output": "13" }, { "input": "12\n548 506\n151 198\n370 380\n655 694\n654 690\n407 370\n518 497\n819 827\n765 751\n802 771\n741 752\n653 662", "output": "11" }, { "input": "40\n685 711\n433 403\n703 710\n491 485\n616 619\n288 282\n884 871\n367 352\n500 511\n977 982\n51 31\n576 564\n508 519\n755 762\n22 20\n368 353\n232 225\n953 955\n452 436\n311 330\n967 988\n369 364\n791 803\n150 149\n651 661\n118 93\n398 387\n748 766\n852 852\n230 228\n555 545\n515 519\n667 678\n867 862\n134 146\n859 863\n96 99\n486 469\n303 296\n780 786", "output": "38" }, { "input": "3\n175 201\n907 909\n388 360", "output": "2" }, { "input": "7\n312 298\n86 78\n73 97\n619 594\n403 451\n538 528\n71 86", "output": "6" }, { "input": "19\n802 820\n368 248\n758 794\n455 378\n876 888\n771 814\n245 177\n586 555\n844 842\n364 360\n820 856\n731 624\n982 975\n825 856\n122 121\n862 896\n42 4\n792 841\n828 820", "output": "16" }, { "input": "32\n643 877\n842 614\n387 176\n99 338\n894 798\n652 728\n611 648\n622 694\n579 781\n243 46\n322 305\n198 438\n708 579\n246 325\n536 459\n874 593\n120 277\n989 907\n223 110\n35 130\n761 692\n690 661\n518 766\n226 93\n678 597\n725 617\n661 574\n775 496\n56 416\n14 189\n358 359\n898 901", "output": "31" }, { "input": "32\n325 327\n20 22\n72 74\n935 933\n664 663\n726 729\n785 784\n170 171\n315 314\n577 580\n984 987\n313 317\n434 435\n962 961\n55 54\n46 44\n743 742\n434 433\n617 612\n332 332\n883 886\n940 936\n793 792\n645 644\n611 607\n418 418\n465 465\n219 218\n167 164\n56 54\n403 405\n210 210", "output": "29" }, { "input": "32\n652 712\n260 241\n27 154\n188 16\n521 351\n518 356\n452 540\n790 827\n339 396\n336 551\n897 930\n828 627\n27 168\n180 113\n134 67\n794 671\n812 711\n100 241\n686 813\n138 289\n384 506\n884 932\n913 959\n470 508\n730 734\n373 478\n788 862\n392 426\n148 68\n113 49\n713 852\n924 894", "output": "29" }, { "input": "14\n685 808\n542 677\n712 747\n832 852\n187 410\n399 338\n626 556\n530 635\n267 145\n215 209\n559 684\n944 949\n753 596\n601 823", "output": "13" }, { "input": "5\n175 158\n16 2\n397 381\n668 686\n957 945", "output": "4" }, { "input": "5\n312 284\n490 509\n730 747\n504 497\n782 793", "output": "4" }, { "input": "2\n802 903\n476 348", "output": "1" }, { "input": "4\n325 343\n425 442\n785 798\n275 270", "output": "3" }, { "input": "28\n462 483\n411 401\n118 94\n111 127\n5 6\n70 52\n893 910\n73 63\n818 818\n182 201\n642 633\n900 886\n893 886\n684 700\n157 173\n953 953\n671 660\n224 225\n832 801\n152 157\n601 585\n115 101\n739 722\n611 606\n659 642\n461 469\n702 689\n649 653", "output": "25" }, { "input": "36\n952 981\n885 900\n803 790\n107 129\n670 654\n143 132\n66 58\n813 819\n849 837\n165 198\n247 228\n15 39\n619 618\n105 138\n868 855\n965 957\n293 298\n613 599\n227 212\n745 754\n723 704\n877 858\n503 487\n678 697\n592 595\n155 135\n962 982\n93 89\n660 673\n225 212\n967 987\n690 680\n804 813\n489 518\n240 221\n111 124", "output": "34" }, { "input": "30\n89 3\n167 156\n784 849\n943 937\n144 95\n24 159\n80 120\n657 683\n585 596\n43 147\n909 964\n131 84\n345 389\n333 321\n91 126\n274 325\n859 723\n866 922\n622 595\n690 752\n902 944\n127 170\n426 383\n905 925\n172 284\n793 810\n414 510\n890 884\n123 24\n267 255", "output": "29" }, { "input": "5\n664 666\n951 941\n739 742\n844 842\n2 2", "output": "4" }, { "input": "3\n939 867\n411 427\n757 708", "output": "2" }, { "input": "36\n429 424\n885 972\n442 386\n512 511\n751 759\n4 115\n461 497\n496 408\n8 23\n542 562\n296 331\n448 492\n412 395\n109 166\n622 640\n379 355\n251 262\n564 586\n66 115\n275 291\n666 611\n629 534\n510 567\n635 666\n738 803\n420 369\n92 17\n101 144\n141 92\n258 258\n184 235\n492 456\n311 210\n394 357\n531 512\n634 636", "output": "34" }, { "input": "29\n462 519\n871 825\n127 335\n156 93\n576 612\n885 830\n634 779\n340 105\n744 795\n716 474\n93 139\n563 805\n137 276\n177 101\n333 14\n391 437\n873 588\n817 518\n460 597\n572 670\n140 303\n392 441\n273 120\n862 578\n670 639\n410 161\n544 577\n193 116\n252 195", "output": "28" }, { "input": "23\n952 907\n345 356\n812 807\n344 328\n242 268\n254 280\n1000 990\n80 78\n424 396\n595 608\n755 813\n383 380\n55 56\n598 633\n203 211\n508 476\n600 593\n206 192\n855 882\n517 462\n967 994\n642 657\n493 488", "output": "22" }, { "input": "10\n579 816\n806 590\n830 787\n120 278\n677 800\n16 67\n188 251\n559 560\n87 67\n104 235", "output": "8" }, { "input": "23\n420 424\n280 303\n515 511\n956 948\n799 803\n441 455\n362 369\n299 289\n823 813\n982 967\n876 878\n185 157\n529 551\n964 989\n655 656\n1 21\n114 112\n45 56\n935 937\n1000 997\n934 942\n360 366\n648 621", "output": "22" }, { "input": "23\n102 84\n562 608\n200 127\n952 999\n465 496\n322 367\n728 690\n143 147\n855 867\n861 866\n26 59\n300 273\n255 351\n192 246\n70 111\n365 277\n32 104\n298 319\n330 354\n241 141\n56 125\n315 298\n412 461", "output": "22" }, { "input": "7\n429 506\n346 307\n99 171\n853 916\n322 263\n115 157\n906 924", "output": "6" }, { "input": "3\n1 1\n2 1\n2 2", "output": "0" }, { "input": "4\n1 1\n1 2\n2 1\n2 2", "output": "0" }, { "input": "5\n1 1\n1 2\n2 2\n3 1\n3 3", "output": "0" }, { "input": "6\n1 1\n1 2\n2 2\n3 1\n3 2\n3 3", "output": "0" }, { "input": "20\n1 1\n2 2\n3 3\n3 9\n4 4\n5 2\n5 5\n5 7\n5 8\n6 2\n6 6\n6 9\n7 7\n8 8\n9 4\n9 7\n9 9\n10 2\n10 9\n10 10", "output": "1" }, { "input": "21\n1 1\n1 9\n2 1\n2 2\n2 5\n2 6\n2 9\n3 3\n3 8\n4 1\n4 4\n5 5\n5 8\n6 6\n7 7\n8 8\n9 9\n10 4\n10 10\n11 5\n11 11", "output": "1" }, { "input": "22\n1 1\n1 3\n1 4\n1 8\n1 9\n1 11\n2 2\n3 3\n4 4\n4 5\n5 5\n6 6\n6 8\n7 7\n8 3\n8 4\n8 8\n9 9\n10 10\n11 4\n11 9\n11 11", "output": "3" }, { "input": "50\n1 1\n2 2\n2 9\n3 3\n4 4\n4 9\n4 16\n4 24\n5 5\n6 6\n7 7\n8 8\n8 9\n8 20\n9 9\n10 10\n11 11\n12 12\n13 13\n14 7\n14 14\n14 16\n14 25\n15 4\n15 6\n15 15\n15 22\n16 6\n16 16\n17 17\n18 18\n19 6\n19 19\n20 20\n21 21\n22 6\n22 22\n23 23\n24 6\n24 7\n24 8\n24 9\n24 24\n25 1\n25 3\n25 5\n25 7\n25 23\n25 24\n25 25", "output": "7" }, { "input": "55\n1 1\n1 14\n2 2\n2 19\n3 1\n3 3\n3 8\n3 14\n3 23\n4 1\n4 4\n5 5\n5 8\n5 15\n6 2\n6 3\n6 4\n6 6\n7 7\n8 8\n8 21\n9 9\n10 1\n10 10\n11 9\n11 11\n12 12\n13 13\n14 14\n15 15\n15 24\n16 5\n16 16\n17 5\n17 10\n17 17\n17 18\n17 22\n17 27\n18 18\n19 19\n20 20\n21 20\n21 21\n22 22\n23 23\n24 14\n24 24\n25 25\n26 8\n26 11\n26 26\n27 3\n27 27\n28 28", "output": "5" }, { "input": "3\n1 2\n2 1\n2 2", "output": "0" }, { "input": "6\n4 4\n3 4\n5 4\n4 5\n4 3\n3 1", "output": "0" }, { "input": "4\n1 1\n1 2\n2 1\n2 2", "output": "0" }, { "input": "3\n1 1\n2 2\n1 2", "output": "0" }, { "input": "8\n1 3\n1 1\n4 1\n2 2\n2 5\n5 9\n5 1\n5 4", "output": "1" }, { "input": "10\n1 1\n1 2\n1 3\n1 4\n5 5\n6 6\n7 7\n8 8\n9 9\n100 100", "output": "6" }, { "input": "7\n1 1\n2 2\n3 3\n4 4\n1 2\n2 3\n3 4", "output": "0" }, { "input": "6\n1 1\n2 1\n2 2\n2 4\n4 3\n2 3", "output": "0" }, { "input": "4\n3 1\n2 1\n2 2\n1 2", "output": "0" }, { "input": "6\n1 1\n2 2\n2 1\n2 4\n4 3\n2 3", "output": "0" }, { "input": "3\n1 2\n1 3\n1 4", "output": "0" }, { "input": "4\n1 1\n2 2\n1 2\n2 1", "output": "0" }, { "input": "4\n1 3\n2 1\n3 2\n3 1", "output": "1" }, { "input": "7\n1 1\n1 2\n2 2\n3 3\n3 4\n4 4\n1 4", "output": "0" }, { "input": "21\n12 12\n13 12\n12 11\n13 13\n10 10\n11 10\n11 11\n501 500\n501 501\n503 502\n500 500\n503 503\n502 501\n502 502\n700 700\n702 702\n703 702\n701 701\n702 701\n703 703\n701 700", "output": "2" }, { "input": "6\n1 11\n6 8\n11 10\n1 10\n11 11\n6 9", "output": "1" }, { "input": "4\n1 1\n2 2\n3 2\n3 1", "output": "0" }, { "input": "3\n1 2\n3 4\n3 2", "output": "0" }, { "input": "3\n1 1\n1 2\n2 2", "output": "0" }, { "input": "4\n5 5\n5 4\n6 3\n6 4", "output": "0" }, { "input": "3\n1 1\n2 2\n2 1", "output": "0" } ]
1,669,473,638
2,147,483,647
PyPy 3
OK
TESTS
76
184
1,536,000
n = int(input()) a = [] for i in range(n): x, y = map(int, input().split()) a.append([x,y,False]) def df(x): x[2]= True for s in a: if not s[2] and (x[0] == s[0] or x[1] == s[1]): df(s) rj = 0 for i in a: if not i[2]: rj += 1 df(i) print(rj-1)
Title: Ice Skating Time Limit: None seconds Memory Limit: None megabytes Problem Description: Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created. We assume that Bajtek can only heap up snow drifts at integer coordinates. Input Specification: The first line of input contains a single integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≀<=*x**i*,<=*y**i*<=≀<=1000) β€” the coordinates of the *i*-th snow drift. Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct. Output Specification: Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one. Demo Input: ['2\n2 1\n1 2\n', '2\n2 1\n4 1\n'] Demo Output: ['1\n', '0\n'] Note: none
```python n = int(input()) a = [] for i in range(n): x, y = map(int, input().split()) a.append([x,y,False]) def df(x): x[2]= True for s in a: if not s[2] and (x[0] == s[0] or x[1] == s[1]): df(s) rj = 0 for i in a: if not i[2]: rj += 1 df(i) print(rj-1) ```
3
707
A
Brain's Photos
PROGRAMMING
800
[ "implementation" ]
null
null
Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead. As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such). Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour! As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white. Photo can be represented as a matrix sized *n*<=Γ—<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors: - 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black) The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored.
The first line of the input contains two integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=100)Β β€” the number of photo pixel matrix rows and columns respectively. Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'.
Print the "#Black&amp;White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line.
[ "2 2\nC M\nY Y\n", "3 2\nW W\nW W\nB B\n", "1 1\nW\n" ]
[ "#Color", "#Black&amp;White", "#Black&amp;White" ]
none
500
[ { "input": "2 2\nC M\nY Y", "output": "#Color" }, { "input": "3 2\nW W\nW W\nB B", "output": "#Black&White" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "2 3\nW W W\nB G Y", "output": "#Color" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "5 5\nW G B Y M\nG B Y M C\nB Y M C W\nY M C W G\nM C W G B", "output": "#Color" }, { "input": "1 6\nC M Y W G B", "output": "#Color" }, { "input": "1 3\nW G B", "output": "#Black&White" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "5 5\nW G B W G\nG B W G B\nB W G B W\nW G B W G\nG B W G B", "output": "#Black&White" }, { "input": "2 3\nW W W\nB G C", "output": "#Color" }, { "input": "2 3\nW W W\nB G M", "output": "#Color" }, { "input": "3 3\nC B W\nB Y M\nB B W", "output": "#Color" }, { "input": "1 3\nW C W", "output": "#Color" }, { "input": "3 3\nB W B\nB C W\nB W W", "output": "#Color" }, { "input": "1 2\nW Y", "output": "#Color" }, { "input": "1 1\nG", "output": "#Black&White" }, { "input": "1 3\nB G W", "output": "#Black&White" }, { "input": "2 2\nW W\nB C", "output": "#Color" }, { "input": "1 1\nM", "output": "#Color" }, { "input": "1 2\nW C", "output": "#Color" }, { "input": "2 3\nW W M\nW W M", "output": "#Color" }, { "input": "3 2\nW W\nW W\nB C", "output": "#Color" }, { "input": "2 3\nW W C\nW W W", "output": "#Color" }, { "input": "1 3\nG G G", "output": "#Black&White" }, { "input": "1 1\nC", "output": "#Color" }, { "input": "1 2\nC W", "output": "#Color" }, { "input": "1 3\nW W C", "output": "#Color" }, { "input": "2 2\nW B\nB G", "output": "#Black&White" }, { "input": "2 2\nB B\nY Y", "output": "#Color" }, { "input": "2 2\nG G\nC C", "output": "#Color" }, { "input": "1 2\nB C", "output": "#Color" }, { "input": "1 4\nG G G C", "output": "#Color" }, { "input": "1 1\nB", "output": "#Black&White" }, { "input": "2 1\nY\nB", "output": "#Color" } ]
1,690,114,997
2,147,483,647
Python 3
OK
TESTS
50
31
0
nm = input().split(' ') n = int(nm[0]) m = int(nm[1]) count = 0 for i in range(n): colors = input().split(' ') if ('C' in colors) or ('M' in colors) or ('Y' in colors): count = 1 if count==1: print('#Color') else: print('#Black&White')
Title: Brain's Photos Time Limit: None seconds Memory Limit: None megabytes Problem Description: Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead. As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such). Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour! As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white. Photo can be represented as a matrix sized *n*<=Γ—<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors: - 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black) The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored. Input Specification: The first line of the input contains two integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=100)Β β€” the number of photo pixel matrix rows and columns respectively. Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'. Output Specification: Print the "#Black&amp;White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line. Demo Input: ['2 2\nC M\nY Y\n', '3 2\nW W\nW W\nB B\n', '1 1\nW\n'] Demo Output: ['#Color', '#Black&amp;White', '#Black&amp;White'] Note: none
```python nm = input().split(' ') n = int(nm[0]) m = int(nm[1]) count = 0 for i in range(n): colors = input().split(' ') if ('C' in colors) or ('M' in colors) or ('Y' in colors): count = 1 if count==1: print('#Color') else: print('#Black&White') ```
3
894
A
QAQ
PROGRAMMING
800
[ "brute force", "dp" ]
null
null
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth. Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!). Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
The only line contains a string of length *n* (1<=≀<=*n*<=≀<=100). It's guaranteed that the string only contains uppercase English letters.
Print a single integerΒ β€” the number of subsequences "QAQ" in the string.
[ "QAQAQYSYIOIWIN\n", "QAQQQZZYNOIWIN\n" ]
[ "4\n", "3\n" ]
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
500
[ { "input": "QAQAQYSYIOIWIN", "output": "4" }, { "input": "QAQQQZZYNOIWIN", "output": "3" }, { "input": "QA", "output": "0" }, { "input": "IAQVAQZLQBQVQFTQQQADAQJA", "output": "24" }, { "input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ", "output": "378" }, { "input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ", "output": "1077" }, { "input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA", "output": "568" }, { "input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA", "output": "70" }, { "input": "W", "output": "0" }, { "input": "DBA", "output": "0" }, { "input": "RQAWNACASAAKAGAAAAQ", "output": "10" }, { "input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA", "output": "111" }, { "input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA", "output": "411" }, { "input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ", "output": "625" }, { "input": "QORZOYAQ", "output": "1" }, { "input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA", "output": "13174" }, { "input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT", "output": "10420" }, { "input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ", "output": "12488" }, { "input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA", "output": "9114" }, { "input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ", "output": "35937" }, { "input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE", "output": "254" }, { "input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE", "output": "2174" }, { "input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ", "output": "2962" }, { "input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA", "output": "2482" }, { "input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ", "output": "7768" }, { "input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA", "output": "5422" }, { "input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ", "output": "3024" }, { "input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ", "output": "4527" }, { "input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH", "output": "6416" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA", "output": "14270" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ", "output": "13136" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA", "output": "14270" }, { "input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA", "output": "14231" }, { "input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA", "output": "15296" }, { "input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ", "output": "0" }, { "input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA", "output": "0" }, { "input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ", "output": "0" }, { "input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA", "output": "20825" }, { "input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ", "output": "20825" }, { "input": "Q", "output": "0" }, { "input": "A", "output": "0" }, { "input": "FFF", "output": "0" }, { "input": "AAAAAA", "output": "0" } ]
1,632,507,312
2,147,483,647
Python 3
OK
TESTS
43
77
6,758,400
count = 0 string = input() for i, char in enumerate(string): if char == 'A': count += string[:i].count('Q') * string[i:].count('Q') print(count)
Title: QAQ Time Limit: None seconds Memory Limit: None megabytes Problem Description: "QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth. Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!). Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact. Input Specification: The only line contains a string of length *n* (1<=≀<=*n*<=≀<=100). It's guaranteed that the string only contains uppercase English letters. Output Specification: Print a single integerΒ β€” the number of subsequences "QAQ" in the string. Demo Input: ['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n'] Demo Output: ['4\n', '3\n'] Note: In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
```python count = 0 string = input() for i, char in enumerate(string): if char == 'A': count += string[:i].count('Q') * string[i:].count('Q') print(count) ```
3
262
A
Roma and Lucky Numbers
PROGRAMMING
800
[ "implementation" ]
null
null
Roma (a popular Russian name that means 'Roman') loves the Little Lvov Elephant's lucky numbers. Let us remind you that lucky numbers are positive integers whose decimal representation only contains lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. Roma's got *n* positive integers. He wonders, how many of those integers have not more than *k* lucky digits? Help him, write the program that solves the problem.
The first line contains two integers *n*, *k* (1<=≀<=*n*,<=*k*<=≀<=100). The second line contains *n* integers *a**i* (1<=≀<=*a**i*<=≀<=109) β€” the numbers that Roma has. The numbers in the lines are separated by single spaces.
In a single line print a single integer β€” the answer to the problem.
[ "3 4\n1 2 4\n", "3 2\n447 44 77\n" ]
[ "3\n", "2\n" ]
In the first sample all numbers contain at most four lucky digits, so the answer is 3. In the second sample number 447 doesn't fit in, as it contains more than two lucky digits. All other numbers are fine, so the answer is 2.
500
[ { "input": "3 4\n1 2 4", "output": "3" }, { "input": "3 2\n447 44 77", "output": "2" }, { "input": "2 2\n507978501 180480073", "output": "2" }, { "input": "9 6\n655243746 167613748 1470546 57644035 176077477 56984809 44677 215706823 369042089", "output": "9" }, { "input": "6 100\n170427799 37215529 675016434 168544291 683447134 950090227", "output": "6" }, { "input": "4 2\n194041605 706221269 69909135 257655784", "output": "3" }, { "input": "4 2\n9581849 67346651 530497 272158241", "output": "4" }, { "input": "3 47\n378261451 163985731 230342101", "output": "3" }, { "input": "2 3\n247776868 480572137", "output": "1" }, { "input": "7 77\n366496749 549646417 278840199 119255907 33557677 379268590 150378796", "output": "7" }, { "input": "40 31\n32230963 709031779 144328646 513494529 36547831 416998222 84161665 318773941 170724397 553666286 368402971 48581613 31452501 368026285 47903381 939151438 204145360 189920160 288159400 133145006 314295423 450219949 160203213 358403181 478734385 29331901 31051111 110710191 567314089 139695685 111511396 87708701 317333277 103301481 110400517 634446253 481551313 39202255 105948 738066085", "output": "40" }, { "input": "1 8\n55521105", "output": "1" }, { "input": "49 3\n34644511 150953622 136135827 144208961 359490601 86708232 719413689 188605873 64330753 488776302 104482891 63360106 437791390 46521319 70778345 339141601 136198441 292941209 299339510 582531183 555958105 437904637 74219097 439816011 236010407 122674666 438442529 186501223 63932449 407678041 596993853 92223251 849265278 480265849 30983497 330283357 186901672 20271344 794252593 123774176 27851201 52717531 479907210 196833889 149331196 82147847 255966471 278600081 899317843", "output": "44" }, { "input": "26 2\n330381357 185218042 850474297 483015466 296129476 1205865 538807493 103205601 160403321 694220263 416255901 7245756 507755361 88187633 91426751 1917161 58276681 59540376 576539745 595950717 390256887 105690055 607818885 28976353 488947089 50643601", "output": "22" }, { "input": "38 1\n194481717 126247087 815196361 106258801 381703249 283859137 15290101 40086151 213688513 577996947 513899717 371428417 107799271 11136651 5615081 323386401 381128815 34217126 17709913 520702093 201694245 570931849 169037023 417019726 282437316 7417126 271667553 11375851 185087449 410130883 383045677 5764771 905017051 328584026 215330671 299553233 15838255 234532105", "output": "20" }, { "input": "44 9\n683216389 250581469 130029957 467020047 188395565 206237982 63257361 68314981 732878407 563579660 199133851 53045209 665723851 16273169 10806790 556633156 350593410 474645249 478790761 708234243 71841230 18090541 19836685 146373571 17947452 534010506 46933264 377035021 311636557 75193963 54321761 12759959 71120181 548816939 23608621 31876417 107672995 72575155 369667956 20574379 210596751 532163173 75726739 853719629", "output": "44" }, { "input": "8 6\n204157376 10514197 65483881 347219841 263304577 296402721 11739011 229776191", "output": "8" }, { "input": "38 29\n333702889 680931737 61137217 203030505 68728281 11414209 642645708 590904616 3042901 607198177 189041074 700764043 813035201 198341461 126403544 401436841 420826465 45046581 20249976 46978855 46397957 706610773 24701041 57954481 51603266 593109701 385569073 178982291 582152863 287317968 1474090 34825141 432421977 130257781 151516903 540852403 548392 117246529", "output": "38" }, { "input": "19 3\n562569697 549131571 50676718 84501863 74567295 702372009 365895280 451459937 40378543 167666701 158635641 53639293 442332661 825055617 100109161 326616021 862332843 533271196 4791547", "output": "18" }, { "input": "1 1\n44", "output": "0" }, { "input": "1 1\n4", "output": "1" }, { "input": "10 3\n444 447 774 777 7777 4447 4 7 7 4", "output": "8" } ]
1,659,220,033
2,147,483,647
Python 3
OK
TESTS
34
92
0
n = [int(x) for x in input().split()] s = input().split() count = 0 for i in range(0, n[0]): count2 = 0 for j in range(0, len(s[i])): if s[i][j] == "4" or s[i][j] == "7": count2 += 1 if count2 <= n[1]: count += 1 print(count)
Title: Roma and Lucky Numbers Time Limit: None seconds Memory Limit: None megabytes Problem Description: Roma (a popular Russian name that means 'Roman') loves the Little Lvov Elephant's lucky numbers. Let us remind you that lucky numbers are positive integers whose decimal representation only contains lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not. Roma's got *n* positive integers. He wonders, how many of those integers have not more than *k* lucky digits? Help him, write the program that solves the problem. Input Specification: The first line contains two integers *n*, *k* (1<=≀<=*n*,<=*k*<=≀<=100). The second line contains *n* integers *a**i* (1<=≀<=*a**i*<=≀<=109) β€” the numbers that Roma has. The numbers in the lines are separated by single spaces. Output Specification: In a single line print a single integer β€” the answer to the problem. Demo Input: ['3 4\n1 2 4\n', '3 2\n447 44 77\n'] Demo Output: ['3\n', '2\n'] Note: In the first sample all numbers contain at most four lucky digits, so the answer is 3. In the second sample number 447 doesn't fit in, as it contains more than two lucky digits. All other numbers are fine, so the answer is 2.
```python n = [int(x) for x in input().split()] s = input().split() count = 0 for i in range(0, n[0]): count2 = 0 for j in range(0, len(s[i])): if s[i][j] == "4" or s[i][j] == "7": count2 += 1 if count2 <= n[1]: count += 1 print(count) ```
3
711
A
Bus to Udayland
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
ZS the Coder and Chris the Baboon are travelling to Udayland! To get there, they have to get on the special IOI bus. The IOI bus has *n* rows of seats. There are 4 seats in each row, and the seats are separated into pairs by a walkway. When ZS and Chris came, some places in the bus was already occupied. ZS and Chris are good friends. They insist to get a pair of neighbouring empty seats. Two seats are considered neighbouring if they are in the same row and in the same pair. Given the configuration of the bus, can you help ZS and Chris determine where they should sit?
The first line of the input contains a single integer *n* (1<=≀<=*n*<=≀<=1000)Β β€” the number of rows of seats in the bus. Then, *n* lines follow. Each line contains exactly 5 characters, the first two of them denote the first pair of seats in the row, the third character denotes the walkway (it always equals '|') and the last two of them denote the second pair of seats in the row. Each character, except the walkway, equals to 'O' or to 'X'. 'O' denotes an empty seat, 'X' denotes an occupied seat. See the sample cases for more details.
If it is possible for Chris and ZS to sit at neighbouring empty seats, print "YES" (without quotes) in the first line. In the next *n* lines print the bus configuration, where the characters in the pair of seats for Chris and ZS is changed with characters '+'. Thus the configuration should differ from the input one by exactly two charaters (they should be equal to 'O' in the input and to '+' in the output). If there is no pair of seats for Chris and ZS, print "NO" (without quotes) in a single line. If there are multiple solutions, you may print any of them.
[ "6\nOO|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n", "4\nXO|OX\nXO|XX\nOX|OX\nXX|OX\n", "5\nXX|XX\nXX|XX\nXO|OX\nXO|OO\nOX|XO\n" ]
[ "YES\n++|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n", "NO\n", "YES\nXX|XX\nXX|XX\nXO|OX\nXO|++\nOX|XO\n" ]
Note that the following is an incorrect configuration for the first sample case because the seats must be in the same pair. O+|+X XO|XX OX|OO XX|OX OO|OO OO|XX
500
[ { "input": "6\nOO|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX", "output": "YES\n++|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX" }, { "input": "4\nXO|OX\nXO|XX\nOX|OX\nXX|OX", "output": "NO" }, { "input": "5\nXX|XX\nXX|XX\nXO|OX\nXO|OO\nOX|XO", "output": "YES\nXX|XX\nXX|XX\nXO|OX\nXO|++\nOX|XO" }, { "input": "1\nXO|OX", "output": "NO" }, { "input": "1\nOO|OO", "output": "YES\n++|OO" }, { "input": "4\nXO|XX\nXX|XO\nOX|XX\nXO|XO", "output": "NO" }, { "input": "9\nOX|XO\nOX|XO\nXO|OX\nOX|OX\nXO|OX\nXX|OO\nOX|OX\nOX|XO\nOX|OX", "output": "YES\nOX|XO\nOX|XO\nXO|OX\nOX|OX\nXO|OX\nXX|++\nOX|OX\nOX|XO\nOX|OX" }, { "input": "61\nOX|XX\nOX|XX\nOX|XX\nXO|XO\nXX|XO\nXX|XX\nXX|XX\nOX|XX\nXO|XO\nOX|XO\nXO|OX\nXX|XX\nXX|XX\nOX|OX\nXX|OX\nOX|XO\nOX|XO\nXO|OX\nXO|XX\nOX|XX\nOX|XX\nXO|OX\nXO|XX\nXO|XX\nOX|XX\nXX|XX\nXX|XO\nXO|XX\nXX|XX\nXO|OX\nXX|XO\nXO|XX\nXO|XO\nXO|OX\nXX|OX\nXO|OX\nOX|XX\nXX|OX\nXX|XX\nOX|XO\nOX|XX\nXO|OX\nOX|XX\nOX|XX\nXO|XO\nXO|XX\nOX|XX\nXO|XO\nOX|XX\nXX|XX\nOX|XO\nXO|XO\nXO|XO\nOX|OX\nXX|OX\nXX|OX\nOX|XO\nOX|XX\nOX|OX\nXO|XX\nOX|XX", "output": "NO" }, { "input": "1\nOO|XX", "output": "YES\n++|XX" }, { "input": "10\nOO|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|XX", "output": "YES\n++|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|XX" }, { "input": "10\nXX|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|OO", "output": "YES\nXX|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|++" }, { "input": "5\nXX|XX\nXX|XX\nXO|OX\nOO|OX\nOX|XO", "output": "YES\nXX|XX\nXX|XX\nXO|OX\n++|OX\nOX|XO" }, { "input": "6\nOO|XX\nXO|XX\nOX|OO\nXX|OX\nOO|XX\nOX|XX", "output": "YES\n++|XX\nXO|XX\nOX|OO\nXX|OX\nOO|XX\nOX|XX" } ]
1,668,841,535
2,147,483,647
PyPy 3-64
OK
TESTS
71
109
3,481,600
f = 1 ans = [] for i in range(int(input())): a = input() if 'OO' in a and f: ans.append(a.replace('OO','++',1)) f = 0 else: ans.append(a) if f: print('NO') else: print('YES') print(*ans,sep='\n')
Title: Bus to Udayland Time Limit: None seconds Memory Limit: None megabytes Problem Description: ZS the Coder and Chris the Baboon are travelling to Udayland! To get there, they have to get on the special IOI bus. The IOI bus has *n* rows of seats. There are 4 seats in each row, and the seats are separated into pairs by a walkway. When ZS and Chris came, some places in the bus was already occupied. ZS and Chris are good friends. They insist to get a pair of neighbouring empty seats. Two seats are considered neighbouring if they are in the same row and in the same pair. Given the configuration of the bus, can you help ZS and Chris determine where they should sit? Input Specification: The first line of the input contains a single integer *n* (1<=≀<=*n*<=≀<=1000)Β β€” the number of rows of seats in the bus. Then, *n* lines follow. Each line contains exactly 5 characters, the first two of them denote the first pair of seats in the row, the third character denotes the walkway (it always equals '|') and the last two of them denote the second pair of seats in the row. Each character, except the walkway, equals to 'O' or to 'X'. 'O' denotes an empty seat, 'X' denotes an occupied seat. See the sample cases for more details. Output Specification: If it is possible for Chris and ZS to sit at neighbouring empty seats, print "YES" (without quotes) in the first line. In the next *n* lines print the bus configuration, where the characters in the pair of seats for Chris and ZS is changed with characters '+'. Thus the configuration should differ from the input one by exactly two charaters (they should be equal to 'O' in the input and to '+' in the output). If there is no pair of seats for Chris and ZS, print "NO" (without quotes) in a single line. If there are multiple solutions, you may print any of them. Demo Input: ['6\nOO|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n', '4\nXO|OX\nXO|XX\nOX|OX\nXX|OX\n', '5\nXX|XX\nXX|XX\nXO|OX\nXO|OO\nOX|XO\n'] Demo Output: ['YES\n++|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n', 'NO\n', 'YES\nXX|XX\nXX|XX\nXO|OX\nXO|++\nOX|XO\n'] Note: Note that the following is an incorrect configuration for the first sample case because the seats must be in the same pair. O+|+X XO|XX OX|OO XX|OX OO|OO OO|XX
```python f = 1 ans = [] for i in range(int(input())): a = input() if 'OO' in a and f: ans.append(a.replace('OO','++',1)) f = 0 else: ans.append(a) if f: print('NO') else: print('YES') print(*ans,sep='\n') ```
3
479
C
Exams
PROGRAMMING
1,400
[ "greedy", "sortings" ]
null
null
Student Valera is an undergraduate student at the University. His end of term exams are approaching and he is to pass exactly *n* exams. Valera is a smart guy, so he will be able to pass any exam he takes on his first try. Besides, he can take several exams on one day, and in any order. According to the schedule, a student can take the exam for the *i*-th subject on the day number *a**i*. However, Valera has made an arrangement with each teacher and the teacher of the *i*-th subject allowed him to take an exam before the schedule time on day *b**i* (*b**i*<=&lt;<=*a**i*). Thus, Valera can take an exam for the *i*-th subject either on day *a**i*, or on day *b**i*. All the teachers put the record of the exam in the student's record book on the day of the actual exam and write down the date of the mark as number *a**i*. Valera believes that it would be rather strange if the entries in the record book did not go in the order of non-decreasing date. Therefore Valera asks you to help him. Find the minimum possible value of the day when Valera can take the final exam if he takes exams so that all the records in his record book go in the order of non-decreasing date.
The first line contains a single positive integer *n* (1<=≀<=*n*<=≀<=5000) β€” the number of exams Valera will take. Each of the next *n* lines contains two positive space-separated integers *a**i* and *b**i* (1<=≀<=*b**i*<=&lt;<=*a**i*<=≀<=109) β€” the date of the exam in the schedule and the early date of passing the *i*-th exam, correspondingly.
Print a single integer β€” the minimum possible number of the day when Valera can take the last exam if he takes all the exams so that all the records in his record book go in the order of non-decreasing date.
[ "3\n5 2\n3 1\n4 2\n", "3\n6 1\n5 2\n4 3\n" ]
[ "2\n", "6\n" ]
In the first sample Valera first takes an exam in the second subject on the first day (the teacher writes down the schedule date that is 3). On the next day he takes an exam in the third subject (the teacher writes down the schedule date, 4), then he takes an exam in the first subject (the teacher writes down the mark with date 5). Thus, Valera takes the last exam on the second day and the dates will go in the non-decreasing order: 3, 4, 5. In the second sample Valera first takes an exam in the third subject on the fourth day. Then he takes an exam in the second subject on the fifth day. After that on the sixth day Valera takes an exam in the first subject.
1,500
[ { "input": "3\n5 2\n3 1\n4 2", "output": "2" }, { "input": "3\n6 1\n5 2\n4 3", "output": "6" }, { "input": "1\n1000000000 999999999", "output": "999999999" }, { "input": "1\n2 1", "output": "1" }, { "input": "2\n3 2\n3 2", "output": "2" }, { "input": "5\n4 3\n4 2\n4 1\n4 1\n4 1", "output": "3" }, { "input": "6\n12 11\n10 9\n8 7\n6 5\n4 3\n2 1", "output": "11" }, { "input": "2\n3 1\n3 2", "output": "2" }, { "input": "2\n4 2\n4 1", "output": "2" }, { "input": "2\n5 2\n5 1", "output": "2" }, { "input": "6\n3 1\n3 2\n4 1\n4 2\n5 4\n5 4", "output": "4" }, { "input": "3\n3 2\n4 1\n100 10", "output": "10" }, { "input": "3\n4 3\n5 2\n10 8", "output": "8" }, { "input": "5\n6 5\n6 4\n6 3\n6 2\n6 1", "output": "5" }, { "input": "3\n5 4\n6 3\n8 7", "output": "7" }, { "input": "4\n7 1\n7 3\n8 2\n9 8", "output": "8" }, { "input": "3\n3 2\n4 1\n10 5", "output": "5" }, { "input": "3\n5 4\n6 3\n11 10", "output": "10" }, { "input": "4\n2 1\n3 2\n4 1\n6 5", "output": "5" } ]
1,696,859,162
2,147,483,647
PyPy 3-64
OK
TESTS
53
155
5,734,400
n = int(input()) exams = [] for i in range(n): exams.append(list(map(int, input().split()))) # print(exams) exams.sort() start = exams[0][1] # print(exams) for s,e in exams: # print(vals) if e >= start: start = e else: start = s # print(vals) print(start)
Title: Exams Time Limit: None seconds Memory Limit: None megabytes Problem Description: Student Valera is an undergraduate student at the University. His end of term exams are approaching and he is to pass exactly *n* exams. Valera is a smart guy, so he will be able to pass any exam he takes on his first try. Besides, he can take several exams on one day, and in any order. According to the schedule, a student can take the exam for the *i*-th subject on the day number *a**i*. However, Valera has made an arrangement with each teacher and the teacher of the *i*-th subject allowed him to take an exam before the schedule time on day *b**i* (*b**i*<=&lt;<=*a**i*). Thus, Valera can take an exam for the *i*-th subject either on day *a**i*, or on day *b**i*. All the teachers put the record of the exam in the student's record book on the day of the actual exam and write down the date of the mark as number *a**i*. Valera believes that it would be rather strange if the entries in the record book did not go in the order of non-decreasing date. Therefore Valera asks you to help him. Find the minimum possible value of the day when Valera can take the final exam if he takes exams so that all the records in his record book go in the order of non-decreasing date. Input Specification: The first line contains a single positive integer *n* (1<=≀<=*n*<=≀<=5000) β€” the number of exams Valera will take. Each of the next *n* lines contains two positive space-separated integers *a**i* and *b**i* (1<=≀<=*b**i*<=&lt;<=*a**i*<=≀<=109) β€” the date of the exam in the schedule and the early date of passing the *i*-th exam, correspondingly. Output Specification: Print a single integer β€” the minimum possible number of the day when Valera can take the last exam if he takes all the exams so that all the records in his record book go in the order of non-decreasing date. Demo Input: ['3\n5 2\n3 1\n4 2\n', '3\n6 1\n5 2\n4 3\n'] Demo Output: ['2\n', '6\n'] Note: In the first sample Valera first takes an exam in the second subject on the first day (the teacher writes down the schedule date that is 3). On the next day he takes an exam in the third subject (the teacher writes down the schedule date, 4), then he takes an exam in the first subject (the teacher writes down the mark with date 5). Thus, Valera takes the last exam on the second day and the dates will go in the non-decreasing order: 3, 4, 5. In the second sample Valera first takes an exam in the third subject on the fourth day. Then he takes an exam in the second subject on the fifth day. After that on the sixth day Valera takes an exam in the first subject.
```python n = int(input()) exams = [] for i in range(n): exams.append(list(map(int, input().split()))) # print(exams) exams.sort() start = exams[0][1] # print(exams) for s,e in exams: # print(vals) if e >= start: start = e else: start = s # print(vals) print(start) ```
3
761
A
Dasha and Stairs
PROGRAMMING
1,000
[ "brute force", "constructive algorithms", "implementation", "math" ]
null
null
On her way to programming school tiger Dasha faced her first test β€” a huge staircase! The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values β€” the number of steps with even and odd numbers. You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≀<=*l*<=≀<=*r*), for which values that Dasha has found are correct.
In the only line you are given two integers *a*, *b* (0<=≀<=*a*,<=*b*<=≀<=100) β€” the number of even and odd steps, accordingly.
In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise.
[ "2 3\n", "3 1\n" ]
[ "YES\n", "NO\n" ]
In the first example one of suitable intervals is from 1 to 5. The interval contains two even stepsΒ β€” 2 and 4, and three odd: 1, 3 and 5.
500
[ { "input": "2 3", "output": "YES" }, { "input": "3 1", "output": "NO" }, { "input": "5 4", "output": "YES" }, { "input": "9 9", "output": "YES" }, { "input": "85 95", "output": "NO" }, { "input": "0 1", "output": "YES" }, { "input": "89 25", "output": "NO" }, { "input": "74 73", "output": "YES" }, { "input": "62 39", "output": "NO" }, { "input": "57 57", "output": "YES" }, { "input": "100 99", "output": "YES" }, { "input": "0 0", "output": "NO" }, { "input": "98 100", "output": "NO" }, { "input": "99 100", "output": "YES" }, { "input": "1 0", "output": "YES" }, { "input": "100 0", "output": "NO" }, { "input": "0 100", "output": "NO" }, { "input": "100 98", "output": "NO" }, { "input": "100 100", "output": "YES" }, { "input": "0 5", "output": "NO" }, { "input": "2 2", "output": "YES" } ]
1,486,239,522
2,147,483,647
Python 3
OK
TESTS
21
62
4,608,000
n,m=map(int, input().split()) if n==0 and m==0: print('NO') elif abs(n-m)<=1: print('YES') else: print('NO')
Title: Dasha and Stairs Time Limit: None seconds Memory Limit: None megabytes Problem Description: On her way to programming school tiger Dasha faced her first test β€” a huge staircase! The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values β€” the number of steps with even and odd numbers. You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≀<=*l*<=≀<=*r*), for which values that Dasha has found are correct. Input Specification: In the only line you are given two integers *a*, *b* (0<=≀<=*a*,<=*b*<=≀<=100) β€” the number of even and odd steps, accordingly. Output Specification: In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise. Demo Input: ['2 3\n', '3 1\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first example one of suitable intervals is from 1 to 5. The interval contains two even stepsΒ β€” 2 and 4, and three odd: 1, 3 and 5.
```python n,m=map(int, input().split()) if n==0 and m==0: print('NO') elif abs(n-m)<=1: print('YES') else: print('NO') ```
3
12
A
Super Agent
PROGRAMMING
800
[ "implementation" ]
A. Super Agent
2
256
There is a very secret base in Potatoland where potato mash is made according to a special recipe. The neighbours from Porridgia decided to seize this recipe and to sell it to Pilauland. For this mission they have been preparing special agent Pearlo for many years. When, finally, Pearlo learned all secrets of espionage, he penetrated into the Potatoland territory and reached the secret base. Now he is standing at the entrance, but to get inside he need to pass combination lock. Minute ago one of the workers entered the password on the terminal and opened the door. The terminal is a square digital keyboard 3<=Γ—<=3 with digits from 1 to 9. Pearlo knows that the password consists from distinct digits and is probably symmetric with respect to the central button of the terminal. He has heat sensor which allowed him to detect the digits which the worker pressed. Now he wants to check whether the password entered by the worker is symmetric with respect to the central button of the terminal. This fact can Help Pearlo to reduce the number of different possible password combinations.
Input contains the matrix of three rows of three symbols each. Symbol Β«XΒ» means that the corresponding button was pressed, and Β«.Β» means that is was not pressed. The matrix may contain no Β«XΒ», also it may contain no Β«.Β».
Print YES if the password is symmetric with respect to the central button of the terminal and NO otherwise.
[ "XX.\n...\n.XX\n", "X.X\nX..\n...\n" ]
[ "YES\n", "NO\n" ]
If you are not familiar with the term Β«central symmetryΒ», you may look into http://en.wikipedia.org/wiki/Central_symmetry
0
[ { "input": "XX.\n...\n.XX", "output": "YES" }, { "input": ".X.\n.X.\n.X.", "output": "YES" }, { "input": "XXX\nXXX\nXXX", "output": "YES" }, { "input": "XXX\nX.X\nXXX", "output": "YES" }, { "input": "X..\n.X.\n..X", "output": "YES" }, { "input": "...\nX.X\nX..", "output": "NO" }, { "input": ".X.\nX.X\n.X.", "output": "YES" }, { "input": "X.X\n.X.\nX.X", "output": "YES" }, { "input": "...\n...\n..X", "output": "NO" }, { "input": "XXX\n...\nXXX", "output": "YES" }, { "input": "..X\nX..\n..X", "output": "NO" }, { "input": ".X.\n...\nX.X", "output": "NO" }, { "input": "X.X\nX.X\nX.X", "output": "YES" }, { "input": ".X.\nX.X\nXX.", "output": "NO" }, { "input": "...\nXXX\nXXX", "output": "NO" }, { "input": "XXX\n..X\nXXX", "output": "NO" }, { "input": "X..\nX.X\n.X.", "output": "NO" }, { "input": "...\n..X\nXXX", "output": "NO" }, { "input": "..X\nX.X\nX..", "output": "YES" }, { "input": "..X\n..X\nXXX", "output": "NO" }, { "input": "X..\nX..\nX..", "output": "NO" }, { "input": "XXX\n.X.\nXXX", "output": "YES" }, { "input": "..X\n...\nX..", "output": "YES" }, { "input": "...\n...\nX..", "output": "NO" }, { "input": "...\n...\n.X.", "output": "NO" }, { "input": "...\n...\n..X", "output": "NO" }, { "input": "...\n.X.\nX..", "output": "NO" } ]
1,618,048,774
2,147,483,647
Python 3
OK
TESTS
40
124
0
# -*- coding: utf-8 -*- """ Created on Tue Mar 30 19:32:51 2021 @author: nehas """ r1=input() r2=input() r3=input() if(r1[0]==r3[2] and r1[1]==r3[1] and r1[2]==r3[0] and r2[0]==r2[2]): print("YES") else: print("NO")
Title: Super Agent Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: There is a very secret base in Potatoland where potato mash is made according to a special recipe. The neighbours from Porridgia decided to seize this recipe and to sell it to Pilauland. For this mission they have been preparing special agent Pearlo for many years. When, finally, Pearlo learned all secrets of espionage, he penetrated into the Potatoland territory and reached the secret base. Now he is standing at the entrance, but to get inside he need to pass combination lock. Minute ago one of the workers entered the password on the terminal and opened the door. The terminal is a square digital keyboard 3<=Γ—<=3 with digits from 1 to 9. Pearlo knows that the password consists from distinct digits and is probably symmetric with respect to the central button of the terminal. He has heat sensor which allowed him to detect the digits which the worker pressed. Now he wants to check whether the password entered by the worker is symmetric with respect to the central button of the terminal. This fact can Help Pearlo to reduce the number of different possible password combinations. Input Specification: Input contains the matrix of three rows of three symbols each. Symbol Β«XΒ» means that the corresponding button was pressed, and Β«.Β» means that is was not pressed. The matrix may contain no Β«XΒ», also it may contain no Β«.Β». Output Specification: Print YES if the password is symmetric with respect to the central button of the terminal and NO otherwise. Demo Input: ['XX.\n...\n.XX\n', 'X.X\nX..\n...\n'] Demo Output: ['YES\n', 'NO\n'] Note: If you are not familiar with the term Β«central symmetryΒ», you may look into http://en.wikipedia.org/wiki/Central_symmetry
```python # -*- coding: utf-8 -*- """ Created on Tue Mar 30 19:32:51 2021 @author: nehas """ r1=input() r2=input() r3=input() if(r1[0]==r3[2] and r1[1]==r3[1] and r1[2]==r3[0] and r2[0]==r2[2]): print("YES") else: print("NO") ```
3.969
709
A
Juicer
PROGRAMMING
900
[ "implementation" ]
null
null
Kolya is going to make fresh orange juice. He has *n* oranges of sizes *a*1,<=*a*2,<=...,<=*a**n*. Kolya will put them in the juicer in the fixed order, starting with orange of size *a*1, then orange of size *a*2 and so on. To be put in the juicer the orange must have size not exceeding *b*, so if Kolya sees an orange that is strictly greater he throws it away and continues with the next one. The juicer has a special section to collect waste. It overflows if Kolya squeezes oranges of the total size strictly greater than *d*. When it happens Kolya empties the waste section (even if there are no more oranges) and continues to squeeze the juice. How many times will he have to empty the waste section?
The first line of the input contains three integers *n*, *b* and *d* (1<=≀<=*n*<=≀<=100<=000, 1<=≀<=*b*<=≀<=*d*<=≀<=1<=000<=000)Β β€” the number of oranges, the maximum size of the orange that fits in the juicer and the value *d*, which determines the condition when the waste section should be emptied. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=1<=000<=000)Β β€” sizes of the oranges listed in the order Kolya is going to try to put them in the juicer.
Print one integerΒ β€” the number of times Kolya will have to empty the waste section.
[ "2 7 10\n5 6\n", "1 5 10\n7\n", "3 10 10\n5 7 7\n", "1 1 1\n1\n" ]
[ "1\n", "0\n", "1\n", "0\n" ]
In the first sample, Kolya will squeeze the juice from two oranges and empty the waste section afterwards. In the second sample, the orange won't fit in the juicer so Kolya will have no juice at all.
500
[ { "input": "2 7 10\n5 6", "output": "1" }, { "input": "1 5 10\n7", "output": "0" }, { "input": "3 10 10\n5 7 7", "output": "1" }, { "input": "1 1 1\n1", "output": "0" }, { "input": "2 951637 951638\n44069 951637", "output": "1" }, { "input": "50 100 129\n55 130 91 19 116 3 63 52 104 76 75 27 151 99 149 147 39 148 84 9 132 49 40 112 124 141 144 93 36 32 146 74 48 38 150 55 94 32 107 69 77 81 33 57 62 98 78 127 154 126", "output": "12" }, { "input": "100 1000 1083\n992 616 818 359 609 783 263 989 501 929 362 394 919 1081 870 830 1097 975 62 346 531 367 323 457 707 360 949 334 867 116 478 417 961 963 1029 114 867 1008 988 916 983 1077 959 942 572 961 579 318 721 337 488 717 111 70 416 685 987 130 353 107 61 191 827 849 106 815 211 953 111 398 889 860 801 71 375 320 395 1059 116 222 931 444 582 74 677 655 88 173 686 491 661 186 114 832 615 814 791 464 517 850", "output": "36" }, { "input": "2 6 8\n2 1", "output": "0" }, { "input": "5 15 16\n7 11 5 12 8", "output": "2" }, { "input": "15 759966 759967\n890397 182209 878577 548548 759966 812923 759966 860479 200595 381358 299175 339368 759966 907668 69574", "output": "4" }, { "input": "5 234613 716125\n642626 494941 234613 234613 234613", "output": "0" }, { "input": "50 48547 567054\n529808 597004 242355 559114 78865 537318 631455 733020 655072 645093 309010 855034 306058 625046 524574 834944 27330 664392 443637 821584 338013 490702 289520 675471 885846 258814 134220 571301 84875 94132 200425 928833 375166 521232 317961 175315 947093 89971 322071 174033 48547 998535 954205 704114 943163 438900 48547 538422 48547 48547", "output": "0" }, { "input": "5 10 20\n10 10 10 10 1", "output": "1" }, { "input": "5 10 11\n10 10 10 10 1", "output": "2" }, { "input": "3 10 10\n4 3 3", "output": "0" }, { "input": "3 5 5\n5 5 5", "output": "1" }, { "input": "3 4 14\n5 5 5", "output": "0" }, { "input": "2 7 10\n1234 1234", "output": "0" }, { "input": "1 5 6\n10", "output": "0" }, { "input": "3 4 6\n1 2 3", "output": "0" }, { "input": "5 10 12\n13 13 13 13 13", "output": "0" }, { "input": "3 4 5\n5 7 9", "output": "0" }, { "input": "3 10 100\n5 5 5", "output": "0" }, { "input": "5 1 2\n2 2 2 2 2", "output": "0" }, { "input": "5 5 5\n5 5 5 5 5", "output": "2" }, { "input": "2 2 5\n5 5", "output": "0" }, { "input": "3 1 4\n2 2 2", "output": "0" } ]
1,687,613,448
2,147,483,647
PyPy 3-64
OK
TESTS
58
92
11,673,600
n,b,d = map(int,input().split()) ai = [int(x) for x in input().split()] empty = section = 0 for a in ai: if a <= b: section += a if section > d: section = 0 empty += 1 print(empty)
Title: Juicer Time Limit: None seconds Memory Limit: None megabytes Problem Description: Kolya is going to make fresh orange juice. He has *n* oranges of sizes *a*1,<=*a*2,<=...,<=*a**n*. Kolya will put them in the juicer in the fixed order, starting with orange of size *a*1, then orange of size *a*2 and so on. To be put in the juicer the orange must have size not exceeding *b*, so if Kolya sees an orange that is strictly greater he throws it away and continues with the next one. The juicer has a special section to collect waste. It overflows if Kolya squeezes oranges of the total size strictly greater than *d*. When it happens Kolya empties the waste section (even if there are no more oranges) and continues to squeeze the juice. How many times will he have to empty the waste section? Input Specification: The first line of the input contains three integers *n*, *b* and *d* (1<=≀<=*n*<=≀<=100<=000, 1<=≀<=*b*<=≀<=*d*<=≀<=1<=000<=000)Β β€” the number of oranges, the maximum size of the orange that fits in the juicer and the value *d*, which determines the condition when the waste section should be emptied. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=1<=000<=000)Β β€” sizes of the oranges listed in the order Kolya is going to try to put them in the juicer. Output Specification: Print one integerΒ β€” the number of times Kolya will have to empty the waste section. Demo Input: ['2 7 10\n5 6\n', '1 5 10\n7\n', '3 10 10\n5 7 7\n', '1 1 1\n1\n'] Demo Output: ['1\n', '0\n', '1\n', '0\n'] Note: In the first sample, Kolya will squeeze the juice from two oranges and empty the waste section afterwards. In the second sample, the orange won't fit in the juicer so Kolya will have no juice at all.
```python n,b,d = map(int,input().split()) ai = [int(x) for x in input().split()] empty = section = 0 for a in ai: if a <= b: section += a if section > d: section = 0 empty += 1 print(empty) ```
3
116
A
Tram
PROGRAMMING
800
[ "implementation" ]
null
null
Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty. Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram.
The first line contains a single number *n* (2<=≀<=*n*<=≀<=1000) β€” the number of the tram's stops. Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≀<=*a**i*,<=*b**i*<=≀<=1000) β€” the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement. - The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0.
Print a single integer denoting the minimum possible capacity of the tram (0 is allowed).
[ "4\n0 3\n2 5\n4 2\n4 0\n" ]
[ "6\n" ]
For the first example, a capacity of 6 is sufficient: - At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints. Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
500
[ { "input": "4\n0 3\n2 5\n4 2\n4 0", "output": "6" }, { "input": "5\n0 4\n4 6\n6 5\n5 4\n4 0", "output": "6" }, { "input": "10\n0 5\n1 7\n10 8\n5 3\n0 5\n3 3\n8 8\n0 6\n10 1\n9 0", "output": "18" }, { "input": "3\n0 1\n1 1\n1 0", "output": "1" }, { "input": "4\n0 1\n0 1\n1 0\n1 0", "output": "2" }, { "input": "3\n0 0\n0 0\n0 0", "output": "0" }, { "input": "3\n0 1000\n1000 1000\n1000 0", "output": "1000" }, { "input": "5\n0 73\n73 189\n189 766\n766 0\n0 0", "output": "766" }, { "input": "5\n0 0\n0 0\n0 0\n0 1\n1 0", "output": "1" }, { "input": "5\n0 917\n917 923\n904 992\n1000 0\n11 0", "output": "1011" }, { "input": "5\n0 1\n1 2\n2 1\n1 2\n2 0", "output": "2" }, { "input": "5\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "20\n0 7\n2 1\n2 2\n5 7\n2 6\n6 10\n2 4\n0 4\n7 4\n8 0\n10 6\n2 1\n6 1\n1 7\n0 3\n8 7\n6 3\n6 3\n1 1\n3 0", "output": "22" }, { "input": "5\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0", "output": "1000" }, { "input": "10\n0 592\n258 598\n389 203\n249 836\n196 635\n478 482\n994 987\n1000 0\n769 0\n0 0", "output": "1776" }, { "input": "10\n0 1\n1 0\n0 0\n0 0\n0 0\n0 1\n1 1\n0 1\n1 0\n1 0", "output": "2" }, { "input": "10\n0 926\n926 938\n938 931\n931 964\n937 989\n983 936\n908 949\n997 932\n945 988\n988 0", "output": "1016" }, { "input": "10\n0 1\n1 2\n1 2\n2 2\n2 2\n2 2\n1 1\n1 1\n2 1\n2 0", "output": "3" }, { "input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "10\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0", "output": "1000" }, { "input": "50\n0 332\n332 268\n268 56\n56 711\n420 180\n160 834\n149 341\n373 777\n763 93\n994 407\n86 803\n700 132\n471 608\n429 467\n75 5\n638 305\n405 853\n316 478\n643 163\n18 131\n648 241\n241 766\n316 847\n640 380\n923 759\n789 41\n125 421\n421 9\n9 388\n388 829\n408 108\n462 856\n816 411\n518 688\n290 7\n405 912\n397 772\n396 652\n394 146\n27 648\n462 617\n514 433\n780 35\n710 705\n460 390\n194 508\n643 56\n172 469\n1000 0\n194 0", "output": "2071" }, { "input": "50\n0 0\n0 1\n1 1\n0 1\n0 0\n1 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 1\n1 0\n0 1\n0 0\n1 1\n1 0\n0 1\n0 0\n1 1\n0 1\n1 0\n1 1\n1 0\n0 0\n1 1\n1 0\n0 1\n0 0\n0 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 0\n0 1\n1 0\n0 0\n0 1\n1 1\n1 1\n0 1\n0 0\n1 0\n1 0", "output": "3" }, { "input": "50\n0 926\n926 971\n915 980\n920 965\n954 944\n928 952\n955 980\n916 980\n906 935\n944 913\n905 923\n912 922\n965 934\n912 900\n946 930\n931 983\n979 905\n925 969\n924 926\n910 914\n921 977\n934 979\n962 986\n942 909\n976 903\n982 982\n991 941\n954 929\n902 980\n947 983\n919 924\n917 943\n916 905\n907 913\n964 977\n984 904\n905 999\n950 970\n986 906\n993 970\n960 994\n963 983\n918 986\n980 900\n931 986\n993 997\n941 909\n907 909\n1000 0\n278 0", "output": "1329" }, { "input": "2\n0 863\n863 0", "output": "863" }, { "input": "50\n0 1\n1 2\n2 2\n1 1\n1 1\n1 2\n1 2\n1 1\n1 2\n1 1\n1 1\n1 2\n1 2\n1 1\n2 1\n2 2\n1 2\n2 2\n1 2\n2 1\n2 1\n2 2\n2 1\n1 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n2 2\n2 1\n1 2\n2 2\n1 2\n1 1\n1 1\n2 1\n2 1\n2 2\n2 1\n2 1\n1 2\n1 2\n1 2\n1 2\n2 0\n2 0\n2 0\n0 0", "output": "8" }, { "input": "50\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "100\n0 1\n0 0\n0 0\n1 0\n0 0\n0 1\n0 1\n1 1\n0 0\n0 0\n1 1\n0 0\n1 1\n0 1\n1 1\n0 1\n1 1\n1 0\n1 0\n0 0\n1 0\n0 1\n1 0\n0 0\n0 0\n1 1\n1 1\n0 1\n0 0\n1 0\n1 1\n0 1\n1 0\n1 1\n0 1\n1 1\n1 0\n0 0\n0 0\n0 1\n0 0\n0 1\n1 1\n0 0\n1 1\n1 1\n0 0\n0 1\n1 0\n0 1\n0 0\n0 1\n0 1\n1 1\n1 1\n1 1\n0 0\n0 0\n1 1\n0 1\n0 1\n1 0\n0 0\n0 0\n1 1\n0 1\n0 1\n1 1\n1 1\n0 1\n1 1\n1 1\n0 0\n1 0\n0 1\n0 0\n0 0\n1 1\n1 1\n1 1\n1 1\n0 1\n1 0\n1 0\n1 0\n1 0\n1 0\n0 0\n1 0\n1 0\n0 0\n1 0\n0 0\n0 1\n1 0\n0 1\n1 0\n1 0\n1 0\n1 0", "output": "11" }, { "input": "100\n0 2\n1 2\n2 1\n1 2\n1 2\n2 1\n2 2\n1 1\n1 1\n2 1\n1 2\n2 1\n1 2\n2 2\n2 2\n2 2\n1 2\n2 2\n2 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 2\n1 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n1 1\n2 2\n2 1\n1 2\n1 1\n1 2\n2 1\n2 2\n1 1\n2 1\n1 1\n2 1\n1 1\n1 2\n2 2\n2 2\n1 1\n2 2\n1 2\n2 1\n2 1\n1 1\n1 1\n1 2\n1 2\n1 1\n1 1\n2 1\n1 2\n1 2\n2 1\n2 2\n2 2\n2 2\n2 1\n2 2\n1 1\n1 2\n1 2\n1 1\n2 2\n2 2\n1 1\n2 1\n1 1\n1 2\n1 2\n1 2\n1 1\n1 1\n2 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 1\n2 2\n1 2\n2 0\n2 0\n2 0\n1 0", "output": "7" }, { "input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0", "output": "0" }, { "input": "2\n0 1\n1 0", "output": "1" }, { "input": "2\n0 900\n900 0", "output": "900" }, { "input": "2\n0 1\n1 0", "output": "1" }, { "input": "2\n0 0\n0 0", "output": "0" }, { "input": "2\n0 1000\n1000 0", "output": "1000" }, { "input": "3\n0 802\n175 188\n815 0", "output": "815" }, { "input": "3\n0 910\n910 976\n976 0", "output": "976" }, { "input": "3\n0 2\n2 1\n1 0", "output": "2" } ]
1,685,978,378
2,147,483,647
Python 3
OK
TESTS
71
92
0
c=0 l=0 for i in range(int(input())): q,w=map(int,input().split()) c=c-q+w if l<c: l=c print(l)
Title: Tram Time Limit: None seconds Memory Limit: None megabytes Problem Description: Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty. Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram. Input Specification: The first line contains a single number *n* (2<=≀<=*n*<=≀<=1000) β€” the number of the tram's stops. Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≀<=*a**i*,<=*b**i*<=≀<=1000) β€” the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement. - The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0. Output Specification: Print a single integer denoting the minimum possible capacity of the tram (0 is allowed). Demo Input: ['4\n0 3\n2 5\n4 2\n4 0\n'] Demo Output: ['6\n'] Note: For the first example, a capacity of 6 is sufficient: - At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints. Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
```python c=0 l=0 for i in range(int(input())): q,w=map(int,input().split()) c=c-q+w if l<c: l=c print(l) ```
3
707
A
Brain's Photos
PROGRAMMING
800
[ "implementation" ]
null
null
Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead. As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such). Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour! As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white. Photo can be represented as a matrix sized *n*<=Γ—<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors: - 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black) The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored.
The first line of the input contains two integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=100)Β β€” the number of photo pixel matrix rows and columns respectively. Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'.
Print the "#Black&amp;White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line.
[ "2 2\nC M\nY Y\n", "3 2\nW W\nW W\nB B\n", "1 1\nW\n" ]
[ "#Color", "#Black&amp;White", "#Black&amp;White" ]
none
500
[ { "input": "2 2\nC M\nY Y", "output": "#Color" }, { "input": "3 2\nW W\nW W\nB B", "output": "#Black&White" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "2 3\nW W W\nB G Y", "output": "#Color" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "5 5\nW G B Y M\nG B Y M C\nB Y M C W\nY M C W G\nM C W G B", "output": "#Color" }, { "input": "1 6\nC M Y W G B", "output": "#Color" }, { "input": "1 3\nW G B", "output": "#Black&White" }, { "input": "1 1\nW", "output": "#Black&White" }, { "input": "5 5\nW G B W G\nG B W G B\nB W G B W\nW G B W G\nG B W G B", "output": "#Black&White" }, { "input": "2 3\nW W W\nB G C", "output": "#Color" }, { "input": "2 3\nW W W\nB G M", "output": "#Color" }, { "input": "3 3\nC B W\nB Y M\nB B W", "output": "#Color" }, { "input": "1 3\nW C W", "output": "#Color" }, { "input": "3 3\nB W B\nB C W\nB W W", "output": "#Color" }, { "input": "1 2\nW Y", "output": "#Color" }, { "input": "1 1\nG", "output": "#Black&White" }, { "input": "1 3\nB G W", "output": "#Black&White" }, { "input": "2 2\nW W\nB C", "output": "#Color" }, { "input": "1 1\nM", "output": "#Color" }, { "input": "1 2\nW C", "output": "#Color" }, { "input": "2 3\nW W M\nW W M", "output": "#Color" }, { "input": "3 2\nW W\nW W\nB C", "output": "#Color" }, { "input": "2 3\nW W C\nW W W", "output": "#Color" }, { "input": "1 3\nG G G", "output": "#Black&White" }, { "input": "1 1\nC", "output": "#Color" }, { "input": "1 2\nC W", "output": "#Color" }, { "input": "1 3\nW W C", "output": "#Color" }, { "input": "2 2\nW B\nB G", "output": "#Black&White" }, { "input": "2 2\nB B\nY Y", "output": "#Color" }, { "input": "2 2\nG G\nC C", "output": "#Color" }, { "input": "1 2\nB C", "output": "#Color" }, { "input": "1 4\nG G G C", "output": "#Color" }, { "input": "1 1\nB", "output": "#Black&White" }, { "input": "2 1\nY\nB", "output": "#Color" } ]
1,653,583,131
2,147,483,647
Python 3
OK
TESTS
50
46
0
n,m=map(int,input().split()) list1=[] for i in range(n): l=list(map(str,input().split())) list1.append(l) c=0 for i in list1: for j in i: if j=='C' or j=='M' or j=='Y': c=1 break if c==1: break if c==1: print("#Color") else: print("#Black&White")
Title: Brain's Photos Time Limit: None seconds Memory Limit: None megabytes Problem Description: Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead. As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such). Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour! As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white. Photo can be represented as a matrix sized *n*<=Γ—<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors: - 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black) The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored. Input Specification: The first line of the input contains two integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=100)Β β€” the number of photo pixel matrix rows and columns respectively. Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'. Output Specification: Print the "#Black&amp;White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line. Demo Input: ['2 2\nC M\nY Y\n', '3 2\nW W\nW W\nB B\n', '1 1\nW\n'] Demo Output: ['#Color', '#Black&amp;White', '#Black&amp;White'] Note: none
```python n,m=map(int,input().split()) list1=[] for i in range(n): l=list(map(str,input().split())) list1.append(l) c=0 for i in list1: for j in i: if j=='C' or j=='M' or j=='Y': c=1 break if c==1: break if c==1: print("#Color") else: print("#Black&White") ```
3
270
A
Fancy Fence
PROGRAMMING
1,100
[ "geometry", "implementation", "math" ]
null
null
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot. He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*. Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
The first line of input contains an integer *t* (0<=&lt;<=*t*<=&lt;<=180) β€” the number of tests. Each of the following *t* lines contains a single integer *a* (0<=&lt;<=*a*<=&lt;<=180) β€” the angle the robot can make corners at measured in degrees.
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
[ "3\n30\n60\n90\n" ]
[ "NO\nYES\nYES\n" ]
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the second test case, the fence is a regular triangle, and in the last test case β€” a square.
500
[ { "input": "3\n30\n60\n90", "output": "NO\nYES\nYES" }, { "input": "6\n1\n2\n3\n170\n179\n25", "output": "NO\nNO\nNO\nYES\nYES\nNO" } ]
1,665,621,234
2,147,483,647
Python 3
OK
TESTS
3
60
0
t = int(input()) for i in range(t): def angle(a): if 360%(180-a)==0: return'YES' else: return'NO' a = int(input()) print(angle(a))
Title: Fancy Fence Time Limit: None seconds Memory Limit: None megabytes Problem Description: Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot. He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*. Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*? Input Specification: The first line of input contains an integer *t* (0<=&lt;<=*t*<=&lt;<=180) β€” the number of tests. Each of the following *t* lines contains a single integer *a* (0<=&lt;<=*a*<=&lt;<=180) β€” the angle the robot can make corners at measured in degrees. Output Specification: For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible. Demo Input: ['3\n30\n60\n90\n'] Demo Output: ['NO\nYES\nYES\n'] Note: In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In the second test case, the fence is a regular triangle, and in the last test case β€” a square.
```python t = int(input()) for i in range(t): def angle(a): if 360%(180-a)==0: return'YES' else: return'NO' a = int(input()) print(angle(a)) ```
3
401
A
Vanya and Cards
PROGRAMMING
800
[ "implementation", "math" ]
null
null
Vanya loves playing. He even has a special set of cards to play with. Each card has a single integer. The number on the card can be positive, negative and can even be equal to zero. The only limit is, the number on each card doesn't exceed *x* in the absolute value. Natasha doesn't like when Vanya spends a long time playing, so she hid all of his cards. Vanya became sad and started looking for the cards but he only found *n* of them. Vanya loves the balance, so he wants the sum of all numbers on found cards equal to zero. On the other hand, he got very tired of looking for cards. Help the boy and say what is the minimum number of cards does he need to find to make the sum equal to zero? You can assume that initially Vanya had infinitely many cards with each integer number from <=-<=*x* to *x*.
The first line contains two integers: *n* (1<=≀<=*n*<=≀<=1000) β€” the number of found cards and *x* (1<=≀<=*x*<=≀<=1000) β€” the maximum absolute value of the number on a card. The second line contains *n* space-separated integers β€” the numbers on found cards. It is guaranteed that the numbers do not exceed *x* in their absolute value.
Print a single number β€” the answer to the problem.
[ "3 2\n-1 1 2\n", "2 3\n-2 -2\n" ]
[ "1\n", "2\n" ]
In the first sample, Vanya needs to find a single card with number -2. In the second sample, Vanya needs to find two cards with number 2. He can't find a single card with the required number as the numbers on the lost cards do not exceed 3 in their absolute value.
500
[ { "input": "3 2\n-1 1 2", "output": "1" }, { "input": "2 3\n-2 -2", "output": "2" }, { "input": "4 4\n1 2 3 4", "output": "3" }, { "input": "2 2\n-1 -1", "output": "1" }, { "input": "15 5\n-2 -1 2 -4 -3 4 -4 -2 -2 2 -2 -1 1 -4 -2", "output": "4" }, { "input": "15 16\n-15 -5 -15 -14 -8 15 -15 -12 -5 -3 5 -7 3 8 -15", "output": "6" }, { "input": "1 4\n-3", "output": "1" }, { "input": "10 7\n6 4 6 6 -3 4 -1 2 3 3", "output": "5" }, { "input": "2 1\n1 -1", "output": "0" }, { "input": "1 1\n0", "output": "0" }, { "input": "8 13\n-11 -1 -11 12 -2 -2 -10 -11", "output": "3" }, { "input": "16 11\n3 -7 7 -9 -2 -3 -4 -2 -6 8 10 7 1 4 6 7", "output": "2" }, { "input": "67 15\n-2 -2 6 -4 -7 4 3 13 -9 -4 11 -7 -6 -11 1 11 -1 11 14 10 -8 7 5 11 -13 1 -1 7 -14 9 -11 -11 13 -4 12 -11 -8 -5 -11 6 10 -2 6 9 9 6 -11 -2 7 -10 -1 9 -8 -5 1 -7 -2 3 -1 -13 -6 -9 -8 10 13 -3 9", "output": "1" }, { "input": "123 222\n44 -190 -188 -185 -55 17 190 176 157 176 -24 -113 -54 -61 -53 53 -77 68 -12 -114 -217 163 -122 37 -37 20 -108 17 -140 -210 218 19 -89 54 18 197 111 -150 -36 -131 -172 36 67 16 -202 72 169 -137 -34 -122 137 -72 196 -17 -104 180 -102 96 -69 -184 21 -15 217 -61 175 -221 62 173 -93 -106 122 -135 58 7 -110 -108 156 -141 -102 -50 29 -204 -46 -76 101 -33 -190 99 52 -197 175 -71 161 -140 155 10 189 -217 -97 -170 183 -88 83 -149 157 -208 154 -3 77 90 74 165 198 -181 -166 -4 -200 -89 -200 131 100 -61 -149", "output": "8" }, { "input": "130 142\n58 -50 43 -126 84 -92 -108 -92 57 127 12 -135 -49 89 141 -112 -31 47 75 -19 80 81 -5 17 10 4 -26 68 -102 -10 7 -62 -135 -123 -16 55 -72 -97 -34 21 21 137 130 97 40 -18 110 -52 73 52 85 103 -134 -107 88 30 66 97 126 82 13 125 127 -87 81 22 45 102 13 95 4 10 -35 39 -43 -112 -5 14 -46 19 61 -44 -116 137 -116 -80 -39 92 -75 29 -65 -15 5 -108 -114 -129 -5 52 -21 118 -41 35 -62 -125 130 -95 -11 -75 19 108 108 127 141 2 -130 54 96 -81 -102 140 -58 -102 132 50 -126 82 6 45 -114 -42", "output": "5" }, { "input": "7 12\n2 5 -1 -4 -7 4 3", "output": "1" }, { "input": "57 53\n-49 7 -41 7 38 -51 -23 8 45 1 -24 26 37 28 -31 -40 38 25 -32 -47 -3 20 -40 -32 -44 -36 5 33 -16 -5 28 10 -22 3 -10 -51 -32 -51 27 -50 -22 -12 41 3 15 24 30 -12 -34 -15 -29 38 -10 -35 -9 6 -51", "output": "8" }, { "input": "93 273\n-268 -170 -163 19 -69 18 -244 35 -34 125 -224 -48 179 -247 127 -150 271 -49 -102 201 84 -151 -70 -46 -16 216 240 127 3 218 -209 223 -227 -201 228 -8 203 46 -100 -207 126 255 40 -58 -217 93 172 -97 23 183 102 -92 -157 -117 173 47 144 -235 -227 -62 -128 13 -151 158 110 -116 68 -2 -148 -206 -52 79 -152 -223 74 -149 -69 232 38 -70 -256 -213 -236 132 -189 -200 199 -57 -108 -53 269 -101 -134", "output": "8" }, { "input": "1 1000\n997", "output": "1" }, { "input": "4 3\n2 -1 -2 -1", "output": "1" }, { "input": "1 1\n-1", "output": "1" }, { "input": "1 1\n1", "output": "1" }, { "input": "2 2\n1 -1", "output": "0" }, { "input": "2 2\n-1 1", "output": "0" }, { "input": "2 3\n-1 1", "output": "0" }, { "input": "2 2\n-2 2", "output": "0" }, { "input": "2 2\n2 2", "output": "2" }, { "input": "4 2\n-1 -1 -1 -1", "output": "2" }, { "input": "4 1\n-1 -1 -1 1", "output": "2" }, { "input": "3 2\n2 2 2", "output": "3" }, { "input": "10 300\n300 300 300 300 300 300 300 300 300 300", "output": "10" } ]
1,697,226,027
2,147,483,647
PyPy 3-64
OK
TESTS
47
77
0
n, x = [int(i) for i in input().split()] k = [int(i) for i in input().split()] s = sum(k) c = 0 if s == 0: print(0) exit() if s > 0: while s > 0: s -= x c += 1 else: while s < 0: s += x c += 1 print(c)
Title: Vanya and Cards Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vanya loves playing. He even has a special set of cards to play with. Each card has a single integer. The number on the card can be positive, negative and can even be equal to zero. The only limit is, the number on each card doesn't exceed *x* in the absolute value. Natasha doesn't like when Vanya spends a long time playing, so she hid all of his cards. Vanya became sad and started looking for the cards but he only found *n* of them. Vanya loves the balance, so he wants the sum of all numbers on found cards equal to zero. On the other hand, he got very tired of looking for cards. Help the boy and say what is the minimum number of cards does he need to find to make the sum equal to zero? You can assume that initially Vanya had infinitely many cards with each integer number from <=-<=*x* to *x*. Input Specification: The first line contains two integers: *n* (1<=≀<=*n*<=≀<=1000) β€” the number of found cards and *x* (1<=≀<=*x*<=≀<=1000) β€” the maximum absolute value of the number on a card. The second line contains *n* space-separated integers β€” the numbers on found cards. It is guaranteed that the numbers do not exceed *x* in their absolute value. Output Specification: Print a single number β€” the answer to the problem. Demo Input: ['3 2\n-1 1 2\n', '2 3\n-2 -2\n'] Demo Output: ['1\n', '2\n'] Note: In the first sample, Vanya needs to find a single card with number -2. In the second sample, Vanya needs to find two cards with number 2. He can't find a single card with the required number as the numbers on the lost cards do not exceed 3 in their absolute value.
```python n, x = [int(i) for i in input().split()] k = [int(i) for i in input().split()] s = sum(k) c = 0 if s == 0: print(0) exit() if s > 0: while s > 0: s -= x c += 1 else: while s < 0: s += x c += 1 print(c) ```
3
337
A
Puzzles
PROGRAMMING
900
[ "greedy" ]
null
null
The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces). The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on. Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*.
The first line contains space-separated integers *n* and *m* (2<=≀<=*n*<=≀<=*m*<=≀<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≀<=*f**i*<=≀<=1000) β€” the quantities of pieces in the puzzles sold in the shop.
Print a single integer β€” the least possible difference the teacher can obtain.
[ "4 6\n10 12 10 7 5 22\n" ]
[ "5\n" ]
Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
500
[ { "input": "4 6\n10 12 10 7 5 22", "output": "5" }, { "input": "2 2\n4 4", "output": "0" }, { "input": "2 10\n4 5 6 7 8 9 10 11 12 12", "output": "0" }, { "input": "4 5\n818 136 713 59 946", "output": "759" }, { "input": "3 20\n446 852 783 313 549 965 40 88 86 617 479 118 768 34 47 826 366 957 463 903", "output": "13" }, { "input": "2 25\n782 633 152 416 432 825 115 97 386 357 836 310 530 413 354 373 847 882 913 682 729 582 671 674 94", "output": "3" }, { "input": "4 25\n226 790 628 528 114 64 239 279 619 39 894 763 763 847 525 93 882 697 999 643 650 244 159 884 190", "output": "31" }, { "input": "2 50\n971 889 628 39 253 157 925 694 129 516 660 272 738 319 611 816 142 717 514 392 41 105 132 676 958 118 306 768 600 685 103 857 704 346 857 309 23 718 618 161 176 379 846 834 640 468 952 878 164 997", "output": "0" }, { "input": "25 50\n582 146 750 905 313 509 402 21 488 512 32 898 282 64 579 869 37 996 377 929 975 697 666 837 311 205 116 992 533 298 648 268 54 479 792 595 152 69 267 417 184 433 894 603 988 712 24 414 301 176", "output": "412" }, { "input": "49 50\n58 820 826 960 271 294 473 102 925 318 729 672 244 914 796 646 868 6 893 882 726 203 528 498 271 195 355 459 721 680 547 147 631 116 169 804 145 996 133 559 110 257 771 476 576 251 607 314 427 886", "output": "938" }, { "input": "50 50\n374 573 323 744 190 806 485 247 628 336 491 606 702 321 991 678 337 579 86 240 993 208 668 686 855 205 363 177 719 249 896 919 782 434 59 647 787 996 286 216 636 212 546 903 958 559 544 126 608 993", "output": "937" }, { "input": "6 50\n6 8 7 8 5 4 4 5 7 8 6 5 7 4 7 7 7 8 6 4 6 6 8 8 7 7 8 7 5 8 5 4 4 7 8 4 4 6 6 6 8 7 4 7 6 6 5 8 4 7", "output": "0" }, { "input": "37 50\n14 5 11 17 8 20 19 16 20 11 17 20 16 9 14 14 13 18 11 20 8 8 8 5 19 17 6 18 10 20 9 7 12 6 14 17 4 4 10 13 7 4 11 6 20 19 12 12 15 19", "output": "12" }, { "input": "40 50\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "0" }, { "input": "40 50\n17 20 43 26 41 37 14 8 30 35 30 24 43 8 42 9 41 50 41 35 27 32 35 43 28 36 31 16 5 7 23 16 14 29 8 39 12 16 36 18 49 39 33 37 38 6 6 27 23 17", "output": "31" }, { "input": "2 2\n1000 4", "output": "996" }, { "input": "2 3\n4 502 1000", "output": "498" }, { "input": "3 3\n4 1000 4", "output": "996" } ]
1,693,884,039
2,147,483,647
Python 3
OK
TESTS
18
92
0
n, m = map(int, input().split(" ")) p = list(map(int, input().split(" "))) p.sort() d = p[len(p)-1] for i in range((m-n)+1): d = min(d, p[(i + n)-1] - p[i]) print(d)
Title: Puzzles Time Limit: None seconds Memory Limit: None megabytes Problem Description: The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces). The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on. Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*. Input Specification: The first line contains space-separated integers *n* and *m* (2<=≀<=*n*<=≀<=*m*<=≀<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≀<=*f**i*<=≀<=1000) β€” the quantities of pieces in the puzzles sold in the shop. Output Specification: Print a single integer β€” the least possible difference the teacher can obtain. Demo Input: ['4 6\n10 12 10 7 5 22\n'] Demo Output: ['5\n'] Note: Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5.
```python n, m = map(int, input().split(" ")) p = list(map(int, input().split(" "))) p.sort() d = p[len(p)-1] for i in range((m-n)+1): d = min(d, p[(i + n)-1] - p[i]) print(d) ```
3
729
B
Spotlights
PROGRAMMING
1,200
[ "dp", "implementation" ]
null
null
Theater stage is a rectangular field of size *n*<=Γ—<=*m*. The director gave you the stage's plan which actors will follow. For each cell it is stated in the plan if there would be an actor in this cell or not. You are to place a spotlight on the stage in some good position. The spotlight will project light in one of the four directions (if you look at the stage from above)Β β€” left, right, up or down. Thus, the spotlight's position is a cell it is placed to and a direction it shines. A position is good if two conditions hold: - there is no actor in the cell the spotlight is placed to; - there is at least one actor in the direction the spotlight projects. Count the number of good positions for placing the spotlight. Two positions of spotlight are considered to be different if the location cells or projection direction differ.
The first line contains two positive integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=1000)Β β€” the number of rows and the number of columns in the plan. The next *n* lines contain *m* integers, 0 or 1 eachΒ β€” the description of the plan. Integer 1, means there will be an actor in the corresponding cell, while 0 means the cell will remain empty. It is guaranteed that there is at least one actor in the plan.
Print one integerΒ β€” the number of good positions for placing the spotlight.
[ "2 4\n0 1 0 0\n1 0 1 0\n", "4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0\n" ]
[ "9\n", "20\n" ]
In the first example the following positions are good: 1. the (1, 1) cell and right direction; 1. the (1, 1) cell and down direction; 1. the (1, 3) cell and left direction; 1. the (1, 3) cell and down direction; 1. the (1, 4) cell and left direction; 1. the (2, 2) cell and left direction; 1. the (2, 2) cell and up direction; 1. the (2, 2) and right direction; 1. the (2, 4) cell and left direction. Therefore, there are 9 good positions in this example.
1,000
[ { "input": "2 4\n0 1 0 0\n1 0 1 0", "output": "9" }, { "input": "4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0", "output": "20" }, { "input": "1 5\n1 1 0 0 0", "output": "3" }, { "input": "2 10\n0 0 0 0 0 0 0 1 0 0\n1 0 0 0 0 0 0 0 0 0", "output": "20" }, { "input": "3 1\n1\n0\n0", "output": "2" }, { "input": "5 7\n0 0 0 0 0 0 1\n0 0 0 0 0 0 1\n0 0 0 1 0 0 0\n0 0 0 0 0 0 0\n0 0 0 0 0 0 0", "output": "25" }, { "input": "10 20\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "4" }, { "input": "5 7\n0 0 0 0 0 0 0\n0 1 1 1 1 0 1\n0 1 1 1 1 1 1\n0 0 0 0 0 0 0\n0 1 1 1 1 0 1", "output": "26" }, { "input": "10 20\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "121" }, { "input": "1 2\n0 1", "output": "1" }, { "input": "1 2\n1 0", "output": "1" }, { "input": "1 2\n1 1", "output": "0" }, { "input": "2 1\n1\n0", "output": "1" }, { "input": "2 1\n0\n1", "output": "1" }, { "input": "2 1\n1\n1", "output": "0" }, { "input": "1 1\n1", "output": "0" }, { "input": "4 4\n1 1 1 1\n1 0 0 1\n1 0 0 1\n1 1 1 1", "output": "16" } ]
1,673,618,108
2,147,483,647
PyPy 3-64
OK
TESTS
72
374
74,342,400
s = list(map(int, input().split())) n,m = s[0],s[1] spisok = [] for i in range(n): p = list(map(int, input().split())) spisok.append(p) s1 = [] s2 = [] s3 = [] s4 = [] k1 = 0 k2 = 0 k3 = 0 k4 = 0 for i in range(n): for j in range(m): if spisok[i][j] == 0: k1 += 1 if spisok[i][j] == 1: s1.append(k1) k1 = 0 k1 = 0 for i in range(n): for j in range(m-1, -1, -1): if spisok[i][j] == 0: k2 += 1 if spisok[i][j] == 1: s2.append(k2) k2 = 0 k2 = 0 for i in range(m): for j in range(n): if spisok[j][i] == 0: k3 += 1 if spisok[j][i] == 1: s3.append(k3) k3 = 0 k3 = 0 for i in range(m): for j in range(n - 1, -1, -1): if spisok[j][i] == 0: k4 += 1 if spisok[j][i] == 1: s4.append(k4) k4 = 0 k4 = 0 print(sum(s1) + sum(s2) + sum(s3) + sum(s4))
Title: Spotlights Time Limit: None seconds Memory Limit: None megabytes Problem Description: Theater stage is a rectangular field of size *n*<=Γ—<=*m*. The director gave you the stage's plan which actors will follow. For each cell it is stated in the plan if there would be an actor in this cell or not. You are to place a spotlight on the stage in some good position. The spotlight will project light in one of the four directions (if you look at the stage from above)Β β€” left, right, up or down. Thus, the spotlight's position is a cell it is placed to and a direction it shines. A position is good if two conditions hold: - there is no actor in the cell the spotlight is placed to; - there is at least one actor in the direction the spotlight projects. Count the number of good positions for placing the spotlight. Two positions of spotlight are considered to be different if the location cells or projection direction differ. Input Specification: The first line contains two positive integers *n* and *m* (1<=≀<=*n*,<=*m*<=≀<=1000)Β β€” the number of rows and the number of columns in the plan. The next *n* lines contain *m* integers, 0 or 1 eachΒ β€” the description of the plan. Integer 1, means there will be an actor in the corresponding cell, while 0 means the cell will remain empty. It is guaranteed that there is at least one actor in the plan. Output Specification: Print one integerΒ β€” the number of good positions for placing the spotlight. Demo Input: ['2 4\n0 1 0 0\n1 0 1 0\n', '4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0\n'] Demo Output: ['9\n', '20\n'] Note: In the first example the following positions are good: 1. the (1, 1) cell and right direction; 1. the (1, 1) cell and down direction; 1. the (1, 3) cell and left direction; 1. the (1, 3) cell and down direction; 1. the (1, 4) cell and left direction; 1. the (2, 2) cell and left direction; 1. the (2, 2) cell and up direction; 1. the (2, 2) and right direction; 1. the (2, 4) cell and left direction. Therefore, there are 9 good positions in this example.
```python s = list(map(int, input().split())) n,m = s[0],s[1] spisok = [] for i in range(n): p = list(map(int, input().split())) spisok.append(p) s1 = [] s2 = [] s3 = [] s4 = [] k1 = 0 k2 = 0 k3 = 0 k4 = 0 for i in range(n): for j in range(m): if spisok[i][j] == 0: k1 += 1 if spisok[i][j] == 1: s1.append(k1) k1 = 0 k1 = 0 for i in range(n): for j in range(m-1, -1, -1): if spisok[i][j] == 0: k2 += 1 if spisok[i][j] == 1: s2.append(k2) k2 = 0 k2 = 0 for i in range(m): for j in range(n): if spisok[j][i] == 0: k3 += 1 if spisok[j][i] == 1: s3.append(k3) k3 = 0 k3 = 0 for i in range(m): for j in range(n - 1, -1, -1): if spisok[j][i] == 0: k4 += 1 if spisok[j][i] == 1: s4.append(k4) k4 = 0 k4 = 0 print(sum(s1) + sum(s2) + sum(s3) + sum(s4)) ```
3
931
A
Friends Meeting
PROGRAMMING
800
[ "brute force", "greedy", "implementation", "math" ]
null
null
Two friends are on the coordinate axis *Ox* in points with integer coordinates. One of them is in the point *x*1<==<=*a*, another one is in the point *x*2<==<=*b*. Each of the friends can move by one along the line in any direction unlimited number of times. When a friend moves, the tiredness of a friend changes according to the following rules: the first move increases the tiredness by 1, the second move increases the tiredness by 2, the thirdΒ β€” by 3 and so on. For example, if a friend moves first to the left, then to the right (returning to the same point), and then again to the left his tiredness becomes equal to 1<=+<=2<=+<=3<==<=6. The friends want to meet in a integer point. Determine the minimum total tiredness they should gain, if they meet in the same point.
The first line contains a single integer *a* (1<=≀<=*a*<=≀<=1000) β€” the initial position of the first friend. The second line contains a single integer *b* (1<=≀<=*b*<=≀<=1000) β€” the initial position of the second friend. It is guaranteed that *a*<=β‰ <=*b*.
Print the minimum possible total tiredness if the friends meet in the same point.
[ "3\n4\n", "101\n99\n", "5\n10\n" ]
[ "1\n", "2\n", "9\n" ]
In the first example the first friend should move by one to the right (then the meeting happens at point 4), or the second friend should move by one to the left (then the meeting happens at point 3). In both cases, the total tiredness becomes 1. In the second example the first friend should move by one to the left, and the second friend should move by one to the right. Then they meet in the point 100, and the total tiredness becomes 1 + 1 = 2. In the third example one of the optimal ways is the following. The first friend should move three times to the right, and the second friend β€” two times to the left. Thus the friends meet in the point 8, and the total tiredness becomes 1 + 2 + 3 + 1 + 2 = 9.
500
[ { "input": "3\n4", "output": "1" }, { "input": "101\n99", "output": "2" }, { "input": "5\n10", "output": "9" }, { "input": "1\n2", "output": "1" }, { "input": "1\n1000", "output": "250000" }, { "input": "999\n1000", "output": "1" }, { "input": "1000\n999", "output": "1" }, { "input": "1000\n1", "output": "250000" }, { "input": "2\n1", "output": "1" }, { "input": "2\n999", "output": "249001" }, { "input": "2\n998", "output": "248502" }, { "input": "999\n2", "output": "249001" }, { "input": "998\n2", "output": "248502" }, { "input": "2\n1000", "output": "249500" }, { "input": "1000\n2", "output": "249500" }, { "input": "1\n999", "output": "249500" }, { "input": "999\n1", "output": "249500" }, { "input": "188\n762", "output": "82656" }, { "input": "596\n777", "output": "8281" }, { "input": "773\n70", "output": "123904" }, { "input": "825\n729", "output": "2352" }, { "input": "944\n348", "output": "89102" }, { "input": "352\n445", "output": "2209" }, { "input": "529\n656", "output": "4096" }, { "input": "19\n315", "output": "22052" }, { "input": "138\n370", "output": "13572" }, { "input": "546\n593", "output": "576" }, { "input": "285\n242", "output": "484" }, { "input": "773\n901", "output": "4160" }, { "input": "892\n520", "output": "34782" }, { "input": "864\n179", "output": "117649" }, { "input": "479\n470", "output": "25" }, { "input": "967\n487", "output": "57840" }, { "input": "648\n106", "output": "73712" }, { "input": "58\n765", "output": "125316" }, { "input": "235\n56", "output": "8100" }, { "input": "285\n153", "output": "4422" }, { "input": "943\n13", "output": "216690" }, { "input": "675\n541", "output": "4556" }, { "input": "4\n912", "output": "206570" } ]
1,535,635,969
2,147,483,647
PyPy 3
OK
TESTS
40
140
0
a = int(input()) b = int(input()) acount = 0 bcount = 0 aturn = True total = 0 if (a < b): t = a a = b b = t while (a!=b): if (aturn): a -= 1 acount += 1 total += acount else: b += 1 bcount += 1 total += bcount aturn = not aturn print(total)
Title: Friends Meeting Time Limit: None seconds Memory Limit: None megabytes Problem Description: Two friends are on the coordinate axis *Ox* in points with integer coordinates. One of them is in the point *x*1<==<=*a*, another one is in the point *x*2<==<=*b*. Each of the friends can move by one along the line in any direction unlimited number of times. When a friend moves, the tiredness of a friend changes according to the following rules: the first move increases the tiredness by 1, the second move increases the tiredness by 2, the thirdΒ β€” by 3 and so on. For example, if a friend moves first to the left, then to the right (returning to the same point), and then again to the left his tiredness becomes equal to 1<=+<=2<=+<=3<==<=6. The friends want to meet in a integer point. Determine the minimum total tiredness they should gain, if they meet in the same point. Input Specification: The first line contains a single integer *a* (1<=≀<=*a*<=≀<=1000) β€” the initial position of the first friend. The second line contains a single integer *b* (1<=≀<=*b*<=≀<=1000) β€” the initial position of the second friend. It is guaranteed that *a*<=β‰ <=*b*. Output Specification: Print the minimum possible total tiredness if the friends meet in the same point. Demo Input: ['3\n4\n', '101\n99\n', '5\n10\n'] Demo Output: ['1\n', '2\n', '9\n'] Note: In the first example the first friend should move by one to the right (then the meeting happens at point 4), or the second friend should move by one to the left (then the meeting happens at point 3). In both cases, the total tiredness becomes 1. In the second example the first friend should move by one to the left, and the second friend should move by one to the right. Then they meet in the point 100, and the total tiredness becomes 1 + 1 = 2. In the third example one of the optimal ways is the following. The first friend should move three times to the right, and the second friend β€” two times to the left. Thus the friends meet in the point 8, and the total tiredness becomes 1 + 2 + 3 + 1 + 2 = 9.
```python a = int(input()) b = int(input()) acount = 0 bcount = 0 aturn = True total = 0 if (a < b): t = a a = b b = t while (a!=b): if (aturn): a -= 1 acount += 1 total += acount else: b += 1 bcount += 1 total += bcount aturn = not aturn print(total) ```
3
518
A
Vitaly and Strings
PROGRAMMING
1,600
[ "constructive algorithms", "strings" ]
null
null
Vitaly is a diligent student who never missed a lesson in his five years of studying in the university. He always does his homework on time and passes his exams in time. During the last lesson the teacher has provided two strings *s* and *t* to Vitaly. The strings have the same length, they consist of lowercase English letters, string *s* is lexicographically smaller than string *t*. Vitaly wondered if there is such string that is lexicographically larger than string *s* and at the same is lexicographically smaller than string *t*. This string should also consist of lowercase English letters and have the length equal to the lengths of strings *s* and *t*. Let's help Vitaly solve this easy problem!
The first line contains string *s* (1<=≀<=|*s*|<=≀<=100), consisting of lowercase English letters. Here, |*s*| denotes the length of the string. The second line contains string *t* (|*t*|<==<=|*s*|), consisting of lowercase English letters. It is guaranteed that the lengths of strings *s* and *t* are the same and string *s* is lexicographically less than string *t*.
If the string that meets the given requirements doesn't exist, print a single string "No such string" (without the quotes). If such string exists, print it. If there are multiple valid strings, you may print any of them.
[ "a\nc\n", "aaa\nzzz\n", "abcdefg\nabcdefh\n" ]
[ "b\n", "kkk\n", "No such string\n" ]
String *s* = *s*<sub class="lower-index">1</sub>*s*<sub class="lower-index">2</sub>... *s*<sub class="lower-index">*n*</sub> is said to be lexicographically smaller than *t* = *t*<sub class="lower-index">1</sub>*t*<sub class="lower-index">2</sub>... *t*<sub class="lower-index">*n*</sub>, if there exists such *i*, that *s*<sub class="lower-index">1</sub> = *t*<sub class="lower-index">1</sub>, *s*<sub class="lower-index">2</sub> = *t*<sub class="lower-index">2</sub>, ... *s*<sub class="lower-index">*i* - 1</sub> = *t*<sub class="lower-index">*i* - 1</sub>, *s*<sub class="lower-index">*i*</sub> &lt; *t*<sub class="lower-index">*i*</sub>.
500
[ { "input": "a\nc", "output": "b" }, { "input": "aaa\nzzz", "output": "kkk" }, { "input": "abcdefg\nabcdefh", "output": "No such string" }, { "input": "abcdefg\nabcfefg", "output": "abcdefh" }, { "input": "frt\nfru", "output": "No such string" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz", "output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaab" }, { "input": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzx\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz", "output": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzy" }, { "input": "q\nz", "output": "r" }, { "input": "pnzcl\npnzdf", "output": "pnzcm" }, { "input": "vklldrxnfgyorgfpfezvhbouyzzzzz\nvklldrxnfgyorgfpfezvhbouzaaadv", "output": "vklldrxnfgyorgfpfezvhbouzaaaaa" }, { "input": "pkjlxzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\npkjlyaaaaaaaaaaaaaaaaaaaaaaaaaaaahr", "output": "pkjlyaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa" }, { "input": "exoudpymnspkocwszzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\nexoudpymnspkocwtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabml", "output": "exoudpymnspkocwtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa" }, { "input": "anarzvsklmwvovozwnmhklkpcseeogdgauoppmzrukynbjjoxytuvsiecuzfquxnowewebhtuoxepocyeamqfrblpwqiokbcubil\nanarzvsklmwvovozwnmhklkpcseeogdgauoppmzrukynbjjoxytuvsiecuzfquxnowewebhtuoxepocyeamqfrblpwqiokbcubim", "output": "No such string" }, { "input": "uqyugulumzwlxsjnxxkutzqayskrbjoaaekbhckjryhjjllzzz\nuqyugulumzwlxsjnxxkutzqayskrbjoaaekbhckjryhjjlmaaa", "output": "No such string" }, { "input": "esfaeyxpblcrriizhnhfrxnbopqvhwtetgjqavlqdlxexaifgvkqfwzneibhxxdacbzzzzzzzzzzzzzz\nesfaeyxpblcrriizhnhfrxnbopqvhwtetgjqavlqdlxexaifgvkqfwzneibhxxdaccaaaaaaaaaaaatf", "output": "esfaeyxpblcrriizhnhfrxnbopqvhwtetgjqavlqdlxexaifgvkqfwzneibhxxdaccaaaaaaaaaaaaaa" }, { "input": "oisjtilteipnzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\noisjtilteipoaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaao", "output": "oisjtilteipoaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa" }, { "input": "svpoxbsudndfnnpugbouawegyxgtmvqzbewxpcwhopdbwscimgzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\nsvpoxbsudndfnnpugbouawegyxgtmvqzbewxpcwhopdbwscimhaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "No such string" }, { "input": "ddzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\ndeaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaao", "output": "deaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa" }, { "input": "xqzbhslocdbifnyzyjenlpctocieaccsycmwlcebkqqkeibatfvylbqlutvjijgjhdetqsjqnoipqbmjhhzxggdobyvpczdavdzz\nxqzbhslocdbifnyzyjenlpctocieaccsycmwlcebkqqkeibatfvylbqlutvjijgjhdetqsjqnoipqbmjhhzxggdobyvpczdavilj", "output": "xqzbhslocdbifnyzyjenlpctocieaccsycmwlcebkqqkeibatfvylbqlutvjijgjhdetqsjqnoipqbmjhhzxggdobyvpczdaveaa" }, { "input": "poflpxucohdobeisxfsnkbdzwizjjhgngufssqhmfgmydmmrnuminrvxxamoebhczlwsfefdtnchaisfxkfcovxmvppxnrfawfoq\npoflpxucohdobeisxfsnkbdzwizjjhgngufssqhmfgmydmmrnuminrvxxamoebhczlwsfefdtnchaisfxkfcovxmvppxnrfawujg", "output": "poflpxucohdobeisxfsnkbdzwizjjhgngufssqhmfgmydmmrnuminrvxxamoebhczlwsfefdtnchaisfxkfcovxmvppxnrfawfor" }, { "input": "vonggnmokmvmguwtobkxoqgxkuxtyjmxrygyliohlhwxuxjmlkqcfuxboxjnzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\nvonggnmokmvmguwtobkxoqgxkuxtyjmxrygyliohlhwxuxjmlkqcfuxboxjoaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaac", "output": "vonggnmokmvmguwtobkxoqgxkuxtyjmxrygyliohlhwxuxjmlkqcfuxboxjoaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa" }, { "input": "bqycw\nquhod", "output": "bqycx" }, { "input": "hceslswecf\nnmxshuymaa", "output": "hceslswecg" }, { "input": "awqtzslxowuaefe\nvujscakjpvxviki", "output": "awqtzslxowuaeff" }, { "input": "lerlcnaogdravnogfogcyoxgi\nojrbithvjdqtempegvqxmgmmw", "output": "lerlcnaogdravnogfogcyoxgj" }, { "input": "jbrhvicytqaivheqeourrlosvnsujsxdinryyawgalidsaufxv\noevvkhujmhagaholrmsatdjjyfmyblvgetpnxgjcilugjsncjs", "output": "jbrhvicytqaivheqeourrlosvnsujsxdinryyawgalidsaufxw" }, { "input": "jrpogrcuhqdpmyzpuabuhaptlxaeiqjxhqkmuzsjbhqxvdtoocrkusaeasqdwlunomwzww\nspvgaswympzlscnumemgiznngnxqgccbubmxgqmaakbnyngkxlxjjsafricchhpecdjgxw", "output": "jrpogrcuhqdpmyzpuabuhaptlxaeiqjxhqkmuzsjbhqxvdtoocrkusaeasqdwlunomwzwx" }, { "input": "mzmhjmfxaxaplzjmjkbyadeweltagyyuzpvrmnyvirjpdmebxyzjvdoezhnayfrvtnccryhkvhcvakcf\nohhhhkujfpjbgouebtmmbzizuhuumvrsqfniwpmxdtzhyiaivdyxhywnqzagicydixjtvbqbevhbqttu", "output": "mzmhjmfxaxaplzjmjkbyadeweltagyyuzpvrmnyvirjpdmebxyzjvdoezhnayfrvtnccryhkvhcvakcg" }, { "input": "cdmwmzutsicpzhcokbbhwktqbomozxvvjlhwdgtiledgurxsfreisgczdwgupzxmjnfyjxcpdwzkggludkcmgppndl\nuvuqvyrnhtyubpevizhjxdvmpueittksrnosmfuuzbimnqussasdjufrthrgjbyzomauaxbvwferfvtmydmwmjaoxg", "output": "cdmwmzutsicpzhcokbbhwktqbomozxvvjlhwdgtiledgurxsfreisgczdwgupzxmjnfyjxcpdwzkggludkcmgppndm" }, { "input": "dpnmrwpbgzvcmrcodwgvvfwpyagdwlngmhrazyvalszhruprxzmwltftxmujfyrrnwzvphgqlcphreumqkytswxziugburwrlyay\nqibcfxdfovoejutaeetbbwrgexdrvqywwmhipxgfrvhzovxkfawpfnpjvlhkyahessodqcclangxefcaixysqijnitevwmpalkzd", "output": "dpnmrwpbgzvcmrcodwgvvfwpyagdwlngmhrazyvalszhruprxzmwltftxmujfyrrnwzvphgqlcphreumqkytswxziugburwrlyaz" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaab", "output": "No such string" }, { "input": "phdvmuwqmvzyurtnshitcypuzbhpceovkibzbhhjwxkdtvqmbpoumeoiztxtvkvsjrlnhowsdmgftuiulzebdigmun\nphdvmuwqmvzyurtnshitcypuzbhpceovkibzbhhjwxkdtvqmbpoumeoiztxtvkvsjrlnhowsdmgftuiulzebdigmuo", "output": "No such string" }, { "input": "hrsantdquixzjyjtqytcmnflnyehzbibkbgkqffgqpkgeuqmbmxzhbjwsnfkizvbcyoghyvnxxjavoahlqjxomtsouzoog\nhrsantdquixzjyjtqytcmnflnyehzbibkbgkqffgqpkgeuqmbmxzhbjwsnfkizvbcyoghyvnxxjavoahlqjxomtsouzooh", "output": "No such string" }, { "input": "kexdbtpkjbwwyibjndbtmwqzolopqitgkomqggojevoankiepxirrcidxldlzsppehmoazdywltmjbxgsxgihwnwpmczjrcwpywl\nkexdbtpkjbwwyibjndbtmwqzolopqitgkomqggojevoankiepxirrcidxldlzsppehmoazdywltmjbxgsxgihwnwpmczjrcwpywm", "output": "No such string" }, { "input": "yijdysvzfcnaedvnecswgoylhzgguxecmucepgstjbdkbjyfdlxxxejkrrxfiuwjpdmdhhqhlqeqzjwudtdryrfkpwfxdjlkowmk\nyijdysvzfcnaedvnecswgoylhzgguxecmucepgstjbdkbjyfdlxxxejkrrxfiuwjpdmdhhqhlqeqzjwudtdryrfkpwfxdjlkowml", "output": "No such string" }, { "input": "a\nb", "output": "No such string" }, { "input": "x\nz", "output": "y" }, { "input": "a\nz", "output": "b" }, { "input": "y\nz", "output": "No such string" }, { "input": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzy\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz", "output": "No such string" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaac", "output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaab" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\nzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaab" }, { "input": "yzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz", "output": "zaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa" }, { "input": "yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyy\nzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz", "output": "yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyz" }, { "input": "aaa\naac", "output": "aab" }, { "input": "aaa\naab", "output": "No such string" }, { "input": "zzx\nzzz", "output": "zzy" }, { "input": "zzy\nzzz", "output": "No such string" }, { "input": "aba\naca", "output": "abb" }, { "input": "aaa\nbbb", "output": "aab" }, { "input": "azzz\ncaaa", "output": "baaa" } ]
1,543,793,383
2,147,483,647
PyPy 3
OK
TESTS
51
170
0
from operator import itemgetter #int(input()) #map(int,input().split()) #[list(map(int,input().split())) for i in range(q)] #print("YES" * ans + "NO" * (1-ans)) s = input() s2 = input() alth = "abcdefghijklmnopqrstuvwxyz" n = len(s) s3 = [0] * n for i in range(n-1,-1,-1): if s[i] == "z": s3[i] = "a" else: s3[i] = alth[alth.find(s[i]) + 1] for i in range(i): s3[i] = s[i] break s3 = "".join(s3) if s3 == s2: print("No such string") else: print(s3)
Title: Vitaly and Strings Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vitaly is a diligent student who never missed a lesson in his five years of studying in the university. He always does his homework on time and passes his exams in time. During the last lesson the teacher has provided two strings *s* and *t* to Vitaly. The strings have the same length, they consist of lowercase English letters, string *s* is lexicographically smaller than string *t*. Vitaly wondered if there is such string that is lexicographically larger than string *s* and at the same is lexicographically smaller than string *t*. This string should also consist of lowercase English letters and have the length equal to the lengths of strings *s* and *t*. Let's help Vitaly solve this easy problem! Input Specification: The first line contains string *s* (1<=≀<=|*s*|<=≀<=100), consisting of lowercase English letters. Here, |*s*| denotes the length of the string. The second line contains string *t* (|*t*|<==<=|*s*|), consisting of lowercase English letters. It is guaranteed that the lengths of strings *s* and *t* are the same and string *s* is lexicographically less than string *t*. Output Specification: If the string that meets the given requirements doesn't exist, print a single string "No such string" (without the quotes). If such string exists, print it. If there are multiple valid strings, you may print any of them. Demo Input: ['a\nc\n', 'aaa\nzzz\n', 'abcdefg\nabcdefh\n'] Demo Output: ['b\n', 'kkk\n', 'No such string\n'] Note: String *s* = *s*<sub class="lower-index">1</sub>*s*<sub class="lower-index">2</sub>... *s*<sub class="lower-index">*n*</sub> is said to be lexicographically smaller than *t* = *t*<sub class="lower-index">1</sub>*t*<sub class="lower-index">2</sub>... *t*<sub class="lower-index">*n*</sub>, if there exists such *i*, that *s*<sub class="lower-index">1</sub> = *t*<sub class="lower-index">1</sub>, *s*<sub class="lower-index">2</sub> = *t*<sub class="lower-index">2</sub>, ... *s*<sub class="lower-index">*i* - 1</sub> = *t*<sub class="lower-index">*i* - 1</sub>, *s*<sub class="lower-index">*i*</sub> &lt; *t*<sub class="lower-index">*i*</sub>.
```python from operator import itemgetter #int(input()) #map(int,input().split()) #[list(map(int,input().split())) for i in range(q)] #print("YES" * ans + "NO" * (1-ans)) s = input() s2 = input() alth = "abcdefghijklmnopqrstuvwxyz" n = len(s) s3 = [0] * n for i in range(n-1,-1,-1): if s[i] == "z": s3[i] = "a" else: s3[i] = alth[alth.find(s[i]) + 1] for i in range(i): s3[i] = s[i] break s3 = "".join(s3) if s3 == s2: print("No such string") else: print(s3) ```
3
479
A
Expression
PROGRAMMING
1,000
[ "brute force", "math" ]
null
null
Petya studies in a school and he adores Maths. His class has been studying arithmetic expressions. On the last class the teacher wrote three positive integers *a*, *b*, *c* on the blackboard. The task was to insert signs of operations '+' and '*', and probably brackets between the numbers so that the value of the resulting expression is as large as possible. Let's consider an example: assume that the teacher wrote numbers 1, 2 and 3 on the blackboard. Here are some ways of placing signs and brackets: - 1+2*3=7 - 1*(2+3)=5 - 1*2*3=6 - (1+2)*3=9 Note that you can insert operation signs only between *a* and *b*, and between *b* and *c*, that is, you cannot swap integers. For instance, in the given sample you cannot get expression (1+3)*2. It's easy to see that the maximum value that you can obtain is 9. Your task is: given *a*, *b* and *c* print the maximum value that you can get.
The input contains three integers *a*, *b* and *c*, each on a single line (1<=≀<=*a*,<=*b*,<=*c*<=≀<=10).
Print the maximum value of the expression that you can obtain.
[ "1\n2\n3\n", "2\n10\n3\n" ]
[ "9\n", "60\n" ]
none
500
[ { "input": "1\n2\n3", "output": "9" }, { "input": "2\n10\n3", "output": "60" }, { "input": "1\n1\n1", "output": "3" }, { "input": "1\n2\n1", "output": "4" }, { "input": "10\n10\n10", "output": "1000" }, { "input": "5\n1\n3", "output": "20" }, { "input": "3\n1\n5", "output": "20" }, { "input": "6\n7\n1", "output": "48" }, { "input": "1\n8\n3", "output": "27" }, { "input": "9\n7\n2", "output": "126" }, { "input": "1\n1\n10", "output": "20" }, { "input": "9\n1\n1", "output": "18" }, { "input": "10\n5\n6", "output": "300" }, { "input": "8\n9\n7", "output": "504" }, { "input": "4\n2\n10", "output": "80" }, { "input": "2\n8\n3", "output": "48" }, { "input": "3\n5\n7", "output": "105" }, { "input": "1\n10\n1", "output": "12" }, { "input": "2\n2\n2", "output": "8" }, { "input": "5\n6\n1", "output": "35" }, { "input": "10\n1\n1", "output": "20" }, { "input": "1\n6\n1", "output": "8" }, { "input": "1\n9\n1", "output": "11" }, { "input": "2\n1\n2", "output": "6" }, { "input": "2\n6\n1", "output": "14" }, { "input": "9\n2\n1", "output": "27" }, { "input": "1\n9\n2", "output": "20" }, { "input": "1\n3\n1", "output": "5" }, { "input": "2\n1\n1", "output": "4" } ]
1,695,573,886
2,147,483,647
Python 3
OK
TESTS
29
46
0
x = int(input()) y = int(input()) z = int(input()) print(max(x*y*z,max((x+y)*z,max(x+y+z,x*(y+z)))))
Title: Expression Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petya studies in a school and he adores Maths. His class has been studying arithmetic expressions. On the last class the teacher wrote three positive integers *a*, *b*, *c* on the blackboard. The task was to insert signs of operations '+' and '*', and probably brackets between the numbers so that the value of the resulting expression is as large as possible. Let's consider an example: assume that the teacher wrote numbers 1, 2 and 3 on the blackboard. Here are some ways of placing signs and brackets: - 1+2*3=7 - 1*(2+3)=5 - 1*2*3=6 - (1+2)*3=9 Note that you can insert operation signs only between *a* and *b*, and between *b* and *c*, that is, you cannot swap integers. For instance, in the given sample you cannot get expression (1+3)*2. It's easy to see that the maximum value that you can obtain is 9. Your task is: given *a*, *b* and *c* print the maximum value that you can get. Input Specification: The input contains three integers *a*, *b* and *c*, each on a single line (1<=≀<=*a*,<=*b*,<=*c*<=≀<=10). Output Specification: Print the maximum value of the expression that you can obtain. Demo Input: ['1\n2\n3\n', '2\n10\n3\n'] Demo Output: ['9\n', '60\n'] Note: none
```python x = int(input()) y = int(input()) z = int(input()) print(max(x*y*z,max((x+y)*z,max(x+y+z,x*(y+z))))) ```
3
794
A
Bank Robbery
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
A robber has attempted to rob a bank but failed to complete his task. However, he had managed to open all the safes. Oleg the bank client loves money (who doesn't), and decides to take advantage of this failed robbery and steal some money from the safes. There are many safes arranged in a line, where the *i*-th safe from the left is called safe *i*. There are *n* banknotes left in all the safes in total. The *i*-th banknote is in safe *x**i*. Oleg is now at safe *a*. There are two security guards, one of which guards the safe *b* such that *b*<=&lt;<=*a*, i.e. the first guard is to the left of Oleg. The other guard guards the safe *c* so that *c*<=&gt;<=*a*, i.e. he is to the right of Oleg. The two guards are very lazy, so they do not move. In every second, Oleg can either take all the banknotes from the current safe or move to any of the neighboring safes. However, he cannot visit any safe that is guarded by security guards at any time, becaues he might be charged for stealing. Determine the maximum amount of banknotes Oleg can gather.
The first line of input contains three space-separated integers, *a*, *b* and *c* (1<=≀<=*b*<=&lt;<=*a*<=&lt;<=*c*<=≀<=109), denoting the positions of Oleg, the first security guard and the second security guard, respectively. The next line of input contains a single integer *n* (1<=≀<=*n*<=≀<=105), denoting the number of banknotes. The next line of input contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≀<=*x**i*<=≀<=109), denoting that the *i*-th banknote is located in the *x**i*-th safe. Note that *x**i* are not guaranteed to be distinct.
Output a single integer: the maximum number of banknotes Oleg can take.
[ "5 3 7\n8\n4 7 5 5 3 6 2 8\n", "6 5 7\n5\n1 5 7 92 3\n" ]
[ "4\n", "0\n" ]
In the first example Oleg can take the banknotes in positions 4, 5, 6 (note that there are 2 banknotes at position 5). Oleg can't take the banknotes in safes 7 and 8 because he can't run into the second security guard. Similarly, Oleg cannot take the banknotes at positions 3 and 2 because he can't run into the first security guard. Thus, he can take a maximum of 4 banknotes. For the second sample, Oleg can't take any banknotes without bumping into any of the security guards.
500
[ { "input": "5 3 7\n8\n4 7 5 5 3 6 2 8", "output": "4" }, { "input": "6 5 7\n5\n1 5 7 92 3", "output": "0" }, { "input": "3 2 4\n1\n3", "output": "1" }, { "input": "5 3 8\n12\n8 3 4 5 7 6 8 3 5 4 7 6", "output": "8" }, { "input": "7 3 10\n5\n3 3 3 3 3", "output": "0" }, { "input": "3 2 5\n4\n1 3 4 5", "output": "2" }, { "input": "3 2 4\n1\n1", "output": "0" }, { "input": "6 4 8\n1\n4", "output": "0" }, { "input": "2 1 3\n1\n3", "output": "0" } ]
1,666,438,629
2,147,483,647
Python 3
OK
TESTS
46
109
7,372,800
A = list(input().split()) for i in range(len(A)): A[i]=int(A[i]) a=A[0] b=A[1] c=A[2] n = int(input()) B = list(input().split()) for i in range(len(B)): B[i]=int(B[i]) count = 0 for i in B: if i>b and i<c: count+=1 print(count)
Title: Bank Robbery Time Limit: None seconds Memory Limit: None megabytes Problem Description: A robber has attempted to rob a bank but failed to complete his task. However, he had managed to open all the safes. Oleg the bank client loves money (who doesn't), and decides to take advantage of this failed robbery and steal some money from the safes. There are many safes arranged in a line, where the *i*-th safe from the left is called safe *i*. There are *n* banknotes left in all the safes in total. The *i*-th banknote is in safe *x**i*. Oleg is now at safe *a*. There are two security guards, one of which guards the safe *b* such that *b*<=&lt;<=*a*, i.e. the first guard is to the left of Oleg. The other guard guards the safe *c* so that *c*<=&gt;<=*a*, i.e. he is to the right of Oleg. The two guards are very lazy, so they do not move. In every second, Oleg can either take all the banknotes from the current safe or move to any of the neighboring safes. However, he cannot visit any safe that is guarded by security guards at any time, becaues he might be charged for stealing. Determine the maximum amount of banknotes Oleg can gather. Input Specification: The first line of input contains three space-separated integers, *a*, *b* and *c* (1<=≀<=*b*<=&lt;<=*a*<=&lt;<=*c*<=≀<=109), denoting the positions of Oleg, the first security guard and the second security guard, respectively. The next line of input contains a single integer *n* (1<=≀<=*n*<=≀<=105), denoting the number of banknotes. The next line of input contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≀<=*x**i*<=≀<=109), denoting that the *i*-th banknote is located in the *x**i*-th safe. Note that *x**i* are not guaranteed to be distinct. Output Specification: Output a single integer: the maximum number of banknotes Oleg can take. Demo Input: ['5 3 7\n8\n4 7 5 5 3 6 2 8\n', '6 5 7\n5\n1 5 7 92 3\n'] Demo Output: ['4\n', '0\n'] Note: In the first example Oleg can take the banknotes in positions 4, 5, 6 (note that there are 2 banknotes at position 5). Oleg can't take the banknotes in safes 7 and 8 because he can't run into the second security guard. Similarly, Oleg cannot take the banknotes at positions 3 and 2 because he can't run into the first security guard. Thus, he can take a maximum of 4 banknotes. For the second sample, Oleg can't take any banknotes without bumping into any of the security guards.
```python A = list(input().split()) for i in range(len(A)): A[i]=int(A[i]) a=A[0] b=A[1] c=A[2] n = int(input()) B = list(input().split()) for i in range(len(B)): B[i]=int(B[i]) count = 0 for i in B: if i>b and i<c: count+=1 print(count) ```
3
764
A
Taymyr is calling you
PROGRAMMING
800
[ "brute force", "implementation", "math" ]
null
null
Comrade Dujikov is busy choosing artists for Timofey's birthday and is recieving calls from Taymyr from Ilia-alpinist. Ilia-alpinist calls every *n* minutes, i.e. in minutes *n*, 2*n*, 3*n* and so on. Artists come to the comrade every *m* minutes, i.e. in minutes *m*, 2*m*, 3*m* and so on. The day is *z* minutes long, i.e. the day consists of minutes 1,<=2,<=...,<=*z*. How many artists should be killed so that there are no artists in the room when Ilia calls? Consider that a call and a talk with an artist take exactly one minute.
The only string contains three integersΒ β€” *n*, *m* and *z* (1<=≀<=*n*,<=*m*,<=*z*<=≀<=104).
Print single integerΒ β€” the minimum number of artists that should be killed so that there are no artists in the room when Ilia calls.
[ "1 1 10\n", "1 2 5\n", "2 3 9\n" ]
[ "10\n", "2\n", "1\n" ]
Taymyr is a place in the north of Russia. In the first test the artists come each minute, as well as the calls, so we need to kill all of them. In the second test we need to kill artists which come on the second and the fourth minutes. In the third testΒ β€” only the artist which comes on the sixth minute.
500
[ { "input": "1 1 10", "output": "10" }, { "input": "1 2 5", "output": "2" }, { "input": "2 3 9", "output": "1" }, { "input": "4 8 9", "output": "1" }, { "input": "7 9 2", "output": "0" }, { "input": "10000 10000 10000", "output": "1" }, { "input": "24 22 9235", "output": "34" }, { "input": "74 8 417", "output": "1" }, { "input": "972 1 203", "output": "0" }, { "input": "550 1 754", "output": "1" }, { "input": "860 1 884", "output": "1" }, { "input": "358 2 809", "output": "2" }, { "input": "33 27 216", "output": "0" }, { "input": "2940 1 9311", "output": "3" }, { "input": "4624 1 1953", "output": "0" }, { "input": "2696 2 7345", "output": "2" }, { "input": "3443 2 6701", "output": "0" }, { "input": "3 613 2275", "output": "1" }, { "input": "1 10000 10000", "output": "1" }, { "input": "10000 1 10000", "output": "1" }, { "input": "1 1 1", "output": "1" }, { "input": "1 1 10000", "output": "10000" }, { "input": "34 27 10000", "output": "10" }, { "input": "2 2 9999", "output": "4999" }, { "input": "2 2 1", "output": "0" }, { "input": "6 4 36", "output": "3" }, { "input": "33 6 3005", "output": "45" }, { "input": "5 1 20", "output": "4" }, { "input": "1 2 10", "output": "5" }, { "input": "2 1 100", "output": "50" }, { "input": "10 20 10000", "output": "500" }, { "input": "8 12 12", "output": "0" } ]
1,553,622,352
2,147,483,647
Python 3
OK
TESTS
32
748
307,200
# import sys # sys.stdin=open("input.in",'r') # sys.stdout=open("outp.out",'w') n,m,z=map(int,input().split()) a=[i for i in range(n,z+1,n)] b=[j for j in range(m,z+1,m)] c=0 for x in a: if x in b: c+=1 print(c)
Title: Taymyr is calling you Time Limit: None seconds Memory Limit: None megabytes Problem Description: Comrade Dujikov is busy choosing artists for Timofey's birthday and is recieving calls from Taymyr from Ilia-alpinist. Ilia-alpinist calls every *n* minutes, i.e. in minutes *n*, 2*n*, 3*n* and so on. Artists come to the comrade every *m* minutes, i.e. in minutes *m*, 2*m*, 3*m* and so on. The day is *z* minutes long, i.e. the day consists of minutes 1,<=2,<=...,<=*z*. How many artists should be killed so that there are no artists in the room when Ilia calls? Consider that a call and a talk with an artist take exactly one minute. Input Specification: The only string contains three integersΒ β€” *n*, *m* and *z* (1<=≀<=*n*,<=*m*,<=*z*<=≀<=104). Output Specification: Print single integerΒ β€” the minimum number of artists that should be killed so that there are no artists in the room when Ilia calls. Demo Input: ['1 1 10\n', '1 2 5\n', '2 3 9\n'] Demo Output: ['10\n', '2\n', '1\n'] Note: Taymyr is a place in the north of Russia. In the first test the artists come each minute, as well as the calls, so we need to kill all of them. In the second test we need to kill artists which come on the second and the fourth minutes. In the third testΒ β€” only the artist which comes on the sixth minute.
```python # import sys # sys.stdin=open("input.in",'r') # sys.stdout=open("outp.out",'w') n,m,z=map(int,input().split()) a=[i for i in range(n,z+1,n)] b=[j for j in range(m,z+1,m)] c=0 for x in a: if x in b: c+=1 print(c) ```
3
102
B
Sum of Digits
PROGRAMMING
1,000
[ "implementation" ]
B. Sum of Digits
2
265
Having watched the last Harry Potter film, little Gerald also decided to practice magic. He found in his father's magical book a spell that turns any number in the sum of its digits. At the moment Gerald learned that, he came across a number *n*. How many times can Gerald put a spell on it until the number becomes one-digit?
The first line contains the only integer *n* (0<=≀<=*n*<=≀<=10100000). It is guaranteed that *n* doesn't contain any leading zeroes.
Print the number of times a number can be replaced by the sum of its digits until it only contains one digit.
[ "0\n", "10\n", "991\n" ]
[ "0\n", "1\n", "3\n" ]
In the first sample the number already is one-digit β€” Herald can't cast a spell. The second test contains number 10. After one casting of a spell it becomes 1, and here the process is completed. Thus, Gerald can only cast the spell once. The third test contains number 991. As one casts a spell the following transformations take place: 991 → 19 → 10 → 1. After three transformations the number becomes one-digit.
1,000
[ { "input": "0", "output": "0" }, { "input": "10", "output": "1" }, { "input": "991", "output": "3" }, { "input": "99", "output": "2" }, { "input": "100", "output": "1" }, { "input": "123456789", "output": "2" }, { "input": "32", "output": "1" }, { "input": "86", "output": "2" }, { "input": "2", "output": "0" }, { "input": "8", "output": "0" }, { "input": "34", "output": "1" }, { "input": "13", "output": "1" }, { "input": "28", "output": "2" }, { "input": "23", "output": "1" }, { "input": "57", "output": "2" }, { "input": "29", "output": "2" }, { "input": "353869285", "output": "3" }, { "input": "549548646", "output": "2" }, { "input": "858893424", "output": "2" }, { "input": "644818852", "output": "3" }, { "input": "360322525", "output": "3" }, { "input": "122937520", "output": "2" }, { "input": "288403032", "output": "2" }, { "input": "677257481", "output": "3" }, { "input": "58059561", "output": "3" }, { "input": "211288847", "output": "2" }, { "input": "339900034079539584", "output": "2" }, { "input": "784084029310269952", "output": "3" }, { "input": "774730557264864000", "output": "3" }, { "input": "478233807148352256", "output": "3" }, { "input": "165646874056812544", "output": "3" }, { "input": "477533739511673792", "output": "3" }, { "input": "660119944377002240", "output": "3" }, { "input": "448375218506078080", "output": "3" }, { "input": "77213334785795616", "output": "3" }, { "input": "165767221702271872", "output": "3" }, { "input": "1", "output": "0" }, { "input": "5", "output": "0" }, { "input": "8", "output": "0" }, { "input": "156161456146164104103460452045416165146141414651641564105461465156445621465146514562146145465165145145614561465145614561", "output": "3" }, { "input": "9", "output": "0" } ]
1,598,517,263
2,147,483,647
PyPy 3
OK
TESTS
51
1,246
7,884,800
import sys input = sys.stdin.readline def inp(): return int(input()) def minp(): return map(int,input().split()) def inpsl(): return list(input().split()) def write(s): sys.stdout.write(s+" ") def main(): n = inp() cnt = 0 while(n>9): n = sum([int(i) for i in str(n)]) cnt += 1 print(cnt) main()
Title: Sum of Digits Time Limit: 2 seconds Memory Limit: 265 megabytes Problem Description: Having watched the last Harry Potter film, little Gerald also decided to practice magic. He found in his father's magical book a spell that turns any number in the sum of its digits. At the moment Gerald learned that, he came across a number *n*. How many times can Gerald put a spell on it until the number becomes one-digit? Input Specification: The first line contains the only integer *n* (0<=≀<=*n*<=≀<=10100000). It is guaranteed that *n* doesn't contain any leading zeroes. Output Specification: Print the number of times a number can be replaced by the sum of its digits until it only contains one digit. Demo Input: ['0\n', '10\n', '991\n'] Demo Output: ['0\n', '1\n', '3\n'] Note: In the first sample the number already is one-digit β€” Herald can't cast a spell. The second test contains number 10. After one casting of a spell it becomes 1, and here the process is completed. Thus, Gerald can only cast the spell once. The third test contains number 991. As one casts a spell the following transformations take place: 991 → 19 → 10 → 1. After three transformations the number becomes one-digit.
```python import sys input = sys.stdin.readline def inp(): return int(input()) def minp(): return map(int,input().split()) def inpsl(): return list(input().split()) def write(s): sys.stdout.write(s+" ") def main(): n = inp() cnt = 0 while(n>9): n = sum([int(i) for i in str(n)]) cnt += 1 print(cnt) main() ```
3.674312
744
B
Hongcow's Game
PROGRAMMING
1,900
[ "bitmasks", "divide and conquer", "interactive" ]
null
null
This is an interactive problem. In the interaction section below you will see the information about flushing the output. In this problem, you will be playing a game with Hongcow. How lucky of you! Hongcow has a hidden *n* by *n* matrix *M*. Let *M**i*,<=*j* denote the entry *i*-th row and *j*-th column of the matrix. The rows and columns are labeled from 1 to *n*. The matrix entries are between 0 and 109. In addition, *M**i*,<=*i*<==<=0 for all valid *i*. Your task is to find the minimum value along each row, excluding diagonal elements. Formally, for each *i*, you must find . To do this, you can ask Hongcow some questions. A question consists of giving Hongcow a subset of distinct indices {*w*1,<=*w*2,<=...,<=*w**k*}, with 1<=≀<=*k*<=≀<=*n*. Hongcow will respond with *n* integers. The *i*-th integer will contain the minimum value of *min*1<=≀<=*j*<=≀<=*k**M**i*,<=*w**j*. You may only ask Hongcow at most 20 questionsΒ β€” he thinks you only need that many questions answered. When you are ready to answer, print out a single integer <=-<=1 on its own line, then *n* integers on the next line. The *i*-th integer should be the minimum value in the *i*-th row of the matrix, excluding the *i*-th element. Do not forget to flush the final answer as well. Printing the answer does not count as asking a question. You will get Wrong Answer verdict if - Your question or answers are not in the format described in this statement. - You ask strictly more than 20 questions. - Your question contains duplicate indices. - The value of *k* in your question does not lie in the range from 1 to *n*, inclusive. - Your final answer is not correct.
The first line of input will contain a single integer *n* (2<=≀<=*n*<=≀<=1,<=000).
To print the final answer, print out the string -1 on its own line. Then, the next line should contain *n* integers. The *i*-th integer should be the minimum value of the *i*-th row of the matrix, excluding elements on the diagonal. Do not forget to flush your answer!
[ "3\n0 0 0\n2 7 0\n0 0 4\n3 0 8\n0 5 4", "2\n0 0\n0 0" ]
[ "3\n1 2 3\n1\n3\n2\n1 2\n1\n2\n1\n1\n-1\n2 5 4\n", "1\n2\n1\n1\n-1\n0 0" ]
In the first sample, Hongcow has the hidden matrix Here is a more readable version demonstrating the interaction. The column on the left represents Hongcow, while the column on the right represents the contestant. For the second sample, it is possible for off-diagonal elements of the matrix to be zero.
1,250
[]
1,482,673,361
2,147,483,647
Python 3
OK
TESTS
63
265
6,451,200
import math,sys,re,itertools,pprint,collections,copy rs,ri,rai,raf=input,lambda:int(input()),lambda:list(map(int, input().split())),lambda:list(map(float, input().split())) pai=lambda x: print(" ".join(map(str, x))) n = ri() line_min = [float("inf") for _ in range(n)] requests = [] def init_requests(): requests.append([ [(1, n//2)], [(n//2+1, n)] ]) while True: l, r = requests[-1] ln, rn = [], [] for i, j in l + r: if j - i > 0: ln.append( (i, (i+j)//2) ) rn.append( ((i+j)//2+1, j) ) if len(ln) == 0 and len(rn) == 0: break requests.append([ln, rn]) def make_request(a: list): print(len(a)) print(" ".join(map(str, a))) sys.stdout.flush() ans = rai() for i in range(n): if i+1 not in a: line_min[i] = min(line_min[i], ans[i]) init_requests() for l, r in requests: la = [] for lr in l: la += list(range(lr[0], lr[1]+1)) make_request(la) ra = [] for rr in r: ra += list(range(rr[0], rr[1]+1)) make_request(ra) print(-1) pai(line_min)
Title: Hongcow's Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: This is an interactive problem. In the interaction section below you will see the information about flushing the output. In this problem, you will be playing a game with Hongcow. How lucky of you! Hongcow has a hidden *n* by *n* matrix *M*. Let *M**i*,<=*j* denote the entry *i*-th row and *j*-th column of the matrix. The rows and columns are labeled from 1 to *n*. The matrix entries are between 0 and 109. In addition, *M**i*,<=*i*<==<=0 for all valid *i*. Your task is to find the minimum value along each row, excluding diagonal elements. Formally, for each *i*, you must find . To do this, you can ask Hongcow some questions. A question consists of giving Hongcow a subset of distinct indices {*w*1,<=*w*2,<=...,<=*w**k*}, with 1<=≀<=*k*<=≀<=*n*. Hongcow will respond with *n* integers. The *i*-th integer will contain the minimum value of *min*1<=≀<=*j*<=≀<=*k**M**i*,<=*w**j*. You may only ask Hongcow at most 20 questionsΒ β€” he thinks you only need that many questions answered. When you are ready to answer, print out a single integer <=-<=1 on its own line, then *n* integers on the next line. The *i*-th integer should be the minimum value in the *i*-th row of the matrix, excluding the *i*-th element. Do not forget to flush the final answer as well. Printing the answer does not count as asking a question. You will get Wrong Answer verdict if - Your question or answers are not in the format described in this statement. - You ask strictly more than 20 questions. - Your question contains duplicate indices. - The value of *k* in your question does not lie in the range from 1 to *n*, inclusive. - Your final answer is not correct. Input Specification: The first line of input will contain a single integer *n* (2<=≀<=*n*<=≀<=1,<=000). Output Specification: To print the final answer, print out the string -1 on its own line. Then, the next line should contain *n* integers. The *i*-th integer should be the minimum value of the *i*-th row of the matrix, excluding elements on the diagonal. Do not forget to flush your answer! Demo Input: ['3\n0 0 0\n2 7 0\n0 0 4\n3 0 8\n0 5 4', '2\n0 0\n0 0'] Demo Output: ['3\n1 2 3\n1\n3\n2\n1 2\n1\n2\n1\n1\n-1\n2 5 4\n', '1\n2\n1\n1\n-1\n0 0'] Note: In the first sample, Hongcow has the hidden matrix Here is a more readable version demonstrating the interaction. The column on the left represents Hongcow, while the column on the right represents the contestant. For the second sample, it is possible for off-diagonal elements of the matrix to be zero.
```python import math,sys,re,itertools,pprint,collections,copy rs,ri,rai,raf=input,lambda:int(input()),lambda:list(map(int, input().split())),lambda:list(map(float, input().split())) pai=lambda x: print(" ".join(map(str, x))) n = ri() line_min = [float("inf") for _ in range(n)] requests = [] def init_requests(): requests.append([ [(1, n//2)], [(n//2+1, n)] ]) while True: l, r = requests[-1] ln, rn = [], [] for i, j in l + r: if j - i > 0: ln.append( (i, (i+j)//2) ) rn.append( ((i+j)//2+1, j) ) if len(ln) == 0 and len(rn) == 0: break requests.append([ln, rn]) def make_request(a: list): print(len(a)) print(" ".join(map(str, a))) sys.stdout.flush() ans = rai() for i in range(n): if i+1 not in a: line_min[i] = min(line_min[i], ans[i]) init_requests() for l, r in requests: la = [] for lr in l: la += list(range(lr[0], lr[1]+1)) make_request(la) ra = [] for rr in r: ra += list(range(rr[0], rr[1]+1)) make_request(ra) print(-1) pai(line_min) ```
3
802
G
Fake News (easy)
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
[ "abcheaibcdi\n", "hiedi\n" ]
[ "YES", "NO" ]
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
0
[ { "input": "abcheaibcdi", "output": "YES" }, { "input": "hiedi", "output": "NO" }, { "input": "ihied", "output": "NO" }, { "input": "diehi", "output": "NO" }, { "input": "deiih", "output": "NO" }, { "input": "iheid", "output": "NO" }, { "input": "eihdi", "output": "NO" }, { "input": "ehdii", "output": "NO" }, { "input": "edhii", "output": "NO" }, { "input": "deiih", "output": "NO" }, { "input": "ehdii", "output": "NO" }, { "input": "eufyajkssayhjhqcwxmctecaeepjwmfoscqprpcxsqfwnlgzsmmuwuoruantipholrauvxydfvftwfzhnckxswussvlidcojiciflpvkcxkkcmmvtfvxrkwcpeelwsuzqgamamdtdgzscmikvojfvqehblmjczkvtdeymgertgkwfwfukafqlfdhtedcctixhyetdypswgagrpyto", "output": "YES" }, { "input": "arfbvxgdvqzuloojjrwoyqqbxamxybaqltfimofulusfebodjkwwrgwcppkwiodtpjaraglyplgerrpqjkpoggjmfxhwtqrijpijrcyxnoodvwpyjfpvqaoazllbrpzananbrvvybboedidtuvqquklkpeflfaltukjhzjgiofombhbmqbihgtapswykfvlgdoapjqntvqsaohmbvnphvyyhvhavslamczuqifxnwknkaenqmlvetrqogqxmlptgrmqvxzdxdmwobjesmgxckpmawtioavwdngyiwkzypfnxcovwzdohshwlavwsthdssiadhiwmhpvgkrbezm", "output": "YES" }, { "input": "zcectngbqnejjjtsfrluummmqabzqbyccshjqbrjthzhlbmzjfxugvjouwhumsgrnopiyakfadjnbsesamhynsbfbfunupwbxvohfmpwlcpxhovwpfpciclatgmiufwdvtsqrsdcymvkldpnhfeisrzhyhhlkwdzthgprvkpyldeysvbmcibqkpudyrraqdlxpjecvwcvuiklcrsbgvqasmxmtxqzmawcjtozioqlfflinnxpeexbzloaeqjvglbdeufultpjqexvjjjkzemtzuzmxvawilcqdrcjzpqyhtwfphuonzwkotthsaxrmwtnlmcdylxqcfffyndqeouztluqwlhnkkvzwcfiscikv", "output": "YES" }, { "input": "plqaykgovxkvsiahdbglktdlhcqwelxxmtlyymrsyubxdskvyjkrowvcbpdofpjqspsrgpakdczletxujzlsegepzleipiyycpinzxgwjsgslnxsotouddgfcybozfpjhhocpybfjbaywsehbcfrayvancbrumdfngqytnhihyxnlvilrqyhnxeckprqafofelospffhtwguzjbbjlzbqrtiielbvzutzgpqxosiaqznndgobcluuqlhmffiowkjdlkokehtjdyjvmxsiyxureflmdomerfekxdvtitvwzmdsdzplkpbtafxqfpudnhfqpoiwvjnylanunmagoweobdvfjgepbsymfutrjarlxclhgavpytiiqwvojrptofuvlohzeguxdsrihsbucelhhuedltnnjgzxwyblbqvnoliiydfinzlogbvucwykryzcyibnniggbkdkdcdgcsbvvnavtyhtkanrblpvomvjs", "output": "YES" }, { "input": "fbldqzggeunkpwcfirxanmntbfrudijltoertsdvcvcmbwodbibsrxendzebvxwydpasaqnisrijctsuatihxxygbeovhxjdptdcppkvfytdpjspvrannxavmkmisqtygntxkdlousdypyfkrpzapysfpdbyprufwzhunlsfugojddkmxzinatiwfxdqmgyrnjnxvrclhxyuwxtshoqdjptmeecvgmrlvuwqtmnfnfeeiwcavwnqmyustawbjodzwsqmnjxhpqmgpysierlwbbdzcwprpsexyvreewcmlbvaiytjlxdqdaqftefdlmtmmjcwvfejshymhnouoshdzqcwzxpzupkbcievodzqkqvyjuuxxwepxjalvkzufnveji", "output": "YES" }, { "input": "htsyljgoelbbuipivuzrhmfpkgderqpoprlxdpasxhpmxvaztccldtmujjzjmcpdvsdghzpretlsyyiljhjznseaacruriufswuvizwwuvdioazophhyytvbiogttnnouauxllbdn", "output": "YES" }, { "input": "ikmxzqdzxqlvgeojsnhqzciujslwjyzzexnregabdqztpplosdakimjxmuqccbnwvzbajoiqgdobccwnrwmixohrbdarhoeeelzbpigiybtesybwefpcfx", "output": "YES" }, { "input": "bpvbpjvbdfiodsmahxpcubjxdykesubnypalhypantshkjffmxjmelblqnjdmtaltneuyudyevkgedkqrdmrfeemgpghwrifcwincfixokfgurhqbcfzeajrgkgpwqwsepudxulywowwxzdxkumsicsvnzfxspmjpaixgejeaoyoibegosqoyoydmphfpbutrrewyjecowjckvpcceoamtfbitdneuwqfvnagswlskmsmkhmxyfsrpqwhxzocyffiumcy", "output": "YES" }, { "input": "vllsexwrazvlfvhvrtqeohvzzresjdiuhomfpgqcxpqdevplecuaepixhlijatxzegciizpvyvxuembiplwklahlqibykfideysjygagjbgqkbhdhkatddcwlxboinfuomnpc", "output": "YES" }, { "input": "pnjdwpxmvfoqkjtbhquqcuredrkwqzzfjmdvpnbqtypzdovemhhclkvigjvtprrpzbrbcbatkucaqteuciuozytsptvsskkeplaxdaqmjkmef", "output": "NO" }, { "input": "jpwfhvlxvsdhtuozvlmnfiotrgapgjxtcsgcjnodcztupysvvvmjpzqkpommadppdrykuqkcpzojcwvlogvkddedwbggkrhuvtsvdiokehlkdlnukcufjvqxnikcdawvexxwffxtriqbdmkahxdtygodzohwtdmmuvmatdkvweqvaehaxiefpevkvqpyxsrhtmgjsdfcwzqobibeduooldrmglbinrepmunizheqzvgqvpdskhxfidxfnbisyizhepwyrcykcmjxnkyfjgrqlkixcvysa", "output": "YES" }, { "input": "aftcrvuumeqbfvaqlltscnuhkpcifrrhnutjinxdhhdbzvizlrapzjdatuaynoplgjketupgaejciosofuhcgcjdcucarfvtsofgubtphijciswsvidnvpztlaarydkeqxzwdhfbmullkimerukusbrdnnujviydldrwhdfllsjtziwfeaiqotbiprespmxjulnyunkdtcghrzvhtcychkwatqqmladxpvmvlkzscthylbzkpgwlzfjqwarqvdeyngekqvrhrftpxnkfcibbowvnqdkulcdydspcubwlgoyinpnzgidbgunparnueddzwtzdiavbprbbg", "output": "YES" }, { "input": "oagjghsidigeh", "output": "NO" }, { "input": "chdhzpfzabupskiusjoefrwmjmqkbmdgboicnszkhdrlegeqjsldurmbshijadlwsycselhlnudndpdhcnhruhhvsgbthpruiqfirxkhpqhzhqdfpyozolbionodypfcqfeqbkcgmqkizgeyyelzeoothexcoaahedgrvoemqcwccbvoeqawqeuusyjxmgjkpfwcdttfmwunzuwvsihliexlzygqcgpbdiawfvqukikhbjerjkyhpcknlndaystrgsinghlmekbvhntcpypmchcwoglsmwwdulqneuabuuuvtyrnjxfcgoothalwkzzfxakneusezgnnepkpipzromqubraiggqndliz", "output": "YES" }, { "input": "lgirxqkrkgjcutpqitmffvbujcljkqardlalyigxorscczuzikoylcxenryhskoavymexysvmhbsvhtycjlmzhijpuvcjshyfeycvvcfyzytzoyvxajpqdjtfiatnvxnyeqtfcagfftafllhhjhplbdsrfpctkqpinpdfrtlzyjllfbeffputywcckupyslkbbzpgcnxgbmhtqeqqehpdaokkjtatrhyiuusjhwgiiiikxpzdueasemosmmccoakafgvxduwiuflovhhfhffgnnjhoperhhjtvocpqytjxkmrknnknqeglffhfuplopmktykxuvcmbwpoeisrlyyhdpxfvzseucofyhziuiikihpqheqdyzwigeaqzhxzvporgisxgvhyicqyejovqloibhbunsvsunpvmdckkbuokitdzleilfwutcvuuytpupizinfjrzhxudsmjcjyfcpfgthujjowdwtgbvi", "output": "YES" }, { "input": "uuehrvufgerqbzyzksmqnewacotuimawhlbycdbsmhshrsbqwybbkwjwsrkwptvlbbwjiivqugzrxxwgidrcrhrwsmwgeoleptfamzefgaeyxouxocrpvomjrazmxrnffdwrrmblgdiabdncvfougtmjgvvazasnygdrigbsrieoonirlivfyodvulouslxosswgpdexuldmkdbpdlgutiotvxjyecbrsvbmqxrlcpcipjjncduyqtohlzybvlemmfdeubihwlwqglkgjvnwrbgydcpwklmjeewqklmqdbajqgrpnynaxfvxjzgibqerxyhnxenrmcdqaaeksbzyrcaepozqpetaurlhjuxxhwppuhgoihxdxbmxeiahyaqkbknktlzkheaarjoqqrsyeducvoygwalgarldcdlqogfvsncejssmx", "output": "YES" }, { "input": "iiopulfjxoitgiusqrhgbkiyzinphjtclodbkkydetylvuimkhdkklmyoacmekdvjpuxcrvqnjhqhhbfenlpzpwijtykqziocilvtpqhxuyrphdlamawjuzgjwiebkqyrzyqgtkcrhntjxqmcgkrqcslogjegfrivzidfedeegwbbsopvxvdoididlpypjogxaodtueebbwuwilacunqpozczcgrpaxxrtogpxgfkudtxchoravrrdtimhenwmnafxaruuojduxxglefejycfcyxllfimkszmbrhcwpnwjqgwvzysmlaaifdxfjjpgjmcksiigpanappjdloiolojmcqbnpnjjzaufdpjaknylmyvolhwypygwepmqwpiglpcnpypnudhdzpdvgzosyjthzcwtytxq", "output": "YES" } ]
1,651,644,775
2,147,483,647
Python 3
OK
TESTS
58
77
409,600
#!/usr/bin/env python import math import sys import itertools import fractions if __name__ == '__main__': wtf = sys.stdin.read() wtf = wtf.strip().split('\n') S = wtf[0] f = '' FNT = 'heidi' z = FNT for s in S: if len(f) == 5: if f == FNT: break f = '' z = FNT if s == z[0]: f += s z = z[1:] print('YES' if f == 'heidi' else 'NO')
Title: Fake News (easy) Time Limit: None seconds Memory Limit: None megabytes Problem Description: As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it... Input Specification: The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z). Output Specification: Output YES if the string *s* contains heidi as a subsequence and NO otherwise. Demo Input: ['abcheaibcdi\n', 'hiedi\n'] Demo Output: ['YES', 'NO'] Note: A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
```python #!/usr/bin/env python import math import sys import itertools import fractions if __name__ == '__main__': wtf = sys.stdin.read() wtf = wtf.strip().split('\n') S = wtf[0] f = '' FNT = 'heidi' z = FNT for s in S: if len(f) == 5: if f == FNT: break f = '' z = FNT if s == z[0]: f += s z = z[1:] print('YES' if f == 'heidi' else 'NO') ```
3
1,005
B
Delete from the Left
PROGRAMMING
900
[ "brute force", "implementation", "strings" ]
null
null
You are given two strings $s$ and $t$. In a single move, you can choose any of two strings and delete the first (that is, the leftmost) character. After a move, the length of the string decreases by $1$. You can't choose a string if it is empty. For example: - by applying a move to the string "where", the result is the string "here", - by applying a move to the string "a", the result is an empty string "". You are required to make two given strings equal using the fewest number of moves. It is possible that, in the end, both strings will be equal to the empty string, and so, are equal to each other. In this case, the answer is obviously the sum of the lengths of the initial strings. Write a program that finds the minimum number of moves to make two given strings $s$ and $t$ equal.
The first line of the input contains $s$. In the second line of the input contains $t$. Both strings consist only of lowercase Latin letters. The number of letters in each string is between 1 and $2\cdot10^5$, inclusive.
Output the fewest number of moves required. It is possible that, in the end, both strings will be equal to the empty string, and so, are equal to each other. In this case, the answer is obviously the sum of the lengths of the given strings.
[ "test\nwest\n", "codeforces\nyes\n", "test\nyes\n", "b\nab\n" ]
[ "2\n", "9\n", "7\n", "1\n" ]
In the first example, you should apply the move once to the first string and apply the move once to the second string. As a result, both strings will be equal to "est". In the second example, the move should be applied to the string "codeforces" $8$ times. As a result, the string becomes "codeforces" $\to$ "es". The move should be applied to the string "yes" once. The result is the same string "yes" $\to$ "es". In the third example, you can make the strings equal only by completely deleting them. That is, in the end, both strings will be empty. In the fourth example, the first character of the second string should be deleted.
0
[ { "input": "test\nwest", "output": "2" }, { "input": "codeforces\nyes", "output": "9" }, { "input": "test\nyes", "output": "7" }, { "input": "b\nab", "output": "1" }, { "input": "z\nz", "output": "0" }, { "input": "abacabadabacaba\nabacabadacaba", "output": "18" }, { "input": "z\na", "output": "2" }, { "input": "ama\nsama", "output": "1" }, { "input": "aaabc\nbc", "output": "3" }, { "input": "lxuyspmieeuyxluv\ndfwxqvavzxctblaa", "output": "32" }, { "input": "ahmedaly\naly", "output": "5" }, { "input": "aa\na", "output": "1" }, { "input": "aa\nba", "output": "2" }, { "input": "cccba\nba", "output": "3" }, { "input": "a\nab", "output": "3" }, { "input": "dadc\ndddc", "output": "4" }, { "input": "aacaaab\nb", "output": "6" }, { "input": "dddc\ncdcde", "output": "9" }, { "input": "bbdab\ndab", "output": "2" }, { "input": "a\naa", "output": "1" }, { "input": "aa\nab", "output": "4" }, { "input": "codeforces\nces", "output": "7" } ]
1,633,169,745
2,147,483,647
Python 3
OK
TESTS
28
140
7,782,400
a = input() b = input() n = 0 a1 = len(a) b1 = len(b) while a1 != 0 and b1 != 0 and a[a1-1] == b[b1-1]: a1 -= 1 b1 -= 1 print(a1 + b1) # Sat Oct 02 2021 13:15:45 GMT+0300 (Москва, стандартноС врСмя)
Title: Delete from the Left Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given two strings $s$ and $t$. In a single move, you can choose any of two strings and delete the first (that is, the leftmost) character. After a move, the length of the string decreases by $1$. You can't choose a string if it is empty. For example: - by applying a move to the string "where", the result is the string "here", - by applying a move to the string "a", the result is an empty string "". You are required to make two given strings equal using the fewest number of moves. It is possible that, in the end, both strings will be equal to the empty string, and so, are equal to each other. In this case, the answer is obviously the sum of the lengths of the initial strings. Write a program that finds the minimum number of moves to make two given strings $s$ and $t$ equal. Input Specification: The first line of the input contains $s$. In the second line of the input contains $t$. Both strings consist only of lowercase Latin letters. The number of letters in each string is between 1 and $2\cdot10^5$, inclusive. Output Specification: Output the fewest number of moves required. It is possible that, in the end, both strings will be equal to the empty string, and so, are equal to each other. In this case, the answer is obviously the sum of the lengths of the given strings. Demo Input: ['test\nwest\n', 'codeforces\nyes\n', 'test\nyes\n', 'b\nab\n'] Demo Output: ['2\n', '9\n', '7\n', '1\n'] Note: In the first example, you should apply the move once to the first string and apply the move once to the second string. As a result, both strings will be equal to "est". In the second example, the move should be applied to the string "codeforces" $8$ times. As a result, the string becomes "codeforces" $\to$ "es". The move should be applied to the string "yes" once. The result is the same string "yes" $\to$ "es". In the third example, you can make the strings equal only by completely deleting them. That is, in the end, both strings will be empty. In the fourth example, the first character of the second string should be deleted.
```python a = input() b = input() n = 0 a1 = len(a) b1 = len(b) while a1 != 0 and b1 != 0 and a[a1-1] == b[b1-1]: a1 -= 1 b1 -= 1 print(a1 + b1) # Sat Oct 02 2021 13:15:45 GMT+0300 (Москва, стандартноС врСмя) ```
3
465
A
inc ARG
PROGRAMMING
900
[ "implementation" ]
null
null
Sergey is testing a next-generation processor. Instead of bytes the processor works with memory cells consisting of *n* bits. These bits are numbered from 1 to *n*. An integer is stored in the cell in the following way: the least significant bit is stored in the first bit of the cell, the next significant bit is stored in the second bit, and so on; the most significant bit is stored in the *n*-th bit. Now Sergey wants to test the following instruction: "add 1 to the value of the cell". As a result of the instruction, the integer that is written in the cell must be increased by one; if some of the most significant bits of the resulting number do not fit into the cell, they must be discarded. Sergey wrote certain values ​​of the bits in the cell and is going to add one to its value. How many bits of the cell will change after the operation?
The first line contains a single integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of bits in the cell. The second line contains a string consisting of *n* characters β€” the initial state of the cell. The first character denotes the state of the first bit of the cell. The second character denotes the second least significant bit and so on. The last character denotes the state of the most significant bit.
Print a single integer β€” the number of bits in the cell which change their state after we add 1 to the cell.
[ "4\n1100\n", "4\n1111\n" ]
[ "3\n", "4\n" ]
In the first sample the cell ends up with value 0010, in the second sample β€” with 0000.
500
[ { "input": "4\n1100", "output": "3" }, { "input": "4\n1111", "output": "4" }, { "input": "1\n0", "output": "1" }, { "input": "1\n1", "output": "1" }, { "input": "2\n00", "output": "1" }, { "input": "2\n01", "output": "1" }, { "input": "2\n10", "output": "2" }, { "input": "2\n11", "output": "2" }, { "input": "10\n0000000000", "output": "1" }, { "input": "20\n11111111110110001100", "output": "11" }, { "input": "50\n01011110100010000001010000100001001101001101101011", "output": "1" }, { "input": "60\n111111111101111111111111111111111111111111111111111111111111", "output": "11" }, { "input": "60\n111111111111111111111111111111111111111111111111111111111111", "output": "60" }, { "input": "66\n111111010010011001110011000111000100011110011001111110011111111101", "output": "7" }, { "input": "90\n000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "1" }, { "input": "91\n1011111111111111111111111111111111111111111111111111111111111111111111111111111111111111111", "output": "2" }, { "input": "92\n11111111101011111011111111111111111111111011101111111111011111111111111101111111101011111101", "output": "10" }, { "input": "100\n0001011110100011001100100010111001000001111101101001001001001011110100101101010000000110100101110010", "output": "1" }, { "input": "100\n0111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111", "output": "1" }, { "input": "100\n0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "1" }, { "input": "100\n0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "1" }, { "input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111", "output": "100" }, { "input": "100\n1011001110001000011111110011000100001110010110111101110110011011011000010100110001111100000010110010", "output": "2" }, { "input": "100\n1101111011001111111111110011110111101110111111111111111111111111111111011111111111110111111111111111", "output": "3" }, { "input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111", "output": "100" }, { "input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110", "output": "100" }, { "input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111101", "output": "99" }, { "input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111100000", "output": "96" }, { "input": "100\n1111111111111111111111111111111110011000110110001010101100100100001000010010010010000100110000010101", "output": "34" } ]
1,664,543,379
2,147,483,647
Python 3
OK
TESTS
29
46
0
n=int(input()) cell=input() b=0 place=cell.find("0") if place==(-1): print(n) else: print(place+1)
Title: inc ARG Time Limit: None seconds Memory Limit: None megabytes Problem Description: Sergey is testing a next-generation processor. Instead of bytes the processor works with memory cells consisting of *n* bits. These bits are numbered from 1 to *n*. An integer is stored in the cell in the following way: the least significant bit is stored in the first bit of the cell, the next significant bit is stored in the second bit, and so on; the most significant bit is stored in the *n*-th bit. Now Sergey wants to test the following instruction: "add 1 to the value of the cell". As a result of the instruction, the integer that is written in the cell must be increased by one; if some of the most significant bits of the resulting number do not fit into the cell, they must be discarded. Sergey wrote certain values ​​of the bits in the cell and is going to add one to its value. How many bits of the cell will change after the operation? Input Specification: The first line contains a single integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of bits in the cell. The second line contains a string consisting of *n* characters β€” the initial state of the cell. The first character denotes the state of the first bit of the cell. The second character denotes the second least significant bit and so on. The last character denotes the state of the most significant bit. Output Specification: Print a single integer β€” the number of bits in the cell which change their state after we add 1 to the cell. Demo Input: ['4\n1100\n', '4\n1111\n'] Demo Output: ['3\n', '4\n'] Note: In the first sample the cell ends up with value 0010, in the second sample β€” with 0000.
```python n=int(input()) cell=input() b=0 place=cell.find("0") if place==(-1): print(n) else: print(place+1) ```
3
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP β€” with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* β€” it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,662,217,494
2,147,483,647
Python 3
OK
TESTS
30
92
0
s=input() l=[x for x in s if 97<=ord(x)<=122] u=[x for x in s if 65<=ord(x)<=90] m=len(l) n=len(u) if m==n: print(s.lower()) elif m>n: print(s.lower()) else: print(s.upper())
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP β€” with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* β€” it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python s=input() l=[x for x in s if 97<=ord(x)<=122] u=[x for x in s if 65<=ord(x)<=90] m=len(l) n=len(u) if m==n: print(s.lower()) elif m>n: print(s.lower()) else: print(s.upper()) ```
3.977
129
B
Students and Shoelaces
PROGRAMMING
1,200
[ "brute force", "dfs and similar", "graphs", "implementation" ]
null
null
Anna and Maria are in charge of the math club for junior students. When the club gathers together, the students behave badly. They've brought lots of shoe laces to the club and got tied with each other. Specifically, each string ties together two students. Besides, if two students are tied, then the lace connects the first student with the second one as well as the second student with the first one. To restore order, Anna and Maria do the following. First, for each student Anna finds out what other students he is tied to. If a student is tied to exactly one other student, Anna reprimands him. Then Maria gathers in a single group all the students who have been just reprimanded. She kicks them out from the club. This group of students immediately leaves the club. These students takes with them the laces that used to tie them. Then again for every student Anna finds out how many other students he is tied to and so on. And they do so until Anna can reprimand at least one student. Determine how many groups of students will be kicked out of the club.
The first line contains two integers *n* and *m* β€” the initial number of students and laces (). The students are numbered from 1 to *n*, and the laces are numbered from 1 to *m*. Next *m* lines each contain two integers *a* and *b* β€” the numbers of students tied by the *i*-th lace (1<=≀<=*a*,<=*b*<=≀<=*n*,<=*a*<=β‰ <=*b*). It is guaranteed that no two students are tied with more than one lace. No lace ties a student to himself.
Print the single number β€” the number of groups of students that will be kicked out from the club.
[ "3 3\n1 2\n2 3\n3 1\n", "6 3\n1 2\n2 3\n3 4\n", "6 5\n1 4\n2 4\n3 4\n5 4\n6 4\n" ]
[ "0\n", "2\n", "1\n" ]
In the first sample Anna and Maria won't kick out any group of students β€” in the initial position every student is tied to two other students and Anna won't be able to reprimand anyone. In the second sample four students are tied in a chain and two more are running by themselves. First Anna and Maria kick out the two students from both ends of the chain (1 and 4), then β€” two other students from the chain (2 and 3). At that the students who are running by themselves will stay in the club. In the third sample Anna and Maria will momentarily kick out all students except for the fourth one and the process stops at that point. The correct answer is one.
1,000
[ { "input": "3 3\n1 2\n2 3\n3 1", "output": "0" }, { "input": "6 3\n1 2\n2 3\n3 4", "output": "2" }, { "input": "6 5\n1 4\n2 4\n3 4\n5 4\n6 4", "output": "1" }, { "input": "100 0", "output": "0" }, { "input": "5 5\n1 2\n2 3\n3 4\n4 5\n5 1", "output": "0" }, { "input": "5 4\n1 4\n4 3\n4 5\n5 2", "output": "2" }, { "input": "11 10\n1 2\n1 3\n3 4\n1 5\n5 6\n6 7\n1 8\n8 9\n9 10\n10 11", "output": "4" }, { "input": "7 7\n1 2\n2 3\n3 1\n1 4\n4 5\n4 6\n4 7", "output": "2" }, { "input": "12 49\n6 3\n12 9\n10 11\n3 5\n10 2\n6 9\n8 5\n6 12\n7 3\n3 12\n3 2\n5 6\n7 5\n9 2\n11 1\n7 6\n5 4\n8 7\n12 5\n5 11\n8 9\n10 3\n6 2\n10 4\n9 10\n9 11\n11 3\n5 9\n11 6\n10 8\n7 9\n10 7\n4 6\n3 8\n4 11\n12 2\n4 9\n2 11\n7 11\n1 5\n7 2\n8 1\n4 12\n9 1\n4 2\n8 2\n11 12\n3 1\n1 6", "output": "0" }, { "input": "10 29\n4 5\n1 7\n4 2\n3 8\n7 6\n8 10\n10 6\n4 1\n10 1\n6 2\n7 4\n7 10\n2 7\n9 8\n5 10\n2 5\n8 5\n4 9\n2 8\n5 7\n4 8\n7 3\n6 5\n1 3\n1 9\n10 4\n10 9\n10 2\n2 3", "output": "0" }, { "input": "9 33\n5 7\n5 9\n9 6\n9 1\n7 4\n3 5\n7 8\n8 6\n3 6\n8 2\n3 8\n1 6\n1 8\n1 4\n4 2\n1 2\n2 5\n3 4\n8 5\n2 6\n3 1\n1 5\n1 7\n3 2\n5 4\n9 4\n3 9\n7 3\n6 4\n9 8\n7 9\n8 4\n6 5", "output": "0" }, { "input": "7 8\n5 7\n2 7\n1 6\n1 3\n3 7\n6 3\n6 4\n2 6", "output": "1" }, { "input": "6 15\n3 1\n4 5\n1 4\n6 2\n3 5\n6 3\n1 6\n1 5\n2 3\n2 5\n6 4\n5 6\n4 2\n1 2\n3 4", "output": "0" }, { "input": "7 11\n5 3\n6 5\n6 4\n1 6\n7 1\n2 6\n7 5\n2 5\n3 1\n3 4\n2 4", "output": "0" }, { "input": "95 0", "output": "0" }, { "input": "100 0", "output": "0" }, { "input": "62 30\n29 51\n29 55\n4 12\n53 25\n36 28\n32 11\n29 11\n47 9\n21 8\n25 4\n51 19\n26 56\n22 21\n37 9\n9 33\n7 25\n16 7\n40 49\n15 21\n49 58\n34 30\n20 46\n62 48\n53 57\n33 6\n60 37\n41 34\n62 36\n36 43\n11 39", "output": "2" }, { "input": "56 25\n12 40\n31 27\n18 40\n1 43\n9 10\n25 47\n27 29\n26 28\n19 38\n19 40\n22 14\n21 51\n29 31\n55 29\n51 33\n20 17\n24 15\n3 48\n31 56\n15 29\n49 42\n50 4\n22 42\n25 17\n18 51", "output": "3" }, { "input": "51 29\n36 30\n37 45\n4 24\n40 18\n47 35\n15 1\n30 38\n15 18\n32 40\n34 42\n2 47\n35 21\n25 28\n13 1\n13 28\n36 1\n46 47\n22 17\n41 45\n43 45\n40 15\n29 35\n47 15\n30 21\n9 14\n18 38\n18 50\n42 10\n31 41", "output": "3" }, { "input": "72 45\n5 15\n8 18\n40 25\n71 66\n67 22\n6 44\n16 25\n8 23\n19 70\n26 34\n48 15\n24 2\n54 68\n44 43\n17 37\n49 19\n71 49\n34 38\n59 1\n65 70\n11 54\n5 11\n15 31\n29 50\n48 16\n70 57\n25 59\n2 59\n56 12\n66 62\n24 16\n46 27\n45 67\n68 43\n31 11\n31 30\n8 44\n64 33\n38 44\n54 10\n13 9\n7 51\n25 4\n40 70\n26 65", "output": "5" }, { "input": "56 22\n17 27\n48 49\n29 8\n47 20\n32 7\n44 5\n14 39\n5 13\n40 2\n50 42\n38 9\n18 37\n16 44\n21 32\n21 39\n37 54\n19 46\n30 47\n17 13\n30 31\n49 16\n56 7", "output": "4" }, { "input": "81 46\n53 58\n31 14\n18 54\n43 61\n57 65\n6 38\n49 5\n6 40\n6 10\n17 72\n27 48\n58 39\n21 75\n21 43\n78 20\n34 4\n15 35\n74 48\n76 15\n49 38\n46 51\n78 9\n80 5\n26 42\n64 31\n46 72\n1 29\n20 17\n32 45\n53 43\n24 5\n52 59\n3 80\n78 19\n61 17\n80 12\n17 8\n63 2\n8 4\n44 10\n53 72\n18 60\n68 15\n17 58\n79 71\n73 35", "output": "4" }, { "input": "82 46\n64 43\n32 24\n57 30\n24 46\n70 12\n23 41\n63 39\n46 70\n4 61\n19 12\n39 79\n14 28\n37 3\n12 27\n15 20\n35 39\n25 64\n59 16\n68 63\n37 14\n76 7\n67 29\n9 5\n14 55\n46 26\n71 79\n47 42\n5 55\n18 45\n28 40\n44 78\n74 9\n60 53\n44 19\n52 81\n65 52\n40 13\n40 19\n43 1\n24 23\n68 9\n16 20\n70 14\n41 40\n29 10\n45 65", "output": "8" }, { "input": "69 38\n63 35\n52 17\n43 69\n2 57\n12 5\n26 36\n13 10\n16 68\n5 18\n5 41\n10 4\n60 9\n39 22\n39 28\n53 57\n13 52\n66 38\n49 61\n12 19\n27 46\n67 7\n25 8\n23 58\n52 34\n29 2\n2 42\n8 53\n57 43\n68 11\n48 28\n56 19\n46 33\n63 21\n57 16\n68 59\n67 34\n28 43\n56 36", "output": "4" }, { "input": "75 31\n32 50\n52 8\n21 9\n68 35\n12 72\n47 26\n38 58\n40 55\n31 70\n53 75\n44 1\n65 22\n33 22\n33 29\n14 39\n1 63\n16 52\n70 15\n12 27\n63 31\n47 9\n71 31\n43 17\n43 49\n8 26\n11 39\n9 22\n30 45\n65 47\n32 9\n60 70", "output": "4" }, { "input": "77 41\n48 45\n50 36\n6 69\n70 3\n22 21\n72 6\n54 3\n49 31\n2 23\n14 59\n68 58\n4 54\n60 12\n63 60\n44 24\n28 24\n40 8\n5 1\n13 24\n29 15\n19 76\n70 50\n65 71\n23 33\n58 16\n50 42\n71 28\n58 54\n24 73\n6 17\n29 13\n60 4\n42 4\n21 60\n77 39\n57 9\n51 19\n61 6\n49 36\n24 32\n41 66", "output": "3" }, { "input": "72 39\n9 44\n15 12\n2 53\n34 18\n41 70\n54 72\n39 19\n26 7\n4 54\n53 59\n46 49\n70 6\n9 10\n64 51\n31 60\n61 53\n59 71\n9 60\n67 16\n4 16\n34 3\n2 61\n16 23\n34 6\n10 18\n13 38\n66 40\n59 9\n40 14\n38 24\n31 48\n7 69\n20 39\n49 52\n32 67\n61 35\n62 45\n37 54\n5 27", "output": "8" }, { "input": "96 70\n30 37\n47 56\n19 79\n15 28\n2 43\n43 54\n59 75\n42 22\n38 18\n18 14\n47 41\n60 29\n35 11\n90 4\n14 41\n11 71\n41 24\n68 28\n45 92\n14 15\n34 63\n77 32\n67 38\n36 8\n37 4\n58 95\n68 84\n69 81\n35 23\n56 63\n78 91\n35 44\n66 63\n80 19\n87 88\n28 14\n62 35\n24 23\n83 37\n54 89\n14 40\n9 35\n94 9\n56 46\n92 70\n16 58\n96 31\n53 23\n56 5\n36 42\n89 77\n29 51\n26 13\n46 70\n25 56\n95 96\n3 51\n76 8\n36 82\n44 85\n54 56\n89 67\n32 5\n82 78\n33 65\n43 28\n35 1\n94 13\n26 24\n10 51", "output": "4" }, { "input": "76 49\n15 59\n23 26\n57 48\n49 51\n42 76\n36 40\n37 40\n29 15\n28 71\n47 70\n27 39\n76 21\n55 16\n21 18\n19 1\n25 31\n51 71\n54 42\n28 9\n61 69\n33 9\n18 19\n58 51\n51 45\n29 34\n9 67\n26 8\n70 37\n11 62\n24 22\n59 76\n67 17\n59 11\n54 1\n12 57\n23 3\n46 47\n37 20\n65 9\n51 12\n31 19\n56 13\n58 22\n26 59\n39 76\n27 11\n48 64\n59 35\n44 75", "output": "5" }, { "input": "52 26\n29 41\n16 26\n18 48\n31 17\n37 42\n26 1\n11 7\n29 6\n23 17\n12 47\n34 23\n41 16\n15 35\n25 21\n45 7\n52 2\n37 10\n28 19\n1 27\n30 47\n42 35\n50 30\n30 34\n19 30\n42 25\n47 31", "output": "3" }, { "input": "86 48\n59 34\n21 33\n45 20\n62 23\n4 68\n2 65\n63 26\n64 20\n51 34\n64 21\n68 78\n61 80\n81 3\n38 39\n47 48\n24 34\n44 71\n72 78\n50 2\n13 51\n82 78\n11 74\n14 48\n2 75\n49 55\n63 85\n20 85\n4 53\n51 15\n11 67\n1 15\n2 64\n10 81\n6 7\n68 18\n84 28\n77 69\n10 36\n15 14\n32 86\n16 79\n26 13\n38 55\n47 43\n47 39\n45 37\n58 81\n42 35", "output": "8" }, { "input": "58 29\n27 24\n40 52\n51 28\n44 50\n7 28\n14 53\n10 16\n16 45\n8 56\n35 26\n39 6\n6 14\n45 22\n35 13\n20 17\n42 6\n37 21\n4 11\n26 56\n54 55\n3 57\n40 3\n55 27\n4 51\n35 29\n50 16\n47 7\n48 20\n1 37", "output": "3" }, { "input": "51 23\n46 47\n31 27\n1 20\n49 16\n2 10\n29 47\n13 27\n34 26\n31 2\n28 20\n17 40\n39 4\n29 26\n28 44\n3 39\n50 12\n19 1\n30 21\n41 23\n2 29\n16 3\n49 28\n49 41", "output": "4" }, { "input": "75 43\n46 34\n33 12\n51 39\n47 74\n68 64\n40 46\n20 51\n47 19\n4 5\n57 59\n12 26\n68 65\n38 42\n73 37\n5 74\n36 61\n8 18\n58 33\n34 73\n42 43\n10 49\n70 50\n49 18\n24 53\n71 73\n44 24\n49 56\n24 29\n44 67\n70 46\n57 25\n73 63\n3 51\n30 71\n41 44\n17 69\n17 18\n19 68\n42 7\n11 51\n1 5\n72 23\n65 53", "output": "5" } ]
1,610,271,929
2,147,483,647
Python 3
OK
TESTS
70
154
307,200
s,l = [int(x) for x in input().split()] group = {} for i in range(1,s+1): group[i] = [] for i in range(1, l+1): num,num2 = [int(x) for x in input().split()] group[num].append(num2) group[num2].append(num) grp = 0 while 1: visited = [] check = False for i in range(1, s + 1): if len(group[i]) == 1 and i not in visited: check = True index = group[i][-1] group[index].remove(i) group[i].remove(index) visited.append(index) if check: grp += 1 else: break print(grp)
Title: Students and Shoelaces Time Limit: None seconds Memory Limit: None megabytes Problem Description: Anna and Maria are in charge of the math club for junior students. When the club gathers together, the students behave badly. They've brought lots of shoe laces to the club and got tied with each other. Specifically, each string ties together two students. Besides, if two students are tied, then the lace connects the first student with the second one as well as the second student with the first one. To restore order, Anna and Maria do the following. First, for each student Anna finds out what other students he is tied to. If a student is tied to exactly one other student, Anna reprimands him. Then Maria gathers in a single group all the students who have been just reprimanded. She kicks them out from the club. This group of students immediately leaves the club. These students takes with them the laces that used to tie them. Then again for every student Anna finds out how many other students he is tied to and so on. And they do so until Anna can reprimand at least one student. Determine how many groups of students will be kicked out of the club. Input Specification: The first line contains two integers *n* and *m* β€” the initial number of students and laces (). The students are numbered from 1 to *n*, and the laces are numbered from 1 to *m*. Next *m* lines each contain two integers *a* and *b* β€” the numbers of students tied by the *i*-th lace (1<=≀<=*a*,<=*b*<=≀<=*n*,<=*a*<=β‰ <=*b*). It is guaranteed that no two students are tied with more than one lace. No lace ties a student to himself. Output Specification: Print the single number β€” the number of groups of students that will be kicked out from the club. Demo Input: ['3 3\n1 2\n2 3\n3 1\n', '6 3\n1 2\n2 3\n3 4\n', '6 5\n1 4\n2 4\n3 4\n5 4\n6 4\n'] Demo Output: ['0\n', '2\n', '1\n'] Note: In the first sample Anna and Maria won't kick out any group of students β€” in the initial position every student is tied to two other students and Anna won't be able to reprimand anyone. In the second sample four students are tied in a chain and two more are running by themselves. First Anna and Maria kick out the two students from both ends of the chain (1 and 4), then β€” two other students from the chain (2 and 3). At that the students who are running by themselves will stay in the club. In the third sample Anna and Maria will momentarily kick out all students except for the fourth one and the process stops at that point. The correct answer is one.
```python s,l = [int(x) for x in input().split()] group = {} for i in range(1,s+1): group[i] = [] for i in range(1, l+1): num,num2 = [int(x) for x in input().split()] group[num].append(num2) group[num2].append(num) grp = 0 while 1: visited = [] check = False for i in range(1, s + 1): if len(group[i]) == 1 and i not in visited: check = True index = group[i][-1] group[index].remove(i) group[i].remove(index) visited.append(index) if check: grp += 1 else: break print(grp) ```
3
797
C
Minimal string
PROGRAMMING
1,700
[ "data structures", "greedy", "strings" ]
null
null
Petya recieved a gift of a string *s* with length up to 105 characters for his birthday. He took two more empty strings *t* and *u* and decided to play a game. This game has two possible moves: - Extract the first character of *s* and append *t* with this character. - Extract the last character of *t* and append *u* with this character. Petya wants to get strings *s* and *t* empty and string *u* lexicographically minimal. You should write a program that will help Petya win the game.
First line contains non-empty string *s* (1<=≀<=|*s*|<=≀<=105), consisting of lowercase English letters.
Print resulting string *u*.
[ "cab\n", "acdb\n" ]
[ "abc\n", "abdc\n" ]
none
0
[ { "input": "cab", "output": "abc" }, { "input": "acdb", "output": "abdc" }, { "input": "a", "output": "a" }, { "input": "ab", "output": "ab" }, { "input": "ba", "output": "ab" }, { "input": "dijee", "output": "deeji" }, { "input": "bhrmc", "output": "bcmrh" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa" }, { "input": "bababaaababaabbbbbabbbbbbaaabbabaaaaabbbbbaaaabbbbabaabaabababbbabbabbabaaababbabbababaaaaabaaaabbba", "output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb" }, { "input": "bccbbcccbccbacacbaccaababcbaababaaaaabcaaabcaacbabcaababaabaccacacccbacbcacbbbaacaaccccabbbbacbcbbba", "output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbcbcbbbbcccccbbbccbcbccccccbbbcbbccbcbbbbcbbccbccbccbcccbbccb" }, { "input": "eejahjfbbcdhbieiigaihidhageiechaadieecaaehcehjbddgcjgagdfgffdaaihbecebdjhjagghecdhbhdfbedhfhfafbjajg", "output": "aaaaaaaaaaaaagjjbffhfhdebfdhbhdcehggjhjdbecebhidffgfdggjcgddbjhecheceeidhceieghdihigiieibhdcbbfjhjee" }, { "input": "bnrdfnybkzepmluyrhofwnwvfmkdwolvyzrqhuhztvlwjldqmoyxzytpfmrgouymeupxrvpbesyxixnrfbxnqcwgmgjstknqtwrr", "output": "bbbbcggjknqrrwttsmwqnxfrnxixysepvrxpuemyuogrmfptyzxyomqdljwlvtzhuhqrzyvlowdkmfvwnwfohryulmpezkynfdrn" }, { "input": "bcaeaae", "output": "aaaecbe" }, { "input": "edcadcbcdd", "output": "abccdcddde" }, { "input": "a", "output": "a" }, { "input": "a", "output": "a" }, { "input": "a", "output": "a" }, { "input": "b", "output": "b" }, { "input": "b", "output": "b" }, { "input": "a", "output": "a" }, { "input": "c", "output": "c" }, { "input": "a", "output": "a" }, { "input": "b", "output": "b" }, { "input": "c", "output": "c" }, { "input": "b", "output": "b" }, { "input": "a", "output": "a" }, { "input": "e", "output": "e" }, { "input": "b", "output": "b" }, { "input": "b", "output": "b" }, { "input": "aa", "output": "aa" }, { "input": "aa", "output": "aa" }, { "input": "aa", "output": "aa" }, { "input": "aa", "output": "aa" }, { "input": "bb", "output": "bb" }, { "input": "bb", "output": "bb" }, { "input": "ba", "output": "ab" }, { "input": "ca", "output": "ac" }, { "input": "ab", "output": "ab" }, { "input": "cb", "output": "bc" }, { "input": "bb", "output": "bb" }, { "input": "aa", "output": "aa" }, { "input": "da", "output": "ad" }, { "input": "ab", "output": "ab" }, { "input": "cd", "output": "cd" }, { "input": "aaa", "output": "aaa" }, { "input": "aaa", "output": "aaa" }, { "input": "aaa", "output": "aaa" }, { "input": "aab", "output": "aab" }, { "input": "aaa", "output": "aaa" }, { "input": "baa", "output": "aab" }, { "input": "bab", "output": "abb" }, { "input": "baa", "output": "aab" }, { "input": "ccc", "output": "ccc" }, { "input": "ddd", "output": "ddd" }, { "input": "ccd", "output": "ccd" }, { "input": "bca", "output": "acb" }, { "input": "cde", "output": "cde" }, { "input": "ece", "output": "cee" }, { "input": "bdd", "output": "bdd" }, { "input": "aaaa", "output": "aaaa" }, { "input": "aaaa", "output": "aaaa" }, { "input": "aaaa", "output": "aaaa" }, { "input": "abaa", "output": "aaab" }, { "input": "abab", "output": "aabb" }, { "input": "bbbb", "output": "bbbb" }, { "input": "bbba", "output": "abbb" }, { "input": "caba", "output": "aabc" }, { "input": "ccbb", "output": "bbcc" }, { "input": "abac", "output": "aabc" }, { "input": "daba", "output": "aabd" }, { "input": "cdbb", "output": "bbdc" }, { "input": "bddd", "output": "bddd" }, { "input": "dacb", "output": "abcd" }, { "input": "abcc", "output": "abcc" }, { "input": "aaaaa", "output": "aaaaa" }, { "input": "aaaaa", "output": "aaaaa" }, { "input": "aaaaa", "output": "aaaaa" }, { "input": "baaab", "output": "aaabb" }, { "input": "aabbb", "output": "aabbb" }, { "input": "aabaa", "output": "aaaab" }, { "input": "abcba", "output": "aabcb" }, { "input": "bacbc", "output": "abbcc" }, { "input": "bacba", "output": "aabcb" }, { "input": "bdbda", "output": "adbdb" }, { "input": "accbb", "output": "abbcc" }, { "input": "dbccc", "output": "bcccd" }, { "input": "decca", "output": "acced" }, { "input": "dbbdd", "output": "bbddd" }, { "input": "accec", "output": "accce" }, { "input": "aaaaaa", "output": "aaaaaa" }, { "input": "aaaaaa", "output": "aaaaaa" }, { "input": "aaaaaa", "output": "aaaaaa" }, { "input": "bbbbab", "output": "abbbbb" }, { "input": "bbbbab", "output": "abbbbb" }, { "input": "aaaaba", "output": "aaaaab" }, { "input": "cbbbcc", "output": "bbbccc" }, { "input": "aaacac", "output": "aaaacc" }, { "input": "bacbbc", "output": "abbbcc" }, { "input": "cacacc", "output": "aacccc" }, { "input": "badbdc", "output": "abbcdd" }, { "input": "ddadad", "output": "aadddd" }, { "input": "ccdece", "output": "cccede" }, { "input": "eecade", "output": "acdeee" }, { "input": "eabdcb", "output": "abbcde" }, { "input": "aaaaaaa", "output": "aaaaaaa" }, { "input": "aaaaaaa", "output": "aaaaaaa" }, { "input": "aaaaaaa", "output": "aaaaaaa" }, { "input": "aaabbaa", "output": "aaaaabb" }, { "input": "baaabab", "output": "aaaabbb" }, { "input": "bbababa", "output": "aaabbbb" }, { "input": "bcccacc", "output": "acccbcc" }, { "input": "cbbcccc", "output": "bbccccc" }, { "input": "abacaaa", "output": "aaaaacb" }, { "input": "ccdbdac", "output": "acdbdcc" }, { "input": "bbacaba", "output": "aaabcbb" }, { "input": "abbaccc", "output": "aabbccc" }, { "input": "bdcbcab", "output": "abcbcdb" }, { "input": "dabcbce", "output": "abbccde" }, { "input": "abaaabe", "output": "aaaabbe" }, { "input": "aaaaaaaa", "output": "aaaaaaaa" }, { "input": "aaaaaaaa", "output": "aaaaaaaa" }, { "input": "aaaaaaaa", "output": "aaaaaaaa" }, { "input": "ababbbba", "output": "aaabbbbb" }, { "input": "aaaaaaba", "output": "aaaaaaab" }, { "input": "babbbaab", "output": "aaabbbbb" }, { "input": "bcaccaab", "output": "aaabcccb" }, { "input": "bbccaabc", "output": "aabccbbc" }, { "input": "cacaaaac", "output": "aaaaaccc" }, { "input": "daacbddc", "output": "aabccddd" }, { "input": "cdbdcdaa", "output": "aadcdbdc" }, { "input": "bccbdacd", "output": "acdbccbd" }, { "input": "abbeaade", "output": "aaadebbe" }, { "input": "ccabecba", "output": "aabcebcc" }, { "input": "ececaead", "output": "aadecece" }, { "input": "aaaaaaaaa", "output": "aaaaaaaaa" }, { "input": "aaaaaaaaa", "output": "aaaaaaaaa" }, { "input": "aaaaaaaaa", "output": "aaaaaaaaa" }, { "input": "aabaaabbb", "output": "aaaaabbbb" }, { "input": "abbbbbaab", "output": "aaabbbbbb" }, { "input": "bbbaababb", "output": "aaabbbbbb" }, { "input": "babcaaccb", "output": "aaabcccbb" }, { "input": "ccbcabaac", "output": "aaabcbccc" }, { "input": "caaaccccb", "output": "aaabccccc" }, { "input": "abbcdbddb", "output": "abbbbdddc" }, { "input": "dbcaacbbb", "output": "aabbbccbd" }, { "input": "cadcbddac", "output": "aacddbcdc" }, { "input": "ecebadadb", "output": "aabddbece" }, { "input": "bdbeeccdd", "output": "bbccddeed" }, { "input": "daaedecda", "output": "aaadceded" }, { "input": "aaaaaaaaaa", "output": "aaaaaaaaaa" }, { "input": "aaaaaaaaaa", "output": "aaaaaaaaaa" }, { "input": "aaaaaaaaaa", "output": "aaaaaaaaaa" }, { "input": "abaaaaabbb", "output": "aaaaaabbbb" }, { "input": "bbaaaabaaa", "output": "aaaaaaabbb" }, { "input": "bbabbaaaaa", "output": "aaaaaabbbb" }, { "input": "cbaabcaacc", "output": "aaaacbbccc" }, { "input": "aaaaccccab", "output": "aaaaabcccc" }, { "input": "bccaccaacc", "output": "aaaccccbcc" }, { "input": "dbdccdcacd", "output": "accdccdbdd" }, { "input": "caaddaaccb", "output": "aaaabccddc" }, { "input": "adbbabcbdc", "output": "aabbbbccdd" }, { "input": "cdeabdbbad", "output": "aabbdbdedc" }, { "input": "eeddcbeeec", "output": "bcceeeddee" }, { "input": "bbcebddeba", "output": "abeddbecbb" } ]
1,584,980,803
2,147,483,647
Python 3
OK
TESTS
189
561
1,843,200
def fnz(l): for i in range(len(l)): if l[i] != 0: return i return i alphabets = ["a","b","c","d","e","f","g","h","i","j","k","l","m","n","o","p","q","r","s","t","u","v","w","x","y","z"] count_alph = [0]*26 s = input() t = [] u = [] for i in s: count_alph[alphabets.index(i)] +=1 for i in s: t.append(i) count_alph[alphabets.index(i)] -=1 while t[-1] <= alphabets[fnz(count_alph)]: u.append(t.pop()) if len(t) == 0: break u = u + t[::-1] ans = "" for i in u: ans += i print(ans)
Title: Minimal string Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petya recieved a gift of a string *s* with length up to 105 characters for his birthday. He took two more empty strings *t* and *u* and decided to play a game. This game has two possible moves: - Extract the first character of *s* and append *t* with this character. - Extract the last character of *t* and append *u* with this character. Petya wants to get strings *s* and *t* empty and string *u* lexicographically minimal. You should write a program that will help Petya win the game. Input Specification: First line contains non-empty string *s* (1<=≀<=|*s*|<=≀<=105), consisting of lowercase English letters. Output Specification: Print resulting string *u*. Demo Input: ['cab\n', 'acdb\n'] Demo Output: ['abc\n', 'abdc\n'] Note: none
```python def fnz(l): for i in range(len(l)): if l[i] != 0: return i return i alphabets = ["a","b","c","d","e","f","g","h","i","j","k","l","m","n","o","p","q","r","s","t","u","v","w","x","y","z"] count_alph = [0]*26 s = input() t = [] u = [] for i in s: count_alph[alphabets.index(i)] +=1 for i in s: t.append(i) count_alph[alphabets.index(i)] -=1 while t[-1] <= alphabets[fnz(count_alph)]: u.append(t.pop()) if len(t) == 0: break u = u + t[::-1] ans = "" for i in u: ans += i print(ans) ```
3
430
B
Balls Game
PROGRAMMING
1,400
[ "brute force", "two pointers" ]
null
null
Iahub is training for the IOI. What is a better way to train than playing a Zuma-like game? There are *n* balls put in a row. Each ball is colored in one of *k* colors. Initially the row doesn't contain three or more contiguous balls with the same color. Iahub has a single ball of color *x*. He can insert his ball at any position in the row (probably, between two other balls). If at any moment there are three or more contiguous balls of the same color in the row, they are destroyed immediately. This rule is applied multiple times, until there are no more sets of 3 or more contiguous balls of the same color. For example, if Iahub has the row of balls [black, black, white, white, black, black] and a white ball, he can insert the ball between two white balls. Thus three white balls are destroyed, and then four black balls become contiguous, so all four balls are destroyed. The row will not contain any ball in the end, so Iahub can destroy all 6 balls. Iahub wants to destroy as many balls as possible. You are given the description of the row of balls, and the color of Iahub's ball. Help Iahub train for the IOI by telling him the maximum number of balls from the row he can destroy.
The first line of input contains three integers: *n* (1<=≀<=*n*<=≀<=100), *k* (1<=≀<=*k*<=≀<=100) and *x* (1<=≀<=*x*<=≀<=*k*). The next line contains *n* space-separated integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≀<=*c**i*<=≀<=*k*). Number *c**i* means that the *i*-th ball in the row has color *c**i*. It is guaranteed that the initial row of balls will never contain three or more contiguous balls of the same color.
Print a single integer β€” the maximum number of balls Iahub can destroy.
[ "6 2 2\n1 1 2 2 1 1\n", "1 1 1\n1\n" ]
[ "6\n", "0\n" ]
none
1,000
[ { "input": "6 2 2\n1 1 2 2 1 1", "output": "6" }, { "input": "1 1 1\n1", "output": "0" }, { "input": "10 2 1\n2 1 2 2 1 2 2 1 1 2", "output": "5" }, { "input": "50 2 1\n1 1 2 2 1 2 1 1 2 2 1 2 1 2 1 1 2 2 1 2 1 2 2 1 2 1 2 1 2 2 1 1 2 2 1 1 2 2 1 2 1 1 2 1 1 2 2 1 1 2", "output": "15" }, { "input": "75 5 5\n1 1 5 5 3 5 2 3 3 2 2 1 1 5 4 4 3 4 5 4 3 3 1 2 2 1 2 1 2 5 5 2 1 3 2 2 3 1 2 1 1 5 5 1 1 2 1 1 2 2 5 2 2 1 1 2 1 2 1 1 3 3 5 4 4 3 3 4 4 5 5 1 1 2 2", "output": "6" }, { "input": "100 3 2\n1 1 2 3 1 3 2 1 1 3 3 2 2 1 1 2 2 1 1 3 2 2 3 2 3 2 2 3 3 1 1 2 2 1 2 2 1 3 3 1 3 3 1 2 1 2 2 1 2 3 2 1 1 2 1 1 3 3 1 3 3 1 1 2 2 1 1 2 1 3 2 2 3 2 2 3 3 1 2 1 2 2 1 1 2 3 1 3 3 1 2 3 2 2 1 3 2 2 3 3", "output": "6" }, { "input": "100 2 1\n2 2 1 2 1 2 1 2 2 1 1 2 1 1 2 1 1 2 2 1 1 2 1 1 2 1 2 2 1 2 1 2 1 2 1 1 2 1 1 2 1 1 2 2 1 1 2 1 2 2 1 2 1 2 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 1 2 1 2 1 2 2 1 2 1 1 2 1 2 1 1 2 1 1 2 1 1 2 2 1 2 2 1 1 2 1", "output": "15" }, { "input": "100 2 2\n1 2 1 2 2 1 2 1 2 1 2 1 1 2 1 2 2 1 1 2 1 1 2 2 1 1 2 1 2 2 1 2 2 1 2 1 2 1 1 2 1 2 1 2 1 2 1 1 2 1 1 2 2 1 1 2 2 1 2 1 2 1 2 1 2 2 1 2 1 2 2 1 1 2 1 2 2 1 1 2 2 1 2 1 2 1 1 2 1 2 1 2 1 2 1 2 2 1 2 2", "output": "14" }, { "input": "100 2 2\n1 2 1 1 2 1 2 2 1 2 1 2 1 2 1 2 1 2 2 1 1 2 2 1 2 1 1 2 2 1 1 2 1 2 1 2 1 1 2 1 1 2 1 2 2 1 1 2 2 1 1 2 1 2 2 1 1 2 1 2 1 2 2 1 2 2 1 1 2 1 2 2 1 2 2 1 2 1 1 2 1 2 2 1 2 2 1 2 1 2 1 2 1 1 2 2 1 1 2 2", "output": "17" }, { "input": "100 2 2\n2 1 1 2 2 1 1 2 1 2 1 1 2 2 1 2 1 2 1 2 2 1 2 1 1 2 1 2 1 2 1 2 1 1 2 2 1 1 2 1 1 2 1 2 2 1 1 2 1 2 1 1 2 2 1 1 2 1 2 1 2 1 2 2 1 1 2 2 1 1 2 2 1 2 1 2 1 1 2 1 1 2 2 1 2 1 2 2 1 2 2 1 1 2 1 2 2 1 2 2", "output": "17" }, { "input": "100 2 2\n1 2 2 1 2 2 1 1 2 1 2 1 2 1 2 1 2 1 2 1 1 2 2 1 2 1 2 1 2 1 2 1 1 2 1 1 2 1 2 2 1 1 2 2 1 1 2 1 1 2 2 1 2 1 2 1 2 1 2 1 1 2 2 1 1 2 2 1 1 2 2 1 2 2 1 1 2 1 2 2 1 2 2 1 2 2 1 2 2 1 1 2 2 1 2 1 2 1 2 1", "output": "28" }, { "input": "100 2 2\n1 1 2 1 2 1 1 2 1 2 1 2 2 1 2 1 2 1 1 2 2 1 2 1 1 2 2 1 1 2 1 2 2 1 2 2 1 2 1 2 1 1 2 1 2 1 1 2 2 1 1 2 1 2 1 2 1 2 1 2 2 1 1 2 1 2 2 1 2 1 1 2 1 1 2 1 2 1 2 1 1 2 1 2 2 1 2 1 2 2 1 1 2 1 2 2 1 1 2 2", "output": "8" }, { "input": "100 100 50\n15 44 5 7 75 40 52 82 78 90 48 32 16 53 69 2 21 84 7 21 21 87 29 8 42 54 10 21 38 55 54 88 48 63 3 17 45 82 82 91 7 11 11 24 24 79 1 32 32 38 41 41 4 4 74 17 26 26 96 96 3 3 50 50 96 26 26 17 17 74 74 4 41 38 38 32 1 1 79 79 24 11 11 7 7 91 91 82 45 45 97 9 74 60 32 91 61 64 100 26", "output": "2" }, { "input": "100 50 22\n15 2 18 15 48 35 46 33 32 39 39 5 5 27 27 50 50 47 47 10 10 6 3 3 7 8 7 17 17 29 14 10 10 46 13 13 31 32 31 22 22 32 31 31 32 13 13 46 46 10 10 14 14 29 29 17 7 7 8 3 6 6 10 47 50 50 27 5 5 39 39 21 47 4 40 47 21 28 21 21 40 27 34 17 3 36 5 7 21 14 25 49 40 34 32 13 23 29 2 4", "output": "2" }, { "input": "100 3 3\n3 1 1 2 1 1 3 1 3 3 1 3 3 1 2 1 1 2 2 3 3 2 3 2 2 3 1 3 3 2 2 1 3 3 2 2 1 2 3 3 1 3 1 3 1 2 2 1 2 1 2 3 1 3 1 3 2 1 3 2 3 3 2 3 2 3 1 3 2 2 1 2 1 2 1 1 3 1 3 1 2 1 2 1 2 3 2 2 3 3 2 2 3 2 2 3 1 1 2 3", "output": "6" }, { "input": "100 100 100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "0" }, { "input": "100 2 2\n1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2 1 1 2 2", "output": "98" }, { "input": "6 20 10\n10 2 10 10 2 2", "output": "5" } ]
1,599,965,703
2,147,483,647
PyPy 3
OK
TESTS
18
170
1,433,600
#! /usr/bin/python3 def remove_contiguous(arr): left = 0 right = 1 while(right < len(arr)): while(right < len(arr) and arr[left] == arr[right]): right += 1 if (right - left >= 3): del arr[left:right] modified = True return arr left = right right += 1 return arr n, k, x = map(int, input().strip().split()) c = [int(x) for x in input().strip().split()] ans = 0 for i in range(1, len(c)): if c[i - 1] == c[i] and c[i] == x: d = c[:i] + [x] + c[i:] len_prev = len(d) while(True): d = remove_contiguous(d) if (len_prev == len(d)): break len_prev = len(d) ans = max(ans, n - len(d)) print(ans)
Title: Balls Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Iahub is training for the IOI. What is a better way to train than playing a Zuma-like game? There are *n* balls put in a row. Each ball is colored in one of *k* colors. Initially the row doesn't contain three or more contiguous balls with the same color. Iahub has a single ball of color *x*. He can insert his ball at any position in the row (probably, between two other balls). If at any moment there are three or more contiguous balls of the same color in the row, they are destroyed immediately. This rule is applied multiple times, until there are no more sets of 3 or more contiguous balls of the same color. For example, if Iahub has the row of balls [black, black, white, white, black, black] and a white ball, he can insert the ball between two white balls. Thus three white balls are destroyed, and then four black balls become contiguous, so all four balls are destroyed. The row will not contain any ball in the end, so Iahub can destroy all 6 balls. Iahub wants to destroy as many balls as possible. You are given the description of the row of balls, and the color of Iahub's ball. Help Iahub train for the IOI by telling him the maximum number of balls from the row he can destroy. Input Specification: The first line of input contains three integers: *n* (1<=≀<=*n*<=≀<=100), *k* (1<=≀<=*k*<=≀<=100) and *x* (1<=≀<=*x*<=≀<=*k*). The next line contains *n* space-separated integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≀<=*c**i*<=≀<=*k*). Number *c**i* means that the *i*-th ball in the row has color *c**i*. It is guaranteed that the initial row of balls will never contain three or more contiguous balls of the same color. Output Specification: Print a single integer β€” the maximum number of balls Iahub can destroy. Demo Input: ['6 2 2\n1 1 2 2 1 1\n', '1 1 1\n1\n'] Demo Output: ['6\n', '0\n'] Note: none
```python #! /usr/bin/python3 def remove_contiguous(arr): left = 0 right = 1 while(right < len(arr)): while(right < len(arr) and arr[left] == arr[right]): right += 1 if (right - left >= 3): del arr[left:right] modified = True return arr left = right right += 1 return arr n, k, x = map(int, input().strip().split()) c = [int(x) for x in input().strip().split()] ans = 0 for i in range(1, len(c)): if c[i - 1] == c[i] and c[i] == x: d = c[:i] + [x] + c[i:] len_prev = len(d) while(True): d = remove_contiguous(d) if (len_prev == len(d)): break len_prev = len(d) ans = max(ans, n - len(d)) print(ans) ```
3
791
A
Bear and Big Brother
PROGRAMMING
800
[ "implementation" ]
null
null
Bear Limak wants to become the largest of bears, or at least to become larger than his brother Bob. Right now, Limak and Bob weigh *a* and *b* respectively. It's guaranteed that Limak's weight is smaller than or equal to his brother's weight. Limak eats a lot and his weight is tripled after every year, while Bob's weight is doubled after every year. After how many full years will Limak become strictly larger (strictly heavier) than Bob?
The only line of the input contains two integers *a* and *b* (1<=≀<=*a*<=≀<=*b*<=≀<=10)Β β€” the weight of Limak and the weight of Bob respectively.
Print one integer, denoting the integer number of years after which Limak will become strictly larger than Bob.
[ "4 7\n", "4 9\n", "1 1\n" ]
[ "2\n", "3\n", "1\n" ]
In the first sample, Limak weighs 4 and Bob weighs 7 initially. After one year their weights are 4Β·3 = 12 and 7Β·2 = 14 respectively (one weight is tripled while the other one is doubled). Limak isn't larger than Bob yet. After the second year weights are 36 and 28, so the first weight is greater than the second one. Limak became larger than Bob after two years so you should print 2. In the second sample, Limak's and Bob's weights in next years are: 12 and 18, then 36 and 36, and finally 108 and 72 (after three years). The answer is 3. Remember that Limak wants to be larger than Bob and he won't be satisfied with equal weights. In the third sample, Limak becomes larger than Bob after the first year. Their weights will be 3 and 2 then.
500
[ { "input": "4 7", "output": "2" }, { "input": "4 9", "output": "3" }, { "input": "1 1", "output": "1" }, { "input": "4 6", "output": "2" }, { "input": "1 10", "output": "6" }, { "input": "1 1", "output": "1" }, { "input": "1 2", "output": "2" }, { "input": "1 3", "output": "3" }, { "input": "1 4", "output": "4" }, { "input": "1 5", "output": "4" }, { "input": "1 6", "output": "5" }, { "input": "1 7", "output": "5" }, { "input": "1 8", "output": "6" }, { "input": "1 9", "output": "6" }, { "input": "1 10", "output": "6" }, { "input": "2 2", "output": "1" }, { "input": "2 3", "output": "2" }, { "input": "2 4", "output": "2" }, { "input": "2 5", "output": "3" }, { "input": "2 6", "output": "3" }, { "input": "2 7", "output": "4" }, { "input": "2 8", "output": "4" }, { "input": "2 9", "output": "4" }, { "input": "2 10", "output": "4" }, { "input": "3 3", "output": "1" }, { "input": "3 4", "output": "1" }, { "input": "3 5", "output": "2" }, { "input": "3 6", "output": "2" }, { "input": "3 7", "output": "3" }, { "input": "3 8", "output": "3" }, { "input": "3 9", "output": "3" }, { "input": "3 10", "output": "3" }, { "input": "4 4", "output": "1" }, { "input": "4 5", "output": "1" }, { "input": "4 6", "output": "2" }, { "input": "4 7", "output": "2" }, { "input": "4 8", "output": "2" }, { "input": "4 9", "output": "3" }, { "input": "4 10", "output": "3" }, { "input": "5 5", "output": "1" }, { "input": "5 6", "output": "1" }, { "input": "5 7", "output": "1" }, { "input": "5 8", "output": "2" }, { "input": "5 9", "output": "2" }, { "input": "5 10", "output": "2" }, { "input": "6 6", "output": "1" }, { "input": "6 7", "output": "1" }, { "input": "6 8", "output": "1" }, { "input": "6 9", "output": "2" }, { "input": "6 10", "output": "2" }, { "input": "7 7", "output": "1" }, { "input": "7 8", "output": "1" }, { "input": "7 9", "output": "1" }, { "input": "7 10", "output": "1" }, { "input": "8 8", "output": "1" }, { "input": "8 9", "output": "1" }, { "input": "8 10", "output": "1" }, { "input": "9 9", "output": "1" }, { "input": "9 10", "output": "1" }, { "input": "10 10", "output": "1" }, { "input": "10 10", "output": "1" }, { "input": "1 2", "output": "2" } ]
1,697,009,607
2,147,483,647
PyPy 3-64
OK
TESTS
62
77
0
def solve(): a,b = list(map(int,input().split())) res = 0 while a <= b: a*=3 b*=2 res+=1 return res print(solve())
Title: Bear and Big Brother Time Limit: None seconds Memory Limit: None megabytes Problem Description: Bear Limak wants to become the largest of bears, or at least to become larger than his brother Bob. Right now, Limak and Bob weigh *a* and *b* respectively. It's guaranteed that Limak's weight is smaller than or equal to his brother's weight. Limak eats a lot and his weight is tripled after every year, while Bob's weight is doubled after every year. After how many full years will Limak become strictly larger (strictly heavier) than Bob? Input Specification: The only line of the input contains two integers *a* and *b* (1<=≀<=*a*<=≀<=*b*<=≀<=10)Β β€” the weight of Limak and the weight of Bob respectively. Output Specification: Print one integer, denoting the integer number of years after which Limak will become strictly larger than Bob. Demo Input: ['4 7\n', '4 9\n', '1 1\n'] Demo Output: ['2\n', '3\n', '1\n'] Note: In the first sample, Limak weighs 4 and Bob weighs 7 initially. After one year their weights are 4Β·3 = 12 and 7Β·2 = 14 respectively (one weight is tripled while the other one is doubled). Limak isn't larger than Bob yet. After the second year weights are 36 and 28, so the first weight is greater than the second one. Limak became larger than Bob after two years so you should print 2. In the second sample, Limak's and Bob's weights in next years are: 12 and 18, then 36 and 36, and finally 108 and 72 (after three years). The answer is 3. Remember that Limak wants to be larger than Bob and he won't be satisfied with equal weights. In the third sample, Limak becomes larger than Bob after the first year. Their weights will be 3 and 2 then.
```python def solve(): a,b = list(map(int,input().split())) res = 0 while a <= b: a*=3 b*=2 res+=1 return res print(solve()) ```
3
546
A
Soldier and Bananas
PROGRAMMING
800
[ "brute force", "implementation", "math" ]
null
null
A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*Β·*k* dollars for the *i*-th banana). He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas?
The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=≀<=<=*k*,<=*w*<=<=≀<=<=1000, 0<=≀<=*n*<=≀<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants.
Output one integer β€” the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0.
[ "3 17 4\n" ]
[ "13" ]
none
500
[ { "input": "3 17 4", "output": "13" }, { "input": "1 2 1", "output": "0" }, { "input": "1 1 1", "output": "0" }, { "input": "1 5 6", "output": "16" }, { "input": "1 1000000000 1", "output": "0" }, { "input": "1000 0 1000", "output": "500500000" }, { "input": "859 453892 543", "output": "126416972" }, { "input": "1000 1000000000 1000", "output": "0" }, { "input": "1000 500500000 1000", "output": "0" }, { "input": "1000 500500001 1000", "output": "0" }, { "input": "1000 500499999 1000", "output": "1" }, { "input": "634 87973 214", "output": "14497197" }, { "input": "432 10000 241", "output": "12587552" }, { "input": "111 111111111 111", "output": "0" }, { "input": "20 43 3", "output": "77" } ]
1,696,361,962
2,147,483,647
Python 3
OK
TESTS
15
46
0
k,n,w=list(map(int,input().split())) c=0 for i in range(1,w+1): c+=i*k a=c-n if a>0: print(a) else: print("0")
Title: Soldier and Bananas Time Limit: None seconds Memory Limit: None megabytes Problem Description: A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*Β·*k* dollars for the *i*-th banana). He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas? Input Specification: The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=≀<=<=*k*,<=*w*<=<=≀<=<=1000, 0<=≀<=*n*<=≀<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants. Output Specification: Output one integer β€” the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0. Demo Input: ['3 17 4\n'] Demo Output: ['13'] Note: none
```python k,n,w=list(map(int,input().split())) c=0 for i in range(1,w+1): c+=i*k a=c-n if a>0: print(a) else: print("0") ```
3
818
A
Diplomas and Certificates
PROGRAMMING
800
[ "implementation", "math" ]
null
null
There are *n* students who have taken part in an olympiad. Now it's time to award the students. Some of them will receive diplomas, some wiil get certificates, and others won't receive anything. Students with diplomas and certificates are called winners. But there are some rules of counting the number of diplomas and certificates. The number of certificates must be exactly *k* times greater than the number of diplomas. The number of winners must not be greater than half of the number of all students (i.e. not be greater than half of *n*). It's possible that there are no winners. You have to identify the maximum possible number of winners, according to these rules. Also for this case you have to calculate the number of students with diplomas, the number of students with certificates and the number of students who are not winners.
The first (and the only) line of input contains two integers *n* and *k* (1<=≀<=*n*,<=*k*<=≀<=1012), where *n* is the number of students and *k* is the ratio between the number of certificates and the number of diplomas.
Output three numbers: the number of students with diplomas, the number of students with certificates and the number of students who are not winners in case when the number of winners is maximum possible. It's possible that there are no winners.
[ "18 2\n", "9 10\n", "1000000000000 5\n", "1000000000000 499999999999\n" ]
[ "3 6 9\n", "0 0 9\n", "83333333333 416666666665 500000000002\n", "1 499999999999 500000000000\n" ]
none
0
[ { "input": "18 2", "output": "3 6 9" }, { "input": "9 10", "output": "0 0 9" }, { "input": "1000000000000 5", "output": "83333333333 416666666665 500000000002" }, { "input": "1000000000000 499999999999", "output": "1 499999999999 500000000000" }, { "input": "1 1", "output": "0 0 1" }, { "input": "5 3", "output": "0 0 5" }, { "input": "42 6", "output": "3 18 21" }, { "input": "1000000000000 1000", "output": "499500499 499500499000 500000000501" }, { "input": "999999999999 999999", "output": "499999 499998500001 500000999999" }, { "input": "732577309725 132613", "output": "2762066 366285858458 366288689201" }, { "input": "152326362626 15", "output": "4760198832 71402982480 76163181314" }, { "input": "2 1", "output": "0 0 2" }, { "input": "1000000000000 500000000000", "output": "0 0 1000000000000" }, { "input": "100000000000 50000000011", "output": "0 0 100000000000" }, { "input": "1000000000000 32416187567", "output": "15 486242813505 513757186480" }, { "input": "1000000000000 7777777777", "output": "64 497777777728 502222222208" }, { "input": "1000000000000 77777777777", "output": "6 466666666662 533333333332" }, { "input": "100000000000 578485652", "output": "86 49749766072 50250233842" }, { "input": "999999999999 10000000000", "output": "49 490000000000 509999999950" }, { "input": "7 2", "output": "1 2 4" }, { "input": "420506530901 752346673804", "output": "0 0 420506530901" }, { "input": "960375521135 321688347872", "output": "1 321688347872 638687173262" }, { "input": "1000000000000 1000000000000", "output": "0 0 1000000000000" }, { "input": "99999999999 15253636363", "output": "3 45760909089 54239090907" }, { "input": "19 2", "output": "3 6 10" }, { "input": "999999999999 1000000000000", "output": "0 0 999999999999" }, { "input": "1000000000000 5915587276", "output": "84 496909331184 503090668732" }, { "input": "1000000000000 1000000006", "output": "499 499000002994 500999996507" }, { "input": "549755813888 134217728", "output": "2047 274743689216 275012122625" }, { "input": "99999999999 3333333", "output": "14999 49996661667 50003323333" }, { "input": "9 1", "output": "2 2 5" }, { "input": "1000000000000 250000000001", "output": "1 250000000001 749999999998" }, { "input": "5 1", "output": "1 1 3" }, { "input": "3107038133 596040207", "output": "2 1192080414 1914957717" }, { "input": "1000000000000 73786977", "output": "6776 499980556152 500019437072" }, { "input": "1000000000000 73786976", "output": "6776 499980549376 500019443848" }, { "input": "1000000000000 25000000000", "output": "19 475000000000 524999999981" }, { "input": "216929598879 768233755932", "output": "0 0 216929598879" }, { "input": "1000000000000 250000000000", "output": "1 250000000000 749999999999" }, { "input": "1000000000000 100000000001", "output": "4 400000000004 599999999992" }, { "input": "100000000000 100000000001", "output": "0 0 100000000000" }, { "input": "900000000000 100281800001", "output": "4 401127200004 498872799992" }, { "input": "906028900004 109123020071", "output": "4 436492080284 469536819716" }, { "input": "1000000000000 1", "output": "250000000000 250000000000 500000000000" } ]
1,498,750,117
1,417
Python 3
OK
TESTS
44
77
5,529,600
n, k = input().split() n, k = int(n), int(k) lo, hi = 0, n // (k + 1) while lo < hi: mid = (lo + hi + 1) // 2 if mid * (k + 1) > n // 2: hi = mid - 1 else: lo = mid print(lo, lo * k, n - lo * (k + 1))
Title: Diplomas and Certificates Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are *n* students who have taken part in an olympiad. Now it's time to award the students. Some of them will receive diplomas, some wiil get certificates, and others won't receive anything. Students with diplomas and certificates are called winners. But there are some rules of counting the number of diplomas and certificates. The number of certificates must be exactly *k* times greater than the number of diplomas. The number of winners must not be greater than half of the number of all students (i.e. not be greater than half of *n*). It's possible that there are no winners. You have to identify the maximum possible number of winners, according to these rules. Also for this case you have to calculate the number of students with diplomas, the number of students with certificates and the number of students who are not winners. Input Specification: The first (and the only) line of input contains two integers *n* and *k* (1<=≀<=*n*,<=*k*<=≀<=1012), where *n* is the number of students and *k* is the ratio between the number of certificates and the number of diplomas. Output Specification: Output three numbers: the number of students with diplomas, the number of students with certificates and the number of students who are not winners in case when the number of winners is maximum possible. It's possible that there are no winners. Demo Input: ['18 2\n', '9 10\n', '1000000000000 5\n', '1000000000000 499999999999\n'] Demo Output: ['3 6 9\n', '0 0 9\n', '83333333333 416666666665 500000000002\n', '1 499999999999 500000000000\n'] Note: none
```python n, k = input().split() n, k = int(n), int(k) lo, hi = 0, n // (k + 1) while lo < hi: mid = (lo + hi + 1) // 2 if mid * (k + 1) > n // 2: hi = mid - 1 else: lo = mid print(lo, lo * k, n - lo * (k + 1)) ```
3
169
A
Chores
PROGRAMMING
800
[ "sortings" ]
null
null
Petya and Vasya are brothers. Today is a special day for them as their parents left them home alone and commissioned them to do *n* chores. Each chore is characterized by a single parameter β€” its complexity. The complexity of the *i*-th chore equals *h**i*. As Petya is older, he wants to take the chores with complexity larger than some value *x* (*h**i*<=&gt;<=*x*) to leave to Vasya the chores with complexity less than or equal to *x* (*h**i*<=≀<=*x*). The brothers have already decided that Petya will do exactly *a* chores and Vasya will do exactly *b* chores (*a*<=+<=*b*<==<=*n*). In how many ways can they choose an integer *x* so that Petya got exactly *a* chores and Vasya got exactly *b* chores?
The first input line contains three integers *n*,<=*a* and *b* (2<=≀<=*n*<=≀<=2000; *a*,<=*b*<=β‰₯<=1; *a*<=+<=*b*<==<=*n*) β€” the total number of chores, the number of Petya's chores and the number of Vasya's chores. The next line contains a sequence of integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≀<=*h**i*<=≀<=109), *h**i* is the complexity of the *i*-th chore. The numbers in the given sequence are not necessarily different. All numbers on the lines are separated by single spaces.
Print the required number of ways to choose an integer value of *x*. If there are no such ways, print 0.
[ "5 2 3\n6 2 3 100 1\n", "7 3 4\n1 1 9 1 1 1 1\n" ]
[ "3\n", "0\n" ]
In the first sample the possible values of *x* are 3, 4 or 5. In the second sample it is impossible to find such *x*, that Petya got 3 chores and Vasya got 4.
500
[ { "input": "5 2 3\n6 2 3 100 1", "output": "3" }, { "input": "7 3 4\n1 1 9 1 1 1 1", "output": "0" }, { "input": "2 1 1\n10 2", "output": "8" }, { "input": "2 1 1\n7 7", "output": "0" }, { "input": "2 1 1\n1 1000000000", "output": "999999999" }, { "input": "3 1 2\n6 5 5", "output": "1" }, { "input": "3 2 1\n10 10 8", "output": "2" }, { "input": "8 3 5\n42 55 61 72 83 10 22 33", "output": "6" }, { "input": "10 5 5\n1 2 3 4 5 999999999 999999998 999999997 999999996 999999995", "output": "999999990" }, { "input": "4 1 3\n10 8 7 3", "output": "2" }, { "input": "4 2 2\n402 10 10 402", "output": "392" }, { "input": "4 1 3\n10 402 402 10", "output": "0" }, { "input": "4 3 1\n100 100 200 200", "output": "0" }, { "input": "150 10 140\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" }, { "input": "102 101 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "0" } ]
1,697,781,105
2,147,483,647
PyPy 3
OK
TESTS
29
93
1,228,800
from sys import stdin, stdout n, a, b = map(int, stdin.readline().split()) H = list(map(int, stdin.readline().split())) H.sort() hardest_for_vasya = H[b-1] easiest_for_petya = H[b] ans = easiest_for_petya - hardest_for_vasya stdout.write(str(ans)) if ans > 0 else stdout.write(str(ans))
Title: Chores Time Limit: None seconds Memory Limit: None megabytes Problem Description: Petya and Vasya are brothers. Today is a special day for them as their parents left them home alone and commissioned them to do *n* chores. Each chore is characterized by a single parameter β€” its complexity. The complexity of the *i*-th chore equals *h**i*. As Petya is older, he wants to take the chores with complexity larger than some value *x* (*h**i*<=&gt;<=*x*) to leave to Vasya the chores with complexity less than or equal to *x* (*h**i*<=≀<=*x*). The brothers have already decided that Petya will do exactly *a* chores and Vasya will do exactly *b* chores (*a*<=+<=*b*<==<=*n*). In how many ways can they choose an integer *x* so that Petya got exactly *a* chores and Vasya got exactly *b* chores? Input Specification: The first input line contains three integers *n*,<=*a* and *b* (2<=≀<=*n*<=≀<=2000; *a*,<=*b*<=β‰₯<=1; *a*<=+<=*b*<==<=*n*) β€” the total number of chores, the number of Petya's chores and the number of Vasya's chores. The next line contains a sequence of integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≀<=*h**i*<=≀<=109), *h**i* is the complexity of the *i*-th chore. The numbers in the given sequence are not necessarily different. All numbers on the lines are separated by single spaces. Output Specification: Print the required number of ways to choose an integer value of *x*. If there are no such ways, print 0. Demo Input: ['5 2 3\n6 2 3 100 1\n', '7 3 4\n1 1 9 1 1 1 1\n'] Demo Output: ['3\n', '0\n'] Note: In the first sample the possible values of *x* are 3, 4 or 5. In the second sample it is impossible to find such *x*, that Petya got 3 chores and Vasya got 4.
```python from sys import stdin, stdout n, a, b = map(int, stdin.readline().split()) H = list(map(int, stdin.readline().split())) H.sort() hardest_for_vasya = H[b-1] easiest_for_petya = H[b] ans = easiest_for_petya - hardest_for_vasya stdout.write(str(ans)) if ans > 0 else stdout.write(str(ans)) ```
3
992
A
Nastya and an Array
PROGRAMMING
800
[ "implementation", "sortings" ]
null
null
Nastya owns too many arrays now, so she wants to delete the least important of them. However, she discovered that this array is magic! Nastya now knows that the array has the following properties: - In one second we can add an arbitrary (possibly negative) integer to all elements of the array that are not equal to zero. - When all elements of the array become equal to zero, the array explodes. Nastya is always busy, so she wants to explode the array as fast as possible. Compute the minimum time in which the array can be exploded.
The first line contains a single integer *n* (1<=≀<=*n*<=≀<=105) β€” the size of the array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=105<=≀<=*a**i*<=≀<=105) β€” the elements of the array.
Print a single integer β€” the minimum number of seconds needed to make all elements of the array equal to zero.
[ "5\n1 1 1 1 1\n", "3\n2 0 -1\n", "4\n5 -6 -5 1\n" ]
[ "1\n", "2\n", "4\n" ]
In the first example you can add  - 1 to all non-zero elements in one second and make them equal to zero. In the second example you can add  - 2 on the first second, then the array becomes equal to [0, 0,  - 3]. On the second second you can add 3 to the third (the only non-zero) element.
500
[ { "input": "5\n1 1 1 1 1", "output": "1" }, { "input": "3\n2 0 -1", "output": "2" }, { "input": "4\n5 -6 -5 1", "output": "4" }, { "input": "1\n0", "output": "0" }, { "input": "2\n21794 -79194", "output": "2" }, { "input": "3\n-63526 95085 -5239", "output": "3" }, { "input": "3\n0 53372 -20572", "output": "2" }, { "input": "13\n-2075 -32242 27034 -37618 -96962 82203 64846 48249 -71761 28908 -21222 -61370 46899", "output": "13" }, { "input": "5\n806 0 1308 1954 683", "output": "4" }, { "input": "8\n-26 0 -249 -289 -126 -206 288 -11", "output": "7" }, { "input": "10\n2 2 2 1 2 -1 0 2 -1 1", "output": "3" }, { "input": "1\n8", "output": "1" }, { "input": "3\n0 0 0", "output": "0" }, { "input": "10\n1 2 3 4 5 6 7 8 9 10", "output": "10" }, { "input": "5\n2 0 -1 0 0", "output": "2" }, { "input": "2\n0 0", "output": "0" }, { "input": "5\n0 0 0 0 0", "output": "0" }, { "input": "2\n1 0", "output": "1" }, { "input": "2\n-1 0", "output": "1" }, { "input": "4\n0 0 0 0", "output": "0" }, { "input": "8\n10 9 -1 0 0 3 2 3", "output": "5" }, { "input": "5\n5 0 1 2 3", "output": "4" }, { "input": "3\n1 1 0", "output": "1" }, { "input": "1\n-1", "output": "1" }, { "input": "5\n1 2 0 0 0", "output": "2" }, { "input": "5\n1 0 0 0 0", "output": "1" }, { "input": "5\n4 5 6 0 0", "output": "3" }, { "input": "4\n-1 0 0 1", "output": "2" }, { "input": "5\n3 0 0 4 5", "output": "3" }, { "input": "3\n0 0 2", "output": "1" }, { "input": "3\n1 0 0", "output": "1" }, { "input": "4\n0 0 0 4", "output": "1" }, { "input": "5\n-1 0 0 0 0", "output": "1" }, { "input": "2\n0 1", "output": "1" }, { "input": "3\n1 2 3", "output": "3" }, { "input": "1\n5", "output": "1" }, { "input": "10\n0 0 0 0 0 1 2 3 0 0", "output": "3" }, { "input": "4\n0 1 2 3", "output": "3" }, { "input": "3\n0 1 2", "output": "2" }, { "input": "4\n2 0 0 -1", "output": "2" } ]
1,590,996,775
2,147,483,647
PyPy 3
OK
TESTS
79
218
13,004,800
n=(int)(input()) l=list(map(int,input().split())) c=0 for i in range(n): if l[i]==0: c+=1 if c>1: c=1 print(len(set(l))-c)
Title: Nastya and an Array Time Limit: None seconds Memory Limit: None megabytes Problem Description: Nastya owns too many arrays now, so she wants to delete the least important of them. However, she discovered that this array is magic! Nastya now knows that the array has the following properties: - In one second we can add an arbitrary (possibly negative) integer to all elements of the array that are not equal to zero. - When all elements of the array become equal to zero, the array explodes. Nastya is always busy, so she wants to explode the array as fast as possible. Compute the minimum time in which the array can be exploded. Input Specification: The first line contains a single integer *n* (1<=≀<=*n*<=≀<=105) β€” the size of the array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=105<=≀<=*a**i*<=≀<=105) β€” the elements of the array. Output Specification: Print a single integer β€” the minimum number of seconds needed to make all elements of the array equal to zero. Demo Input: ['5\n1 1 1 1 1\n', '3\n2 0 -1\n', '4\n5 -6 -5 1\n'] Demo Output: ['1\n', '2\n', '4\n'] Note: In the first example you can add  - 1 to all non-zero elements in one second and make them equal to zero. In the second example you can add  - 2 on the first second, then the array becomes equal to [0, 0,  - 3]. On the second second you can add 3 to the third (the only non-zero) element.
```python n=(int)(input()) l=list(map(int,input().split())) c=0 for i in range(n): if l[i]==0: c+=1 if c>1: c=1 print(len(set(l))-c) ```
3
785
A
Anton and Polyhedrons
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons: - Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces. All five kinds of polyhedrons are shown on the picture below: Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number!
The first line of the input contains a single integer *n* (1<=≀<=*n*<=≀<=200<=000)Β β€” the number of polyhedrons in Anton's collection. Each of the following *n* lines of the input contains a string *s**i*Β β€” the name of the *i*-th polyhedron in Anton's collection. The string can look like this: - "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron.
Output one numberΒ β€” the total number of faces in all the polyhedrons in Anton's collection.
[ "4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n", "3\nDodecahedron\nOctahedron\nOctahedron\n" ]
[ "42\n", "28\n" ]
In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces.
500
[ { "input": "4\nIcosahedron\nCube\nTetrahedron\nDodecahedron", "output": "42" }, { "input": "3\nDodecahedron\nOctahedron\nOctahedron", "output": "28" }, { "input": "25\nIcosahedron\nOctahedron\nTetrahedron\nDodecahedron\nCube\nIcosahedron\nOctahedron\nCube\nTetrahedron\nIcosahedron\nIcosahedron\nTetrahedron\nOctahedron\nDodecahedron\nIcosahedron\nOctahedron\nIcosahedron\nTetrahedron\nDodecahedron\nTetrahedron\nOctahedron\nCube\nCube\nDodecahedron\nTetrahedron", "output": "256" }, { "input": "1\nTetrahedron", "output": "4" }, { "input": "1\nCube", "output": "6" }, { "input": "1\nOctahedron", "output": "8" }, { "input": "1\nDodecahedron", "output": "12" }, { "input": "1\nIcosahedron", "output": "20" }, { "input": "28\nOctahedron\nDodecahedron\nOctahedron\nOctahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nDodecahedron\nDodecahedron\nCube\nDodecahedron\nCube\nTetrahedron\nCube\nCube\nTetrahedron\nDodecahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nIcosahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron", "output": "340" } ]
1,689,607,029
2,147,483,647
Python 3
OK
TESTS
30
187
0
n = int(input()) check = {'Tetrahedron': 4,'Cube':6,'Octahedron':8,'Dodecahedron':12,'Icosahedron':20} res = 0 for i in range(n): res += check[input()] print(res)
Title: Anton and Polyhedrons Time Limit: None seconds Memory Limit: None megabytes Problem Description: Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons: - Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces. All five kinds of polyhedrons are shown on the picture below: Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number! Input Specification: The first line of the input contains a single integer *n* (1<=≀<=*n*<=≀<=200<=000)Β β€” the number of polyhedrons in Anton's collection. Each of the following *n* lines of the input contains a string *s**i*Β β€” the name of the *i*-th polyhedron in Anton's collection. The string can look like this: - "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron. Output Specification: Output one numberΒ β€” the total number of faces in all the polyhedrons in Anton's collection. Demo Input: ['4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n', '3\nDodecahedron\nOctahedron\nOctahedron\n'] Demo Output: ['42\n', '28\n'] Note: In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces.
```python n = int(input()) check = {'Tetrahedron': 4,'Cube':6,'Octahedron':8,'Dodecahedron':12,'Icosahedron':20} res = 0 for i in range(n): res += check[input()] print(res) ```
3
25
B
Phone numbers
PROGRAMMING
1,100
[ "implementation" ]
B. Phone numbers
2
256
Phone number in Berland is a sequence of *n* digits. Often, to make it easier to memorize the number, it is divided into groups of two or three digits. For example, the phone number 1198733 is easier to remember as 11-987-33. Your task is to find for a given phone number any of its divisions into groups of two or three digits.
The first line contains integer *n* (2<=≀<=*n*<=≀<=100) β€” amount of digits in the phone number. The second line contains *n* digits β€” the phone number to divide into groups.
Output any of divisions of the given phone number into groups of two or three digits. Separate groups by single character -. If the answer is not unique, output any.
[ "6\n549871\n", "7\n1198733\n" ]
[ "54-98-71", "11-987-33\n" ]
none
0
[ { "input": "6\n549871", "output": "54-98-71" }, { "input": "7\n1198733", "output": "119-87-33" }, { "input": "2\n74", "output": "74" }, { "input": "2\n33", "output": "33" }, { "input": "3\n074", "output": "074" }, { "input": "3\n081", "output": "081" }, { "input": "4\n3811", "output": "38-11" }, { "input": "5\n21583", "output": "215-83" }, { "input": "8\n33408349", "output": "33-40-83-49" }, { "input": "9\n988808426", "output": "988-80-84-26" }, { "input": "10\n0180990956", "output": "01-80-99-09-56" }, { "input": "15\n433488906230138", "output": "433-48-89-06-23-01-38" }, { "input": "22\n7135498415686025907059", "output": "71-35-49-84-15-68-60-25-90-70-59" }, { "input": "49\n2429965524999668169991253653390090510755018570235", "output": "242-99-65-52-49-99-66-81-69-99-12-53-65-33-90-09-05-10-75-50-18-57-02-35" }, { "input": "72\n491925337784111770500147619881727525570039735507439360627744863794794290", "output": "49-19-25-33-77-84-11-17-70-50-01-47-61-98-81-72-75-25-57-00-39-73-55-07-43-93-60-62-77-44-86-37-94-79-42-90" }, { "input": "95\n32543414456047900690980198395035321172843693417425457554204776648220562494524275489599199209210", "output": "325-43-41-44-56-04-79-00-69-09-80-19-83-95-03-53-21-17-28-43-69-34-17-42-54-57-55-42-04-77-66-48-22-05-62-49-45-24-27-54-89-59-91-99-20-92-10" }, { "input": "97\n9362344595153688016434451101547661156123505108492010669557671355055642365998461003851354321478898", "output": "936-23-44-59-51-53-68-80-16-43-44-51-10-15-47-66-11-56-12-35-05-10-84-92-01-06-69-55-76-71-35-50-55-64-23-65-99-84-61-00-38-51-35-43-21-47-88-98" }, { "input": "98\n65521815795893886057122984634320900545031770769333931308009346017867969790810907868670369236928568", "output": "65-52-18-15-79-58-93-88-60-57-12-29-84-63-43-20-90-05-45-03-17-70-76-93-33-93-13-08-00-93-46-01-78-67-96-97-90-81-09-07-86-86-70-36-92-36-92-85-68" }, { "input": "99\n455213856470326729480192345541970106407563996625458559297407682539801838244443866898560852503660390", "output": "455-21-38-56-47-03-26-72-94-80-19-23-45-54-19-70-10-64-07-56-39-96-62-54-58-55-92-97-40-76-82-53-98-01-83-82-44-44-38-66-89-85-60-85-25-03-66-03-90" }, { "input": "100\n4004223124942730640235383244438257614581534320356060987241659784249551110165034719443327659510644224", "output": "40-04-22-31-24-94-27-30-64-02-35-38-32-44-43-82-57-61-45-81-53-43-20-35-60-60-98-72-41-65-97-84-24-95-51-11-01-65-03-47-19-44-33-27-65-95-10-64-42-24" } ]
1,505,568,412
2,147,483,647
Python 3
OK
TESTS
20
124
0
n = int(input()) s = input() for i in range(n): print(s[i], end = '') if (i + 1) % 2 == 0: if n % 2 == 0 and i != n - 1: print('-', end = '') if n % 2 != 0 and i != n - 2: print('-', end = '')
Title: Phone numbers Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Phone number in Berland is a sequence of *n* digits. Often, to make it easier to memorize the number, it is divided into groups of two or three digits. For example, the phone number 1198733 is easier to remember as 11-987-33. Your task is to find for a given phone number any of its divisions into groups of two or three digits. Input Specification: The first line contains integer *n* (2<=≀<=*n*<=≀<=100) β€” amount of digits in the phone number. The second line contains *n* digits β€” the phone number to divide into groups. Output Specification: Output any of divisions of the given phone number into groups of two or three digits. Separate groups by single character -. If the answer is not unique, output any. Demo Input: ['6\n549871\n', '7\n1198733\n'] Demo Output: ['54-98-71', '11-987-33\n'] Note: none
```python n = int(input()) s = input() for i in range(n): print(s[i], end = '') if (i + 1) % 2 == 0: if n % 2 == 0 and i != n - 1: print('-', end = '') if n % 2 != 0 and i != n - 2: print('-', end = '') ```
3.969
1,003
A
Polycarp's Pockets
PROGRAMMING
800
[ "implementation" ]
null
null
Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. Polycarp wants to distribute all the coins between his pockets, but he cannot put two coins with the same value into the same pocket. For example, if Polycarp has got six coins represented as an array $a = [1, 2, 4, 3, 3, 2]$, he can distribute the coins into two pockets as follows: $[1, 2, 3], [2, 3, 4]$. Polycarp wants to distribute all the coins with the minimum number of used pockets. Help him to do that.
The first line of the input contains one integer $n$ ($1 \le n \le 100$) β€” the number of coins. The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$) β€” values of coins.
Print only one integer β€” the minimum number of pockets Polycarp needs to distribute all the coins so no two coins with the same value are put into the same pocket.
[ "6\n1 2 4 3 3 2\n", "1\n100\n" ]
[ "2\n", "1\n" ]
none
0
[ { "input": "6\n1 2 4 3 3 2", "output": "2" }, { "input": "1\n100", "output": "1" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "100" }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "100" }, { "input": "100\n59 47 39 47 47 71 47 28 58 47 35 79 58 47 38 47 47 47 47 27 47 43 29 95 47 49 46 71 47 74 79 47 47 32 45 67 47 47 30 37 47 47 16 67 22 76 47 86 84 10 5 47 47 47 47 47 1 51 47 54 47 8 47 47 9 47 47 47 47 28 47 47 26 47 47 47 47 47 47 92 47 47 77 47 47 24 45 47 10 47 47 89 47 27 47 89 47 67 24 71", "output": "51" }, { "input": "100\n45 99 10 27 16 85 39 38 17 32 15 23 67 48 50 97 42 70 62 30 44 81 64 73 34 22 46 5 83 52 58 60 33 74 47 88 18 61 78 53 25 95 94 31 3 75 1 57 20 54 59 9 68 7 77 43 21 87 86 24 4 80 11 49 2 72 36 84 71 8 65 55 79 100 41 14 35 89 66 69 93 37 56 82 90 91 51 19 26 92 6 96 13 98 12 28 76 40 63 29", "output": "1" }, { "input": "100\n45 29 5 2 6 50 22 36 14 15 9 48 46 20 8 37 7 47 12 50 21 38 18 27 33 19 40 10 5 49 38 42 34 37 27 30 35 24 10 3 40 49 41 3 4 44 13 25 28 31 46 36 23 1 1 23 7 22 35 26 21 16 48 42 32 8 11 16 34 11 39 32 47 28 43 41 39 4 14 19 26 45 13 18 15 25 2 44 17 29 17 33 43 6 12 30 9 20 31 24", "output": "2" }, { "input": "50\n7 7 3 3 7 4 5 6 4 3 7 5 6 4 5 4 4 5 6 7 7 7 4 5 5 5 3 7 6 3 4 6 3 6 4 4 5 4 6 6 3 5 6 3 5 3 3 7 7 6", "output": "10" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "99" }, { "input": "7\n1 2 3 3 3 1 2", "output": "3" }, { "input": "5\n1 2 3 4 5", "output": "1" }, { "input": "7\n1 2 3 4 5 6 7", "output": "1" }, { "input": "8\n1 2 3 4 5 6 7 8", "output": "1" }, { "input": "9\n1 2 3 4 5 6 7 8 9", "output": "1" }, { "input": "10\n1 2 3 4 5 6 7 8 9 10", "output": "1" }, { "input": "3\n2 1 1", "output": "2" }, { "input": "11\n1 2 3 4 5 6 7 8 9 1 1", "output": "3" }, { "input": "12\n1 2 1 1 1 1 1 1 1 1 1 1", "output": "11" }, { "input": "13\n1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "13" }, { "input": "14\n1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "14" }, { "input": "15\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "15" }, { "input": "16\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "16" }, { "input": "3\n1 1 1", "output": "3" }, { "input": "3\n1 2 3", "output": "1" }, { "input": "10\n1 1 1 1 2 2 1 1 9 10", "output": "6" }, { "input": "2\n1 1", "output": "2" }, { "input": "56\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "56" }, { "input": "99\n35 96 73 72 70 83 22 93 98 75 45 32 81 82 45 54 25 7 53 72 29 2 94 19 21 98 34 28 39 99 55 85 44 23 6 47 98 2 33 34 19 57 49 35 67 4 60 4 4 23 55 6 57 66 16 68 34 45 84 79 48 63 4 9 46 88 98 13 19 27 83 12 4 63 57 22 44 77 44 62 28 52 44 64 9 24 55 22 48 4 2 9 80 76 45 1 56 22 92", "output": "6" }, { "input": "10\n1 2 2 3 3 3 4 4 4 4", "output": "4" }, { "input": "99\n97 44 33 56 42 10 61 85 64 26 40 39 82 34 75 9 51 51 39 73 58 38 74 31 13 99 58 1 28 89 76 19 52 7 40 56 12 27 72 72 67 75 62 46 22 55 35 16 18 39 60 63 92 42 85 69 34 61 73 50 57 95 30 4 45 63 76 58 32 35 48 81 10 78 95 79 55 97 21 21 22 94 30 17 78 57 89 93 100 44 16 89 68 55 19 46 42 73 21", "output": "3" }, { "input": "5\n5 5 5 5 1", "output": "4" }, { "input": "6\n2 3 2 5 2 6", "output": "3" }, { "input": "3\n58 59 58", "output": "2" }, { "input": "9\n1 2 3 4 5 6 7 8 8", "output": "2" }, { "input": "97\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "97" }, { "input": "3\n95 95 4", "output": "2" }, { "input": "3\n2 2 5", "output": "2" } ]
1,618,927,959
2,147,483,647
Python 3
OK
TESTS
37
77
0
n=int(input()) x=[int(w) for w in input().split()] a=0 m=[] for i in set(x): m.append(x.count(i)) print(max(m))
Title: Polycarp's Pockets Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. Polycarp wants to distribute all the coins between his pockets, but he cannot put two coins with the same value into the same pocket. For example, if Polycarp has got six coins represented as an array $a = [1, 2, 4, 3, 3, 2]$, he can distribute the coins into two pockets as follows: $[1, 2, 3], [2, 3, 4]$. Polycarp wants to distribute all the coins with the minimum number of used pockets. Help him to do that. Input Specification: The first line of the input contains one integer $n$ ($1 \le n \le 100$) β€” the number of coins. The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$) β€” values of coins. Output Specification: Print only one integer β€” the minimum number of pockets Polycarp needs to distribute all the coins so no two coins with the same value are put into the same pocket. Demo Input: ['6\n1 2 4 3 3 2\n', '1\n100\n'] Demo Output: ['2\n', '1\n'] Note: none
```python n=int(input()) x=[int(w) for w in input().split()] a=0 m=[] for i in set(x): m.append(x.count(i)) print(max(m)) ```
3
176
B
Word Cut
PROGRAMMING
1,700
[ "dp" ]
null
null
Let's consider one interesting word game. In this game you should transform one word into another through special operations. Let's say we have word *w*, let's split this word into two non-empty parts *x* and *y* so, that *w*<==<=*xy*. A split operation is transforming word *w*<==<=*xy* into word *u*<==<=*yx*. For example, a split operation can transform word "wordcut" into word "cutword". You are given two words *start* and *end*. Count in how many ways we can transform word *start* into word *end*, if we apply exactly *k* split operations consecutively to word *start*. Two ways are considered different if the sequences of applied operations differ. Two operation sequences are different if exists such number *i* (1<=≀<=*i*<=≀<=*k*), that in the *i*-th operation of the first sequence the word splits into parts *x* and *y*, in the *i*-th operation of the second sequence the word splits into parts *a* and *b*, and additionally *x*<=β‰ <=*a* holds.
The first line contains a non-empty word *start*, the second line contains a non-empty word *end*. The words consist of lowercase Latin letters. The number of letters in word *start* equals the number of letters in word *end* and is at least 2 and doesn't exceed 1000 letters. The third line contains integer *k* (0<=≀<=*k*<=≀<=105) β€” the required number of operations.
Print a single number β€” the answer to the problem. As this number can be rather large, print it modulo 1000000007 (109<=+<=7).
[ "ab\nab\n2\n", "ababab\nababab\n1\n", "ab\nba\n2\n" ]
[ "1\n", "2\n", "0\n" ]
The sought way in the first sample is: ab  →  a|b  →  ba  →  b|a  →  ab In the second sample the two sought ways are: - ababab  →  abab|ab  →  ababab - ababab  →  ab|abab  →  ababab
1,000
[ { "input": "ab\nab\n2", "output": "1" }, { "input": "ababab\nababab\n1", "output": "2" }, { "input": "ab\nba\n2", "output": "0" }, { "input": "aaa\naaa\n0", "output": "1" }, { "input": "hi\nhi\n1", "output": "0" }, { "input": "abcd\ncbad\n5", "output": "0" }, { "input": "ab\nba\n10", "output": "0" }, { "input": "voodoo\ndoovoo\n100000", "output": "792428974" }, { "input": "ababab\nbababa\n100000", "output": "377286908" }, { "input": "abcdefgh\ncdefghab\n666", "output": "83913683" }, { "input": "aaaabaaaaaaaaaaabaaaaaaa\naaaaaaaaaabaaaaaaaaabaaa\n7477", "output": "0" }, { "input": "ssgqcodnqgfbhqsgineioafkkhcmmmihbiefialidgkffrhaiekebpieqgpplmsgmghphjsfgpscrbcgrssbccqroffnfgkfohljdarbpqmkolldcjcfhpodeqmgbdddlgoolesecdqsochdfgjsmorbnmiinjlpda\nljdarbpqmkolldcjcfhpodeqmgbdddlgoolesecdqsochdfgjsmorbnmiinjlpdassgqcodnqgfbhqsgineioafkkhcmmmihbiefialidgkffrhaiekebpieqgpplmsgmghphjsfgpscrbcgrssbccqroffnfgkfoh\n50897", "output": "222669762" }, { "input": "jfemedqrsqaopiekdosgjnhbshanggdqqpkhepjfrkgkshepbmkdnidmpgfojjjbeddkelccoqapnpkqbimlbgagllioqbdgnsejqcbicjbbijjlrjmkkarjdoganmfsmfohlspbsoldfspdacasgsrcndlhg\nhepbmkdnidmpgfojjjbeddkelccoqapnpkqbimlbgagllioqbdgnsejqcbicjbbijjlrjmkkarjdoganmfsmfohlspbsoldfspdacasgsrcndlhgjfemedqrsqaopiekdosgjnhbshanggdqqpkhepjfrkgks\n6178", "output": "568786732" }, { "input": "aaeddddadbcacbdccaeeeddecadbecbbcebdcdbcddcadcadccecccecdbabd\nadbecbbcebdcdbcddcadcadccecccecdbabdaaeddddadbcacbdccaeeeddec\n55400", "output": "471327413" }, { "input": "chajciihijjbjcgaedebdcjaaeaiffiggfdfbdjhikhbiijhbjciebgkadbbekijadafhjhgiidfjkjbgcdfdgjjfficbagghkdgdhdedihifcfkedcefcdfjaagiehccjbjhihcbdakbjfjdgakkfagddhekccbdjhejhakfccgghkdc\ndafhjhgiidfjkjbgcdfdgjjfficbagghkdgdhdedihifcfkedcefcdfjaagiehccjbjhihcbdakbjfjdgakkfagddhekccbdjhejhakfccgghkdcchajciihijjbjcgaedebdcjaaeaiffiggfdfbdjhikhbiijhbjciebgkadbbekija\n67572", "output": "18146811" }, { "input": "dkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjij\ndddkikjjidkkidijjjjkkjjikjdikiidijjikikjijjiijdikkjjjiddjjijkkkjkiijijkijdjjikikdjjjijdddjkjjdijjjjjjjddkjjkjjjdjjdkijjkijkkjkkkiiijdjijkkdjdjjjkkjkdddjidjjijdddkijididjdddidijjjjjdkidijjkkjiijkjjjjjjdjkkdddkjj\n31328", "output": "0" }, { "input": "lnxjsxjjfbrhijshlptgogxstvaybbueilocmaqwhlauulubpwtjtsdktgrowgbkhdotemhstqtxnpspmxjxrqymonnpcvrendrfxbwqxeedyamwvyyytxtmorkovoeklkabyexrfseimlaqlibaoaaeae\nalxckgrkneuqrqstpxormswxsyhaaoebqhfspyqjbxgytrpdoybxmmenllxxrrjtxtvhaoidjmaekiflxykmpnwageytemoewalwihbunbnvomqbututijjvdsbelrxestajokwysctfptalvegdahlboo\n44031", "output": "0" }, { "input": "cfacacbfaeadfdbedfdccdccdddaaa\ncbfaeadfdbedfdccdccdddaaacfaca\n15215", "output": "668863397" }, { "input": "xxx\nyyy\n0", "output": "0" }, { "input": "abc\ncba\n0", "output": "0" }, { "input": "ab\nba\n0", "output": "0" }, { "input": "abc\nabc\n1", "output": "0" }, { "input": "ab\nba\n9", "output": "1" }, { "input": "ab\nba\n10", "output": "0" }, { "input": "aa\naa\n1", "output": "1" }, { "input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\n100000", "output": "486606280" }, { "input": "aaaba\naaaad\n0", "output": "0" } ]
1,687,312,882
2,147,483,647
PyPy 3-64
OK
TESTS
90
124
1,433,600
s = input() t = input() k = int(input()) mod = 10 ** 9 + 7 n = len(s) status1 = 0 status2 = 0 for i in range(n): if s[i:] + s[:i] == t: status1 += 1 else: status2 += 1 dp0, dp1 = (0, 1) if s == t else (1, 0) for _ in range(k): dp0, dp1 = (dp0 + dp1) * status2 % mod - dp0, (dp0 + dp1) * status1 % mod - dp1 print(dp1 % mod)
Title: Word Cut Time Limit: None seconds Memory Limit: None megabytes Problem Description: Let's consider one interesting word game. In this game you should transform one word into another through special operations. Let's say we have word *w*, let's split this word into two non-empty parts *x* and *y* so, that *w*<==<=*xy*. A split operation is transforming word *w*<==<=*xy* into word *u*<==<=*yx*. For example, a split operation can transform word "wordcut" into word "cutword". You are given two words *start* and *end*. Count in how many ways we can transform word *start* into word *end*, if we apply exactly *k* split operations consecutively to word *start*. Two ways are considered different if the sequences of applied operations differ. Two operation sequences are different if exists such number *i* (1<=≀<=*i*<=≀<=*k*), that in the *i*-th operation of the first sequence the word splits into parts *x* and *y*, in the *i*-th operation of the second sequence the word splits into parts *a* and *b*, and additionally *x*<=β‰ <=*a* holds. Input Specification: The first line contains a non-empty word *start*, the second line contains a non-empty word *end*. The words consist of lowercase Latin letters. The number of letters in word *start* equals the number of letters in word *end* and is at least 2 and doesn't exceed 1000 letters. The third line contains integer *k* (0<=≀<=*k*<=≀<=105) β€” the required number of operations. Output Specification: Print a single number β€” the answer to the problem. As this number can be rather large, print it modulo 1000000007 (109<=+<=7). Demo Input: ['ab\nab\n2\n', 'ababab\nababab\n1\n', 'ab\nba\n2\n'] Demo Output: ['1\n', '2\n', '0\n'] Note: The sought way in the first sample is: ab  →  a|b  →  ba  →  b|a  →  ab In the second sample the two sought ways are: - ababab  →  abab|ab  →  ababab - ababab  →  ab|abab  →  ababab
```python s = input() t = input() k = int(input()) mod = 10 ** 9 + 7 n = len(s) status1 = 0 status2 = 0 for i in range(n): if s[i:] + s[:i] == t: status1 += 1 else: status2 += 1 dp0, dp1 = (0, 1) if s == t else (1, 0) for _ in range(k): dp0, dp1 = (dp0 + dp1) * status2 % mod - dp0, (dp0 + dp1) * status1 % mod - dp1 print(dp1 % mod) ```
3
44
A
Indian Summer
PROGRAMMING
900
[ "implementation" ]
A. Indian Summer
2
256
Indian summer is such a beautiful time of the year! A girl named Alyona is walking in the forest and picking a bouquet from fallen leaves. Alyona is very choosy β€” she doesn't take a leaf if it matches the color and the species of the tree of one of the leaves she already has. Find out how many leaves Alyona has picked.
The first line contains an integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of leaves Alyona has found. The next *n* lines contain the leaves' descriptions. Each leaf is characterized by the species of the tree it has fallen from and by the color. The species of the trees and colors are given in names, consisting of no more than 10 lowercase Latin letters. A name can not be an empty string. The species of a tree and the color are given in each line separated by a space.
Output the single number β€” the number of Alyona's leaves.
[ "5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green\n", "3\noak yellow\noak yellow\noak yellow\n" ]
[ "4\n", "1\n" ]
none
0
[ { "input": "5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green", "output": "4" }, { "input": "3\noak yellow\noak yellow\noak yellow", "output": "1" }, { "input": "5\nxbnbkzn hp\nkaqkl vrgzbvqstu\nj aqidx\nhos gyul\nwefxmh tygpluae", "output": "5" }, { "input": "1\nqvwli hz", "output": "1" }, { "input": "4\nsrhk x\nsrhk x\nqfoe vnrjuab\nqfoe vnrjuab", "output": "2" }, { "input": "4\nsddqllmmpk syded\nfprsq fnenjnaz\nn hdej\nsddqllmmpk syded", "output": "3" }, { "input": "17\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw\njtbctslqq tosqzw", "output": "1" }, { "input": "18\nb d\nrfdb esp\nrfdb esp\nb d\nrfdb esp\nrfdb esp\nb d\nb d\nrfdb esp\nrfdb esp\nb d\nrfdb esp\nb d\nrfdb esp\nb d\nb d\nrfdb esp\nrfdb esp", "output": "2" }, { "input": "13\nsvpzwtwn rykzfdce\nqweiyeck jkreouy\nhk nnli\ntwxrnbbdt vtuv\nxokqjtylly sz\nesdt dbfidjslq\ng ybqgomvw\nxcpfjmf zcqvz\nifajadhj invzueip\nvdemdnxifb hckwebmi\nsdpnhipam wvowzavh\nuqdlfskhgo vunbpghae\ne dtigwnb", "output": "13" }, { "input": "20\nm vkfh\nvptikamead mvx\nitu mf\nklruxckw aqega\nekqkd enjllwol\ncc uybfdh\nimrfdngvo u\ne uh\ntwt jsslcfuogk\nbljwqsag tuqbdn\nqcv q\nasx gzhvwwmajj\nqcv q\nekqkd enjllwol\nasx gzhvwwmajj\nks vv\nkzyfi cn\ncc uybfdh\nitu mf\ncjbjhtbyvk vatwfmux", "output": "15" }, { "input": "2\nab ab\na bab", "output": "2" } ]
1,653,196,100
2,147,483,647
Python 3
OK
TESTS
29
62
0
x1=int(input()) l1=[] for i in range(x1): a1=input() l1.append(a1) print(len(set(l1)))
Title: Indian Summer Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Indian summer is such a beautiful time of the year! A girl named Alyona is walking in the forest and picking a bouquet from fallen leaves. Alyona is very choosy β€” she doesn't take a leaf if it matches the color and the species of the tree of one of the leaves she already has. Find out how many leaves Alyona has picked. Input Specification: The first line contains an integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of leaves Alyona has found. The next *n* lines contain the leaves' descriptions. Each leaf is characterized by the species of the tree it has fallen from and by the color. The species of the trees and colors are given in names, consisting of no more than 10 lowercase Latin letters. A name can not be an empty string. The species of a tree and the color are given in each line separated by a space. Output Specification: Output the single number β€” the number of Alyona's leaves. Demo Input: ['5\nbirch yellow\nmaple red\nbirch yellow\nmaple yellow\nmaple green\n', '3\noak yellow\noak yellow\noak yellow\n'] Demo Output: ['4\n', '1\n'] Note: none
```python x1=int(input()) l1=[] for i in range(x1): a1=input() l1.append(a1) print(len(set(l1))) ```
3.9845
505
B
Mr. Kitayuta's Colorful Graph
PROGRAMMING
1,400
[ "dfs and similar", "dp", "dsu", "graphs" ]
null
null
Mr. Kitayuta has just bought an undirected graph consisting of *n* vertices and *m* edges. The vertices of the graph are numbered from 1 to *n*. Each edge, namely edge *i*, has a color *c**i*, connecting vertex *a**i* and *b**i*. Mr. Kitayuta wants you to process the following *q* queries. In the *i*-th query, he gives you two integers β€” *u**i* and *v**i*. Find the number of the colors that satisfy the following condition: the edges of that color connect vertex *u**i* and vertex *v**i* directly or indirectly.
The first line of the input contains space-separated two integers β€” *n* and *m* (2<=≀<=*n*<=≀<=100,<=1<=≀<=*m*<=≀<=100), denoting the number of the vertices and the number of the edges, respectively. The next *m* lines contain space-separated three integers β€” *a**i*, *b**i* (1<=≀<=*a**i*<=&lt;<=*b**i*<=≀<=*n*) and *c**i* (1<=≀<=*c**i*<=≀<=*m*). Note that there can be multiple edges between two vertices. However, there are no multiple edges of the same color between two vertices, that is, if *i*<=β‰ <=*j*, (*a**i*,<=*b**i*,<=*c**i*)<=β‰ <=(*a**j*,<=*b**j*,<=*c**j*). The next line contains a integer β€” *q* (1<=≀<=*q*<=≀<=100), denoting the number of the queries. Then follows *q* lines, containing space-separated two integers β€” *u**i* and *v**i* (1<=≀<=*u**i*,<=*v**i*<=≀<=*n*). It is guaranteed that *u**i*<=β‰ <=*v**i*.
For each query, print the answer in a separate line.
[ "4 5\n1 2 1\n1 2 2\n2 3 1\n2 3 3\n2 4 3\n3\n1 2\n3 4\n1 4\n", "5 7\n1 5 1\n2 5 1\n3 5 1\n4 5 1\n1 2 2\n2 3 2\n3 4 2\n5\n1 5\n5 1\n2 5\n1 5\n1 4\n" ]
[ "2\n1\n0\n", "1\n1\n1\n1\n2\n" ]
Let's consider the first sample. - Vertex 1 and vertex 2 are connected by color 1 and 2. - Vertex 3 and vertex 4 are connected by color 3. - Vertex 1 and vertex 4 are not connected by any single color.
1,000
[ { "input": "4 5\n1 2 1\n1 2 2\n2 3 1\n2 3 3\n2 4 3\n3\n1 2\n3 4\n1 4", "output": "2\n1\n0" }, { "input": "5 7\n1 5 1\n2 5 1\n3 5 1\n4 5 1\n1 2 2\n2 3 2\n3 4 2\n5\n1 5\n5 1\n2 5\n1 5\n1 4", "output": "1\n1\n1\n1\n2" }, { "input": "2 1\n1 2 1\n1\n1 2", "output": "1" }, { "input": "2 3\n1 2 3\n1 2 2\n1 2 1\n1\n1 2", "output": "3" }, { "input": "2 5\n1 2 1\n1 2 2\n1 2 3\n1 2 4\n1 2 5\n1\n1 2", "output": "5" } ]
1,549,889,234
2,147,483,647
Python 3
OK
TESTS
29
217
0
# main used = [] def dfs(p, t, c): if p == t: return True if used[p]: return False used[p] = True for ch in adj[p]: if ch[1] == c and not (used[ch[0]]) and dfs(ch[0], t, ch[1]): return True return False n, m = map(int, input().split()) adj = [] for i in range(n + 1): adj.append([]) used.append(False) for i in range(m): a, b, c = map(int, input().split()) adj[a].append([b, c]) adj[b].append([a, c]) q = int(input()) for i in range(q): u, v = map(int, input().split()) ctr = 0 for j in range(m + 1): if dfs(u, v, j + 1): ctr += 1 for k in range(n + 1): used[k] = False print(ctr)
Title: Mr. Kitayuta's Colorful Graph Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mr. Kitayuta has just bought an undirected graph consisting of *n* vertices and *m* edges. The vertices of the graph are numbered from 1 to *n*. Each edge, namely edge *i*, has a color *c**i*, connecting vertex *a**i* and *b**i*. Mr. Kitayuta wants you to process the following *q* queries. In the *i*-th query, he gives you two integers β€” *u**i* and *v**i*. Find the number of the colors that satisfy the following condition: the edges of that color connect vertex *u**i* and vertex *v**i* directly or indirectly. Input Specification: The first line of the input contains space-separated two integers β€” *n* and *m* (2<=≀<=*n*<=≀<=100,<=1<=≀<=*m*<=≀<=100), denoting the number of the vertices and the number of the edges, respectively. The next *m* lines contain space-separated three integers β€” *a**i*, *b**i* (1<=≀<=*a**i*<=&lt;<=*b**i*<=≀<=*n*) and *c**i* (1<=≀<=*c**i*<=≀<=*m*). Note that there can be multiple edges between two vertices. However, there are no multiple edges of the same color between two vertices, that is, if *i*<=β‰ <=*j*, (*a**i*,<=*b**i*,<=*c**i*)<=β‰ <=(*a**j*,<=*b**j*,<=*c**j*). The next line contains a integer β€” *q* (1<=≀<=*q*<=≀<=100), denoting the number of the queries. Then follows *q* lines, containing space-separated two integers β€” *u**i* and *v**i* (1<=≀<=*u**i*,<=*v**i*<=≀<=*n*). It is guaranteed that *u**i*<=β‰ <=*v**i*. Output Specification: For each query, print the answer in a separate line. Demo Input: ['4 5\n1 2 1\n1 2 2\n2 3 1\n2 3 3\n2 4 3\n3\n1 2\n3 4\n1 4\n', '5 7\n1 5 1\n2 5 1\n3 5 1\n4 5 1\n1 2 2\n2 3 2\n3 4 2\n5\n1 5\n5 1\n2 5\n1 5\n1 4\n'] Demo Output: ['2\n1\n0\n', '1\n1\n1\n1\n2\n'] Note: Let's consider the first sample. - Vertex 1 and vertex 2 are connected by color 1 and 2. - Vertex 3 and vertex 4 are connected by color 3. - Vertex 1 and vertex 4 are not connected by any single color.
```python # main used = [] def dfs(p, t, c): if p == t: return True if used[p]: return False used[p] = True for ch in adj[p]: if ch[1] == c and not (used[ch[0]]) and dfs(ch[0], t, ch[1]): return True return False n, m = map(int, input().split()) adj = [] for i in range(n + 1): adj.append([]) used.append(False) for i in range(m): a, b, c = map(int, input().split()) adj[a].append([b, c]) adj[b].append([a, c]) q = int(input()) for i in range(q): u, v = map(int, input().split()) ctr = 0 for j in range(m + 1): if dfs(u, v, j + 1): ctr += 1 for k in range(n + 1): used[k] = False print(ctr) ```
3
106
A
Card Game
PROGRAMMING
1,000
[ "implementation" ]
A. Card Game
2
256
There is a card game called "Durak", which means "Fool" in Russian. The game is quite popular in the countries that used to form USSR. The problem does not state all the game's rules explicitly β€” you can find them later yourselves if you want. To play durak you need a pack of 36 cards. Each card has a suit ("S", "H", "D" and "C") and a rank (in the increasing order "6", "7", "8", "9", "T", "J", "Q", "K" and "A"). At the beginning of the game one suit is arbitrarily chosen as trump. The players move like that: one player puts one or several of his cards on the table and the other one should beat each of them with his cards. A card beats another one if both cards have similar suits and the first card has a higher rank then the second one. Besides, a trump card can beat any non-trump card whatever the cards’ ranks are. In all other cases you can not beat the second card with the first one. You are given the trump suit and two different cards. Determine whether the first one beats the second one or not.
The first line contains the tramp suit. It is "S", "H", "D" or "C". The second line contains the description of the two different cards. Each card is described by one word consisting of two symbols. The first symbol stands for the rank ("6", "7", "8", "9", "T", "J", "Q", "K" and "A"), and the second one stands for the suit ("S", "H", "D" and "C").
Print "YES" (without the quotes) if the first cards beats the second one. Otherwise, print "NO" (also without the quotes).
[ "H\nQH 9S\n", "S\n8D 6D\n", "C\n7H AS\n" ]
[ "YES\n", "YES", "NO" ]
none
500
[ { "input": "H\nQH 9S", "output": "YES" }, { "input": "S\n8D 6D", "output": "YES" }, { "input": "C\n7H AS", "output": "NO" }, { "input": "C\nKC 9C", "output": "YES" }, { "input": "D\n7D KD", "output": "NO" }, { "input": "H\n7H KD", "output": "YES" }, { "input": "D\nAS AH", "output": "NO" }, { "input": "H\nKH KS", "output": "YES" }, { "input": "C\n9H 6C", "output": "NO" }, { "input": "C\n9H JC", "output": "NO" }, { "input": "D\nTD JD", "output": "NO" }, { "input": "H\n6S 7S", "output": "NO" }, { "input": "D\n7S 8S", "output": "NO" }, { "input": "S\n8H 9H", "output": "NO" }, { "input": "C\n9D TD", "output": "NO" }, { "input": "H\nTC JC", "output": "NO" }, { "input": "C\nJH QH", "output": "NO" }, { "input": "H\nQD KD", "output": "NO" }, { "input": "D\nKS AS", "output": "NO" }, { "input": "S\nAH 6H", "output": "YES" }, { "input": "H\n7D 6D", "output": "YES" }, { "input": "S\n8H 7H", "output": "YES" }, { "input": "D\n9S 8S", "output": "YES" }, { "input": "S\nTC 9C", "output": "YES" }, { "input": "H\nJS TS", "output": "YES" }, { "input": "S\nQD JD", "output": "YES" }, { "input": "D\nKH QH", "output": "YES" }, { "input": "H\nAD KD", "output": "YES" }, { "input": "H\nQS QD", "output": "NO" }, { "input": "C\nTS TH", "output": "NO" }, { "input": "C\n6C 6D", "output": "YES" }, { "input": "H\n8H 8D", "output": "YES" }, { "input": "S\n7D 7S", "output": "NO" }, { "input": "H\nJC JH", "output": "NO" }, { "input": "H\n8H 9C", "output": "YES" }, { "input": "D\n9D 6S", "output": "YES" }, { "input": "C\nJC AH", "output": "YES" }, { "input": "S\nAS KD", "output": "YES" }, { "input": "S\n7S JS", "output": "NO" }, { "input": "H\nTH 8H", "output": "YES" }, { "input": "S\n7S QS", "output": "NO" }, { "input": "C\nKC QC", "output": "YES" }, { "input": "S\nAD 9S", "output": "NO" }, { "input": "D\n7H 8D", "output": "NO" }, { "input": "H\nJC 9H", "output": "NO" }, { "input": "C\n7S AC", "output": "NO" }, { "input": "C\n8C 7C", "output": "YES" }, { "input": "H\n9D 8S", "output": "NO" }, { "input": "D\nAC KS", "output": "NO" }, { "input": "H\n8C QH", "output": "NO" }, { "input": "S\n7S TS", "output": "NO" }, { "input": "C\nAH 6S", "output": "NO" }, { "input": "S\nKS QS", "output": "YES" }, { "input": "H\nAC QC", "output": "YES" }, { "input": "S\n9H 8D", "output": "NO" }, { "input": "S\nTS JS", "output": "NO" }, { "input": "S\n8H 7C", "output": "NO" }, { "input": "C\nAH 6S", "output": "NO" }, { "input": "S\n7S QS", "output": "NO" }, { "input": "C\nAH 6S", "output": "NO" }, { "input": "S\nTS KS", "output": "NO" }, { "input": "C\nTH KH", "output": "NO" }, { "input": "H\n9C 6D", "output": "NO" }, { "input": "H\n9C 8D", "output": "NO" }, { "input": "H\nTH AH", "output": "NO" }, { "input": "H\nTH JH", "output": "NO" }, { "input": "H\nQS 9C", "output": "NO" }, { "input": "H\nKC AC", "output": "NO" }, { "input": "H\nAH KH", "output": "YES" }, { "input": "H\nKS QS", "output": "YES" }, { "input": "C\nAD KS", "output": "NO" }, { "input": "H\nQS 9C", "output": "NO" }, { "input": "H\n9D 7S", "output": "NO" }, { "input": "D\n6D 9S", "output": "YES" }, { "input": "H\nAH KH", "output": "YES" }, { "input": "H\nKC AC", "output": "NO" }, { "input": "D\n8S 6C", "output": "NO" }, { "input": "S\nAC KC", "output": "YES" } ]
1,683,303,370
2,147,483,647
PyPy 3-64
OK
TESTS
78
154
0
weight = '6789TJQKA' trump_card = input() card_1, card_2 = input().split() if card_1[1] == card_2[1]: print('YES' if weight.index(card_1[0]) > weight.index(card_2[0]) else 'NO') else: print('YES' if card_1[1] == trump_card != card_2[1] else 'NO')
Title: Card Game Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: There is a card game called "Durak", which means "Fool" in Russian. The game is quite popular in the countries that used to form USSR. The problem does not state all the game's rules explicitly β€” you can find them later yourselves if you want. To play durak you need a pack of 36 cards. Each card has a suit ("S", "H", "D" and "C") and a rank (in the increasing order "6", "7", "8", "9", "T", "J", "Q", "K" and "A"). At the beginning of the game one suit is arbitrarily chosen as trump. The players move like that: one player puts one or several of his cards on the table and the other one should beat each of them with his cards. A card beats another one if both cards have similar suits and the first card has a higher rank then the second one. Besides, a trump card can beat any non-trump card whatever the cards’ ranks are. In all other cases you can not beat the second card with the first one. You are given the trump suit and two different cards. Determine whether the first one beats the second one or not. Input Specification: The first line contains the tramp suit. It is "S", "H", "D" or "C". The second line contains the description of the two different cards. Each card is described by one word consisting of two symbols. The first symbol stands for the rank ("6", "7", "8", "9", "T", "J", "Q", "K" and "A"), and the second one stands for the suit ("S", "H", "D" and "C"). Output Specification: Print "YES" (without the quotes) if the first cards beats the second one. Otherwise, print "NO" (also without the quotes). Demo Input: ['H\nQH 9S\n', 'S\n8D 6D\n', 'C\n7H AS\n'] Demo Output: ['YES\n', 'YES', 'NO'] Note: none
```python weight = '6789TJQKA' trump_card = input() card_1, card_2 = input().split() if card_1[1] == card_2[1]: print('YES' if weight.index(card_1[0]) > weight.index(card_2[0]) else 'NO') else: print('YES' if card_1[1] == trump_card != card_2[1] else 'NO') ```
3.9615
476
B
Dreamoon and WiFi
PROGRAMMING
1,300
[ "bitmasks", "brute force", "combinatorics", "dp", "math", "probabilities" ]
null
null
Dreamoon is standing at the position 0 on a number line. Drazil is sending a list of commands through Wi-Fi to Dreamoon's smartphone and Dreamoon follows them. Each command is one of the following two types: 1. Go 1 unit towards the positive direction, denoted as '+' 1. Go 1 unit towards the negative direction, denoted as '-' But the Wi-Fi condition is so poor that Dreamoon's smartphone reports some of the commands can't be recognized and Dreamoon knows that some of them might even be wrong though successfully recognized. Dreamoon decides to follow every recognized command and toss a fair coin to decide those unrecognized ones (that means, he moves to the 1 unit to the negative or positive direction with the same probability 0.5). You are given an original list of commands sent by Drazil and list received by Dreamoon. What is the probability that Dreamoon ends in the position originally supposed to be final by Drazil's commands?
The first line contains a string *s*1 β€” the commands Drazil sends to Dreamoon, this string consists of only the characters in the set {'+', '-'}. The second line contains a string *s*2 β€” the commands Dreamoon's smartphone recognizes, this string consists of only the characters in the set {'+', '-', '?'}. '?' denotes an unrecognized command. Lengths of two strings are equal and do not exceed 10.
Output a single real number corresponding to the probability. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=9.
[ "++-+-\n+-+-+\n", "+-+-\n+-??\n", "+++\n??-\n" ]
[ "1.000000000000\n", "0.500000000000\n", "0.000000000000\n" ]
For the first sample, both *s*<sub class="lower-index">1</sub> and *s*<sub class="lower-index">2</sub> will lead Dreamoon to finish at the same position  + 1. For the second sample, *s*<sub class="lower-index">1</sub> will lead Dreamoon to finish at position 0, while there are four possibilites for *s*<sub class="lower-index">2</sub>: {"+-++", "+-+-", "+--+", "+---"} with ending position {+2, 0, 0, -2} respectively. So there are 2 correct cases out of 4, so the probability of finishing at the correct position is 0.5. For the third sample, *s*<sub class="lower-index">2</sub> could only lead us to finish at positions {+1, -1, -3}, so the probability to finish at the correct position  + 3 is 0.
1,500
[ { "input": "++-+-\n+-+-+", "output": "1.000000000000" }, { "input": "+-+-\n+-??", "output": "0.500000000000" }, { "input": "+++\n??-", "output": "0.000000000000" }, { "input": "++++++++++\n+++??++?++", "output": "0.125000000000" }, { "input": "--+++---+-\n??????????", "output": "0.205078125000" }, { "input": "+--+++--+-\n??????????", "output": "0.246093750000" }, { "input": "+\n+", "output": "1.000000000000" }, { "input": "-\n?", "output": "0.500000000000" }, { "input": "+\n-", "output": "0.000000000000" }, { "input": "-\n-", "output": "1.000000000000" }, { "input": "-\n+", "output": "0.000000000000" }, { "input": "+\n?", "output": "0.500000000000" }, { "input": "++++++++++\n++++++++++", "output": "1.000000000000" }, { "input": "++++++++++\n++++-+++++", "output": "0.000000000000" }, { "input": "----------\n++++++++++", "output": "0.000000000000" }, { "input": "++++++++++\n++++??++++", "output": "0.250000000000" }, { "input": "----------\n+++?++++-+", "output": "0.000000000000" }, { "input": "++++++++++\n++++++++?+", "output": "0.500000000000" }, { "input": "--++++--+\n?-+?-??+-", "output": "0.250000000000" }, { "input": "----------\n??????????", "output": "0.000976562500" }, { "input": "+--++\n+--+-", "output": "0.000000000000" }, { "input": "-----++---\n????????+?", "output": "0.017578125000" }, { "input": "------+--+\n??????????", "output": "0.043945312500" }, { "input": "---++--\n???????", "output": "0.164062500000" }, { "input": "-----++\n???????", "output": "0.164062500000" }, { "input": "+---+--\n???????", "output": "0.164062500000" }, { "input": "---+-+\n??????", "output": "0.234375000000" }, { "input": "+++-+\n---++", "output": "0.000000000000" }, { "input": "++-+--+\n?-?+??+", "output": "0.375000000000" }, { "input": "----+++--\n-+?+++?--", "output": "0.000000000000" }, { "input": "+-----\n+?----", "output": "0.500000000000" } ]
1,688,715,182
2,147,483,647
PyPy 3-64
OK
TESTS
31
77
1,945,600
from sys import stdin def get_input(): # Faster IO return stdin.read().strip().split('\n') def get_prob(s1, s2): n = len(s1) if n == 0: return 1 end = sum(-1 if sign == '-' else 1 for sign in s1) # print(end) res = [0, 0] def rec(i, pos): if i == n: if pos == end: res[0] += 1 else: res[1] += 1 return if s2[i] in ['-', '?']: rec(i + 1, pos - 1) if s2[i] in ['+', '?']: rec(i + 1, pos + 1) rec(0, 0) # print(res) return res[0] / sum(res) print(get_prob(*get_input()))
Title: Dreamoon and WiFi Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dreamoon is standing at the position 0 on a number line. Drazil is sending a list of commands through Wi-Fi to Dreamoon's smartphone and Dreamoon follows them. Each command is one of the following two types: 1. Go 1 unit towards the positive direction, denoted as '+' 1. Go 1 unit towards the negative direction, denoted as '-' But the Wi-Fi condition is so poor that Dreamoon's smartphone reports some of the commands can't be recognized and Dreamoon knows that some of them might even be wrong though successfully recognized. Dreamoon decides to follow every recognized command and toss a fair coin to decide those unrecognized ones (that means, he moves to the 1 unit to the negative or positive direction with the same probability 0.5). You are given an original list of commands sent by Drazil and list received by Dreamoon. What is the probability that Dreamoon ends in the position originally supposed to be final by Drazil's commands? Input Specification: The first line contains a string *s*1 β€” the commands Drazil sends to Dreamoon, this string consists of only the characters in the set {'+', '-'}. The second line contains a string *s*2 β€” the commands Dreamoon's smartphone recognizes, this string consists of only the characters in the set {'+', '-', '?'}. '?' denotes an unrecognized command. Lengths of two strings are equal and do not exceed 10. Output Specification: Output a single real number corresponding to the probability. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=9. Demo Input: ['++-+-\n+-+-+\n', '+-+-\n+-??\n', '+++\n??-\n'] Demo Output: ['1.000000000000\n', '0.500000000000\n', '0.000000000000\n'] Note: For the first sample, both *s*<sub class="lower-index">1</sub> and *s*<sub class="lower-index">2</sub> will lead Dreamoon to finish at the same position  + 1. For the second sample, *s*<sub class="lower-index">1</sub> will lead Dreamoon to finish at position 0, while there are four possibilites for *s*<sub class="lower-index">2</sub>: {"+-++", "+-+-", "+--+", "+---"} with ending position {+2, 0, 0, -2} respectively. So there are 2 correct cases out of 4, so the probability of finishing at the correct position is 0.5. For the third sample, *s*<sub class="lower-index">2</sub> could only lead us to finish at positions {+1, -1, -3}, so the probability to finish at the correct position  + 3 is 0.
```python from sys import stdin def get_input(): # Faster IO return stdin.read().strip().split('\n') def get_prob(s1, s2): n = len(s1) if n == 0: return 1 end = sum(-1 if sign == '-' else 1 for sign in s1) # print(end) res = [0, 0] def rec(i, pos): if i == n: if pos == end: res[0] += 1 else: res[1] += 1 return if s2[i] in ['-', '?']: rec(i + 1, pos - 1) if s2[i] in ['+', '?']: rec(i + 1, pos + 1) rec(0, 0) # print(res) return res[0] / sum(res) print(get_prob(*get_input())) ```
3
500
A
New Year Transportation
PROGRAMMING
1,000
[ "dfs and similar", "graphs", "implementation" ]
null
null
New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=Γ—<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells. So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≀<=*i*<=≀<=*n*<=-<=1 the condition 1<=≀<=*a**i*<=≀<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≀<=*i*<=≀<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≀<=*a**i*<=≀<=*n*<=-<=*i* one can't leave the Line World using portals. Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system.
The first line contains two space-separated integers *n* (3<=≀<=*n*<=≀<=3<=Γ—<=104) and *t* (2<=≀<=*t*<=≀<=*n*) β€” the number of cells, and the index of the cell which I want to go to. The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≀<=*a**i*<=≀<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World.
If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO".
[ "8 4\n1 2 1 2 1 2 1\n", "8 5\n1 2 1 2 1 1 1\n" ]
[ "YES\n", "NO\n" ]
In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4. In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit.
500
[ { "input": "8 4\n1 2 1 2 1 2 1", "output": "YES" }, { "input": "8 5\n1 2 1 2 1 1 1", "output": "NO" }, { "input": "20 19\n13 16 7 6 12 1 5 7 8 6 5 7 5 5 3 3 2 2 1", "output": "YES" }, { "input": "50 49\n11 7 1 41 26 36 19 16 38 14 36 35 37 27 20 27 3 6 21 2 27 11 18 17 19 16 22 8 8 9 1 7 5 12 5 6 13 6 11 2 6 3 1 5 1 1 2 2 1", "output": "YES" }, { "input": "120 104\n41 15 95 85 34 11 25 42 65 39 77 80 74 17 66 73 21 14 36 63 63 79 45 24 65 7 63 80 51 21 2 19 78 28 71 2 15 23 17 68 62 18 54 39 43 70 3 46 34 23 41 65 32 10 13 18 10 3 16 48 54 18 57 28 3 24 44 50 15 2 20 22 45 44 3 29 2 27 11 2 12 25 25 31 1 2 32 4 11 30 13 16 26 21 1 13 21 8 15 5 18 13 5 15 3 8 13 6 5 1 9 7 1 2 4 1 1 2 1", "output": "NO" }, { "input": "10 3\n8 3 5 4 2 3 2 2 1", "output": "NO" }, { "input": "10 9\n8 3 5 4 2 3 2 2 1", "output": "YES" }, { "input": "3 2\n1 1", "output": "YES" }, { "input": "3 2\n2 1", "output": "NO" }, { "input": "4 2\n2 1 1", "output": "NO" }, { "input": "4 4\n2 2 1", "output": "YES" }, { "input": "8 8\n1 2 1 2 1 2 1", "output": "YES" }, { "input": "3 3\n1 1", "output": "YES" }, { "input": "8 8\n1 2 1 2 1 1 1", "output": "YES" }, { "input": "3 3\n2 1", "output": "YES" }, { "input": "4 4\n1 1 1", "output": "YES" }, { "input": "8 8\n1 1 1 1 1 1 1", "output": "YES" }, { "input": "5 5\n1 1 1 1", "output": "YES" } ]
1,665,338,367
2,147,483,647
PyPy 3-64
OK
TESTS
34
62
3,072,000
n, t = map(int, input().split()) data = input().split() i = 1 c = 0 while i <= n-1: i += int(data[i-1]) if i > t: print('NO') break if i == t: print('YES') c += 1 break
Title: New Year Transportation Time Limit: None seconds Memory Limit: None megabytes Problem Description: New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=Γ—<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells. So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≀<=*i*<=≀<=*n*<=-<=1 the condition 1<=≀<=*a**i*<=≀<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≀<=*i*<=≀<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≀<=*a**i*<=≀<=*n*<=-<=*i* one can't leave the Line World using portals. Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system. Input Specification: The first line contains two space-separated integers *n* (3<=≀<=*n*<=≀<=3<=Γ—<=104) and *t* (2<=≀<=*t*<=≀<=*n*) β€” the number of cells, and the index of the cell which I want to go to. The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≀<=*a**i*<=≀<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World. Output Specification: If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO". Demo Input: ['8 4\n1 2 1 2 1 2 1\n', '8 5\n1 2 1 2 1 1 1\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4. In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit.
```python n, t = map(int, input().split()) data = input().split() i = 1 c = 0 while i <= n-1: i += int(data[i-1]) if i > t: print('NO') break if i == t: print('YES') c += 1 break ```
3
233
A
Perfect Permutation
PROGRAMMING
800
[ "implementation", "math" ]
null
null
A permutation is a sequence of integers *p*1,<=*p*2,<=...,<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. Let's denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size of permutation *p*1,<=*p*2,<=...,<=*p**n*. Nickolas adores permutations. He likes some permutations more than the others. He calls such permutations perfect. A perfect permutation is such permutation *p* that for any *i* (1<=≀<=*i*<=≀<=*n*) (*n* is the permutation size) the following equations hold *p**p**i*<==<=*i* and *p**i*<=β‰ <=*i*. Nickolas asks you to print any perfect permutation of size *n* for the given *n*.
A single line contains a single integer *n* (1<=≀<=*n*<=≀<=100) β€” the permutation size.
If a perfect permutation of size *n* doesn't exist, print a single integer -1. Otherwise print *n* distinct integers from 1 to *n*, *p*1,<=*p*2,<=...,<=*p**n* β€” permutation *p*, that is perfect. Separate printed numbers by whitespaces.
[ "1\n", "2\n", "4\n" ]
[ "-1\n", "2 1 \n", "2 1 4 3 \n" ]
none
500
[ { "input": "1", "output": "-1" }, { "input": "2", "output": "2 1 " }, { "input": "4", "output": "2 1 4 3 " }, { "input": "3", "output": "-1" }, { "input": "5", "output": "-1" }, { "input": "6", "output": "2 1 4 3 6 5 " }, { "input": "7", "output": "-1" }, { "input": "20", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 " }, { "input": "8", "output": "2 1 4 3 6 5 8 7 " }, { "input": "9", "output": "-1" }, { "input": "10", "output": "2 1 4 3 6 5 8 7 10 9 " }, { "input": "11", "output": "-1" }, { "input": "21", "output": "-1" }, { "input": "50", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 " }, { "input": "51", "output": "-1" }, { "input": "52", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 " }, { "input": "84", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 " }, { "input": "86", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 " }, { "input": "100", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 " }, { "input": "98", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 " }, { "input": "96", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 " }, { "input": "33", "output": "-1" }, { "input": "34", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 " }, { "input": "36", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 " }, { "input": "38", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 " }, { "input": "40", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 " }, { "input": "42", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 " }, { "input": "44", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 " }, { "input": "46", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 " }, { "input": "48", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 " } ]
1,646,244,180
2,147,483,647
PyPy 3-64
OK
TESTS
30
124
512,000
given = [x for x in range(1, int(input()) + 1)] lens = len(given) if lens % 2 == 1: print(-1) else: answer = [] lens = len(given) i = 1 while i < lens: answer.extend([i+1, i]) i += 2 print(*answer)
Title: Perfect Permutation Time Limit: None seconds Memory Limit: None megabytes Problem Description: A permutation is a sequence of integers *p*1,<=*p*2,<=...,<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. Let's denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size of permutation *p*1,<=*p*2,<=...,<=*p**n*. Nickolas adores permutations. He likes some permutations more than the others. He calls such permutations perfect. A perfect permutation is such permutation *p* that for any *i* (1<=≀<=*i*<=≀<=*n*) (*n* is the permutation size) the following equations hold *p**p**i*<==<=*i* and *p**i*<=β‰ <=*i*. Nickolas asks you to print any perfect permutation of size *n* for the given *n*. Input Specification: A single line contains a single integer *n* (1<=≀<=*n*<=≀<=100) β€” the permutation size. Output Specification: If a perfect permutation of size *n* doesn't exist, print a single integer -1. Otherwise print *n* distinct integers from 1 to *n*, *p*1,<=*p*2,<=...,<=*p**n* β€” permutation *p*, that is perfect. Separate printed numbers by whitespaces. Demo Input: ['1\n', '2\n', '4\n'] Demo Output: ['-1\n', '2 1 \n', '2 1 4 3 \n'] Note: none
```python given = [x for x in range(1, int(input()) + 1)] lens = len(given) if lens % 2 == 1: print(-1) else: answer = [] lens = len(given) i = 1 while i < lens: answer.extend([i+1, i]) i += 2 print(*answer) ```
3
61
A
Ultra-Fast Mathematician
PROGRAMMING
800
[ "implementation" ]
A. Ultra-Fast Mathematician
2
256
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Write one line β€” the corresponding answer. Do not omit the leading 0s.
[ "1010100\n0100101\n", "000\n111\n", "1110\n1010\n", "01110\n01100\n" ]
[ "1110001\n", "111\n", "0100\n", "00010\n" ]
none
500
[ { "input": "1010100\n0100101", "output": "1110001" }, { "input": "000\n111", "output": "111" }, { "input": "1110\n1010", "output": "0100" }, { "input": "01110\n01100", "output": "00010" }, { "input": "011101\n000001", "output": "011100" }, { "input": "10\n01", "output": "11" }, { "input": "00111111\n11011101", "output": "11100010" }, { "input": "011001100\n101001010", "output": "110000110" }, { "input": "1100100001\n0110101100", "output": "1010001101" }, { "input": "00011101010\n10010100101", "output": "10001001111" }, { "input": "100000101101\n111010100011", "output": "011010001110" }, { "input": "1000001111010\n1101100110001", "output": "0101101001011" }, { "input": "01011111010111\n10001110111010", "output": "11010001101101" }, { "input": "110010000111100\n001100101011010", "output": "111110101100110" }, { "input": "0010010111110000\n0000000011010110", "output": "0010010100100110" }, { "input": "00111110111110000\n01111100001100000", "output": "01000010110010000" }, { "input": "101010101111010001\n001001111101111101", "output": "100011010010101100" }, { "input": "0110010101111100000\n0011000101000000110", "output": "0101010000111100110" }, { "input": "11110100011101010111\n00001000011011000000", "output": "11111100000110010111" }, { "input": "101010101111101101001\n111010010010000011111", "output": "010000111101101110110" }, { "input": "0000111111100011000010\n1110110110110000001010", "output": "1110001001010011001000" }, { "input": "10010010101000110111000\n00101110100110111000111", "output": "10111100001110001111111" }, { "input": "010010010010111100000111\n100100111111100011001110", "output": "110110101101011111001001" }, { "input": "0101110100100111011010010\n0101100011010111001010001", "output": "0000010111110000010000011" }, { "input": "10010010100011110111111011\n10000110101100000001000100", "output": "00010100001111110110111111" }, { "input": "000001111000000100001000000\n011100111101111001110110001", "output": "011101000101111101111110001" }, { "input": "0011110010001001011001011100\n0000101101000011101011001010", "output": "0011011111001010110010010110" }, { "input": "11111000000000010011001101111\n11101110011001010100010000000", "output": "00010110011001000111011101111" }, { "input": "011001110000110100001100101100\n001010000011110000001000101001", "output": "010011110011000100000100000101" }, { "input": "1011111010001100011010110101111\n1011001110010000000101100010101", "output": "0000110100011100011111010111010" }, { "input": "10111000100001000001010110000001\n10111000001100101011011001011000", "output": "00000000101101101010001111011001" }, { "input": "000001010000100001000000011011100\n111111111001010100100001100000111", "output": "111110101001110101100001111011011" }, { "input": "1101000000000010011011101100000110\n1110000001100010011010000011011110", "output": "0011000001100000000001101111011000" }, { "input": "01011011000010100001100100011110001\n01011010111000001010010100001110000", "output": "00000001111010101011110000010000001" }, { "input": "000011111000011001000110111100000100\n011011000110000111101011100111000111", "output": "011000111110011110101101011011000011" }, { "input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000", "output": "1011001001111001001011101010101000010" }, { "input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011", "output": "10001110000010101110000111000011111110" }, { "input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100", "output": "000100001011110000011101110111010001110" }, { "input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001", "output": "1101110101010110000011000000101011110011" }, { "input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100", "output": "11001011110010010000010111001100001001110" }, { "input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110", "output": "001100101000011111111101111011101010111001" }, { "input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001", "output": "0111010010100110110101100010000100010100000" }, { "input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100", "output": "11111110000000100101000100110111001100011001" }, { "input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011", "output": "101011011100100010100011011001101010100100010" }, { "input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001", "output": "1101001100111011010111110110101111001011110111" }, { "input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001", "output": "10010101000101000000011010011110011110011110001" }, { "input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100", "output": "011011011100000000010101110010000000101000111101" }, { "input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100", "output": "0101010111101001011011110110011101010101010100011" }, { "input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011", "output": "11001011010010111000010110011101100100001110111111" }, { "input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011", "output": "111011101010011100001111101001101011110010010110001" }, { "input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001", "output": "0100111110110011111110010010010000110111100101101101" }, { "input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100", "output": "01011001110111010111001100010011010100010000111011000" }, { "input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111", "output": "100011101001001000011011011001111000100000010100100100" }, { "input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110", "output": "1100110010000101101010111111101001001001110101110010110" }, { "input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110", "output": "01000111100111001011110010100011111111110010101100001101" }, { "input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010", "output": "110001010001000011000101110101000100001011111001011001001" }, { "input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111", "output": "1110100010111000101001001011101110011111100111000011011011" }, { "input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110", "output": "01110110101110100100110011010000001000101100101111000111011" }, { "input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011", "output": "111100101000000011101011011001110010101111000110010010000000" }, { "input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111", "output": "0100100010111110010011101010000011111110001110010110010111001" }, { "input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111", "output": "00110100000011001101101100100010110010001100000001100110011101" }, { "input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011", "output": "000000011000111011110011101000010000010100101000000011010110010" }, { "input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010", "output": "0010100110110100111100100100101101010100100111011010001001010101" }, { "input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111", "output": "11010110111100101111101001100001110100010110010110110111100110100" }, { "input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111", "output": "111111010011011100101110100110111111111001111110011010111111110000" }, { "input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110", "output": "1010101010100010001001001001100000111000010010010100010011000100000" }, { "input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000", "output": "00011111011111001000011100010011100011010100101011011000001001111110" }, { "input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111", "output": "001111000011001110100111010101111111011100110011001010010010000111011" }, { "input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101", "output": "0110001100110100010000110111000010011010011000011001010011010100010100" }, { "input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010", "output": "00010000000110110101000011001000000100100110111010011111101010001010000" }, { "input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001", "output": "000100100000000110011100100001010110101001100101110010010011111001110111" }, { "input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000", "output": "1000111100010011010110011101000000101010101100011111100001101111001010010" }, { "input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011", "output": "01000010011110111001011011110000001011000111101101101010010110001010100100" }, { "input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101", "output": "101101110110110010011100001011111100100001110000101100110000100011011100110" }, { "input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001", "output": "1110111111110010111000001100101010101011010100101010100101100011001001111111" }, { "input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111", "output": "10111011000111000101110100101000100111011011100011110110000101010001111010111" }, { "input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110", "output": "110100100110000101010010011010011001100110000111010000010100001011110111111101" }, { "input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111", "output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111" }, { "input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001", "output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001" }, { "input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110", "output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011" }, { "input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111", "output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101" }, { "input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010", "output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101" }, { "input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000", "output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001" }, { "input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011", "output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110" }, { "input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011", "output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011" }, { "input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011", "output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011" }, { "input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010", "output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011" }, { "input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001", "output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110" }, { "input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111", "output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010" }, { "input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011", "output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011" }, { "input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100", "output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000" }, { "input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001", "output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101" }, { "input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110", "output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101" }, { "input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011", "output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110" }, { "input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111", "output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110" }, { "input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000", "output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001" }, { "input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010", "output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101" }, { "input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101", "output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011" }, { "input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011", "output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010" }, { "input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010", "output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011" }, { "input": "0\n0", "output": "0" }, { "input": "0\n1", "output": "1" } ]
1,636,987,458
2,147,483,647
Python 3
OK
TESTS
102
61
0
print (*(int(i!=x) for i,x in zip(input(),input())),sep='')
Title: Ultra-Fast Mathematician Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate. Input Specification: There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. Output Specification: Write one line β€” the corresponding answer. Do not omit the leading 0s. Demo Input: ['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n'] Demo Output: ['1110001\n', '111\n', '0100\n', '00010\n'] Note: none
```python print (*(int(i!=x) for i,x in zip(input(),input())),sep='') ```
3.98475
361
A
Levko and Table
PROGRAMMING
800
[ "constructive algorithms", "implementation" ]
null
null
Levko loves tables that consist of *n* rows and *n* columns very much. He especially loves beautiful tables. A table is beautiful to Levko if the sum of elements in each row and column of the table equals *k*. Unfortunately, he doesn't know any such table. Your task is to help him to find at least one of them.
The single line contains two integers, *n* and *k* (1<=≀<=*n*<=≀<=100, 1<=≀<=*k*<=≀<=1000).
Print any beautiful table. Levko doesn't like too big numbers, so all elements of the table mustn't exceed 1000 in their absolute value. If there are multiple suitable tables, you are allowed to print any of them.
[ "2 4\n", "4 7\n" ]
[ "1 3\n3 1\n", "2 1 0 4\n4 0 2 1\n1 3 3 0\n0 3 2 2\n" ]
In the first sample the sum in the first row is 1 + 3 = 4, in the second row β€” 3 + 1 = 4, in the first column β€” 1 + 3 = 4 and in the second column β€” 3 + 1 = 4. There are other beautiful tables for this sample. In the second sample the sum of elements in each row and each column equals 7. Besides, there are other tables that meet the statement requirements.
500
[ { "input": "2 4", "output": "4 0 \n0 4 " }, { "input": "4 7", "output": "7 0 0 0 \n0 7 0 0 \n0 0 7 0 \n0 0 0 7 " }, { "input": "1 8", "output": "8 " }, { "input": "9 3", "output": "3 0 0 0 0 0 0 0 0 \n0 3 0 0 0 0 0 0 0 \n0 0 3 0 0 0 0 0 0 \n0 0 0 3 0 0 0 0 0 \n0 0 0 0 3 0 0 0 0 \n0 0 0 0 0 3 0 0 0 \n0 0 0 0 0 0 3 0 0 \n0 0 0 0 0 0 0 3 0 \n0 0 0 0 0 0 0 0 3 " }, { "input": "31 581", "output": "581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "100 1000", "output": "1000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 1000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 1000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ..." }, { "input": "100 999", "output": "999 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 999 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 999 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "99 998", "output": "998 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 998 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 998 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "100 997", "output": "997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "81 111", "output": "111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 111 0 0..." }, { "input": "1 407", "output": "407 " }, { "input": "54 341", "output": "341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "92 460", "output": "460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "34 47", "output": "47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 ..." }, { "input": "11 547", "output": "547 0 0 0 0 0 0 0 0 0 0 \n0 547 0 0 0 0 0 0 0 0 0 \n0 0 547 0 0 0 0 0 0 0 0 \n0 0 0 547 0 0 0 0 0 0 0 \n0 0 0 0 547 0 0 0 0 0 0 \n0 0 0 0 0 547 0 0 0 0 0 \n0 0 0 0 0 0 547 0 0 0 0 \n0 0 0 0 0 0 0 547 0 0 0 \n0 0 0 0 0 0 0 0 547 0 0 \n0 0 0 0 0 0 0 0 0 547 0 \n0 0 0 0 0 0 0 0 0 0 547 " }, { "input": "100 1", "output": "1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "99 1", "output": "1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "99 2", "output": "2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "2 7", "output": "7 0 \n0 7 " }, { "input": "100 100", "output": "100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..." }, { "input": "4 3", "output": "3 0 0 0 \n0 3 0 0 \n0 0 3 0 \n0 0 0 3 " }, { "input": "3 2", "output": "2 0 0 \n0 2 0 \n0 0 2 " } ]
1,598,018,389
2,147,483,647
PyPy 3
OK
TESTS
22
156
22,630,400
def rotate(c,d): return c[d:]+c[:d] n,m = map(int,input().split()) c = [] if(m%n == 0): c = [m//n]*n else: c = [m//n]*(n-1) c.append(m-sum(c)) p = [] for i in range(n): p.append(rotate(c,i)) for i in p: print(*i)
Title: Levko and Table Time Limit: None seconds Memory Limit: None megabytes Problem Description: Levko loves tables that consist of *n* rows and *n* columns very much. He especially loves beautiful tables. A table is beautiful to Levko if the sum of elements in each row and column of the table equals *k*. Unfortunately, he doesn't know any such table. Your task is to help him to find at least one of them. Input Specification: The single line contains two integers, *n* and *k* (1<=≀<=*n*<=≀<=100, 1<=≀<=*k*<=≀<=1000). Output Specification: Print any beautiful table. Levko doesn't like too big numbers, so all elements of the table mustn't exceed 1000 in their absolute value. If there are multiple suitable tables, you are allowed to print any of them. Demo Input: ['2 4\n', '4 7\n'] Demo Output: ['1 3\n3 1\n', '2 1 0 4\n4 0 2 1\n1 3 3 0\n0 3 2 2\n'] Note: In the first sample the sum in the first row is 1 + 3 = 4, in the second row β€” 3 + 1 = 4, in the first column β€” 1 + 3 = 4 and in the second column β€” 3 + 1 = 4. There are other beautiful tables for this sample. In the second sample the sum of elements in each row and each column equals 7. Besides, there are other tables that meet the statement requirements.
```python def rotate(c,d): return c[d:]+c[:d] n,m = map(int,input().split()) c = [] if(m%n == 0): c = [m//n]*n else: c = [m//n]*(n-1) c.append(m-sum(c)) p = [] for i in range(n): p.append(rotate(c,i)) for i in p: print(*i) ```
3
250
B
Restoring IPv6
PROGRAMMING
1,500
[ "implementation", "strings" ]
null
null
An IPv6-address is a 128-bit number. For convenience, this number is recorded in blocks of 16 bits in hexadecimal record, the blocks are separated by colons β€” 8 blocks in total, each block has four hexadecimal digits. Here is an example of the correct record of a IPv6 address: "0124:5678:90ab:cdef:0124:5678:90ab:cdef". We'll call such format of recording an IPv6-address full. Besides the full record of an IPv6 address there is a short record format. The record of an IPv6 address can be shortened by removing one or more leading zeroes at the beginning of each block. However, each block should contain at least one digit in the short format. For example, the leading zeroes can be removed like that: "a56f:00d3:0000:0124:0001:f19a:1000:0000" <=β†’<= "a56f:d3:0:0124:01:f19a:1000:00". There are more ways to shorten zeroes in this IPv6 address. Some IPv6 addresses contain long sequences of zeroes. Continuous sequences of 16-bit zero blocks can be shortened to "::". A sequence can consist of one or several consecutive blocks, with all 16 bits equal to 0. You can see examples of zero block shortenings below: - "a56f:00d3:0000:0124:0001:0000:0000:0000" <=β†’<= "a56f:00d3:0000:0124:0001::"; - "a56f:0000:0000:0124:0001:0000:1234:0ff0" <=β†’<= "a56f::0124:0001:0000:1234:0ff0"; - "a56f:0000:0000:0000:0001:0000:1234:0ff0" <=β†’<= "a56f:0000::0000:0001:0000:1234:0ff0"; - "a56f:00d3:0000:0124:0001:0000:0000:0000" <=β†’<= "a56f:00d3:0000:0124:0001::0000"; - "0000:0000:0000:0000:0000:0000:0000:0000" <=β†’<= "::". It is not allowed to shorten zero blocks in the address more than once. This means that the short record can't contain the sequence of characters "::" more than once. Otherwise, it will sometimes be impossible to determine the number of zero blocks, each represented by a double colon. The format of the record of the IPv6 address after removing the leading zeroes and shortening the zero blocks is called short. You've got several short records of IPv6 addresses. Restore their full record.
The first line contains a single integer *n* β€” the number of records to restore (1<=≀<=*n*<=≀<=100). Each of the following *n* lines contains a string β€” the short IPv6 addresses. Each string only consists of string characters "0123456789abcdef:". It is guaranteed that each short address is obtained by the way that is described in the statement from some full IPv6 address.
For each short IPv6 address from the input print its full record on a separate line. Print the full records for the short IPv6 addresses in the order, in which the short records follow in the input.
[ "6\na56f:d3:0:0124:01:f19a:1000:00\na56f:00d3:0000:0124:0001::\na56f::0124:0001:0000:1234:0ff0\na56f:0000::0000:0001:0000:1234:0ff0\n::\n0ea::4d:f4:6:0\n" ]
[ "a56f:00d3:0000:0124:0001:f19a:1000:0000\na56f:00d3:0000:0124:0001:0000:0000:0000\na56f:0000:0000:0124:0001:0000:1234:0ff0\na56f:0000:0000:0000:0001:0000:1234:0ff0\n0000:0000:0000:0000:0000:0000:0000:0000\n00ea:0000:0000:0000:004d:00f4:0006:0000\n" ]
none
1,000
[ { "input": "6\na56f:d3:0:0124:01:f19a:1000:00\na56f:00d3:0000:0124:0001::\na56f::0124:0001:0000:1234:0ff0\na56f:0000::0000:0001:0000:1234:0ff0\n::\n0ea::4d:f4:6:0", "output": "a56f:00d3:0000:0124:0001:f19a:1000:0000\na56f:00d3:0000:0124:0001:0000:0000:0000\na56f:0000:0000:0124:0001:0000:1234:0ff0\na56f:0000:0000:0000:0001:0000:1234:0ff0\n0000:0000:0000:0000:0000:0000:0000:0000\n00ea:0000:0000:0000:004d:00f4:0006:0000" }, { "input": "20\n0:0:9e39:9:b21:c9b:c:0\n0:0:0:0:0:a27:6b:cb0a\n2:7:4d:b:0:3:2:f401\n17:2dc6::0:89e3:0:dc:0\nca:4:0:0:d6:b999:e:0\n4af:553:b29:dd7:2:5b:0:7\n0:c981:8f:a4d:0:d4:0:f61\n0:0:1:0:dc33:0:1964:0\n84:da:0:6d6:0ecc:1:f:0\n4:fb:4d37:0:8c:4:4a52:24\nc:e:a:0:0:0:e:0\n0:3761:72ed:b7:3b0:ff7:fc:102\n5ae:8ca7:10::0:9b2:0:525a\n0::ab:8d64:86:767:2\ne6b:3cb:0:81ce:0ac4:11::1\n4:0:5238:7b:591d:ff15:0:e\n0:f9a5:0::118e:dde:0\n0:d4c:feb:b:10a:0:d:e\n0:0:0:ff38:b5d:a3c2:f3:0\n2:a:6:c50:83:4f:7f0d::", "output": "0000:0000:9e39:0009:0b21:0c9b:000c:0000\n0000:0000:0000:0000:0000:0a27:006b:cb0a\n0002:0007:004d:000b:0000:0003:0002:f401\n0017:2dc6:0000:0000:89e3:0000:00dc:0000\n00ca:0004:0000:0000:00d6:b999:000e:0000\n04af:0553:0b29:0dd7:0002:005b:0000:0007\n0000:c981:008f:0a4d:0000:00d4:0000:0f61\n0000:0000:0001:0000:dc33:0000:1964:0000\n0084:00da:0000:06d6:0ecc:0001:000f:0000\n0004:00fb:4d37:0000:008c:0004:4a52:0024\n000c:000e:000a:0000:0000:0000:000e:0000\n0000:3761:72ed:00b7:03b0:0ff7:00fc:0102\n05ae:8ca7:0010:0000..." }, { "input": "10\n1::7\n0:0::1\n::1ed\n::30:44\n::eaf:ff:000b\n56fe::\ndf0:3df::\nd03:ab:0::\n85::0485:0\n::", "output": "0001:0000:0000:0000:0000:0000:0000:0007\n0000:0000:0000:0000:0000:0000:0000:0001\n0000:0000:0000:0000:0000:0000:0000:01ed\n0000:0000:0000:0000:0000:0000:0030:0044\n0000:0000:0000:0000:0000:0eaf:00ff:000b\n56fe:0000:0000:0000:0000:0000:0000:0000\n0df0:03df:0000:0000:0000:0000:0000:0000\n0d03:00ab:0000:0000:0000:0000:0000:0000\n0085:0000:0000:0000:0000:0000:0485:0000\n0000:0000:0000:0000:0000:0000:0000:0000" }, { "input": "6\n0:00:000:0000::\n1:01:001:0001::\nf:0f:00f:000f::\n1:10:100:1000::\nf:f0:f00:f000::\nf:ff:fff:ffff::", "output": "0000:0000:0000:0000:0000:0000:0000:0000\n0001:0001:0001:0001:0000:0000:0000:0000\n000f:000f:000f:000f:0000:0000:0000:0000\n0001:0010:0100:1000:0000:0000:0000:0000\n000f:00f0:0f00:f000:0000:0000:0000:0000\n000f:00ff:0fff:ffff:0000:0000:0000:0000" }, { "input": "3\n::\n::\n::", "output": "0000:0000:0000:0000:0000:0000:0000:0000\n0000:0000:0000:0000:0000:0000:0000:0000\n0000:0000:0000:0000:0000:0000:0000:0000" }, { "input": "4\n1:2:3:4:5:6:7:8\n0:0:0:0:0:0:0:0\nf:0f:00f:000f:ff:0ff:00ff:fff\n0fff:0ff0:0f0f:f0f:0f0:f0f0:f00f:ff0f", "output": "0001:0002:0003:0004:0005:0006:0007:0008\n0000:0000:0000:0000:0000:0000:0000:0000\n000f:000f:000f:000f:00ff:00ff:00ff:0fff\n0fff:0ff0:0f0f:0f0f:00f0:f0f0:f00f:ff0f" } ]
1,659,288,987
2,147,483,647
Python 3
OK
TESTS
40
92
0
# coding=utf8 cnt = input() for k in range(int(cnt)): ip = input() if ip == "": print("0000:0000:0000:0000:0000:0000:0000:0000") continue ip = ip.split(":") ret = "" # 扩:: if ip[0] == "": ip = ["0000"] * (8 - len(ip) + 2) + ip[2:] elif ip[-1] == "": ip = ip[:-2] + ["0000"] * (8 - len(ip) + 2) for i in range(len(ip)): if ip[i] == "": ip = ip[:i] + ["0000"] * (8 - len(ip) + 1) + ip[i + 1:] for i in range(len(ip)): if ip[i] != "": ip[i] = "0" * (4 - len(ip[i])) + ip[i] print(":".join(ip))
Title: Restoring IPv6 Time Limit: None seconds Memory Limit: None megabytes Problem Description: An IPv6-address is a 128-bit number. For convenience, this number is recorded in blocks of 16 bits in hexadecimal record, the blocks are separated by colons β€” 8 blocks in total, each block has four hexadecimal digits. Here is an example of the correct record of a IPv6 address: "0124:5678:90ab:cdef:0124:5678:90ab:cdef". We'll call such format of recording an IPv6-address full. Besides the full record of an IPv6 address there is a short record format. The record of an IPv6 address can be shortened by removing one or more leading zeroes at the beginning of each block. However, each block should contain at least one digit in the short format. For example, the leading zeroes can be removed like that: "a56f:00d3:0000:0124:0001:f19a:1000:0000" <=β†’<= "a56f:d3:0:0124:01:f19a:1000:00". There are more ways to shorten zeroes in this IPv6 address. Some IPv6 addresses contain long sequences of zeroes. Continuous sequences of 16-bit zero blocks can be shortened to "::". A sequence can consist of one or several consecutive blocks, with all 16 bits equal to 0. You can see examples of zero block shortenings below: - "a56f:00d3:0000:0124:0001:0000:0000:0000" <=β†’<= "a56f:00d3:0000:0124:0001::"; - "a56f:0000:0000:0124:0001:0000:1234:0ff0" <=β†’<= "a56f::0124:0001:0000:1234:0ff0"; - "a56f:0000:0000:0000:0001:0000:1234:0ff0" <=β†’<= "a56f:0000::0000:0001:0000:1234:0ff0"; - "a56f:00d3:0000:0124:0001:0000:0000:0000" <=β†’<= "a56f:00d3:0000:0124:0001::0000"; - "0000:0000:0000:0000:0000:0000:0000:0000" <=β†’<= "::". It is not allowed to shorten zero blocks in the address more than once. This means that the short record can't contain the sequence of characters "::" more than once. Otherwise, it will sometimes be impossible to determine the number of zero blocks, each represented by a double colon. The format of the record of the IPv6 address after removing the leading zeroes and shortening the zero blocks is called short. You've got several short records of IPv6 addresses. Restore their full record. Input Specification: The first line contains a single integer *n* β€” the number of records to restore (1<=≀<=*n*<=≀<=100). Each of the following *n* lines contains a string β€” the short IPv6 addresses. Each string only consists of string characters "0123456789abcdef:". It is guaranteed that each short address is obtained by the way that is described in the statement from some full IPv6 address. Output Specification: For each short IPv6 address from the input print its full record on a separate line. Print the full records for the short IPv6 addresses in the order, in which the short records follow in the input. Demo Input: ['6\na56f:d3:0:0124:01:f19a:1000:00\na56f:00d3:0000:0124:0001::\na56f::0124:0001:0000:1234:0ff0\na56f:0000::0000:0001:0000:1234:0ff0\n::\n0ea::4d:f4:6:0\n'] Demo Output: ['a56f:00d3:0000:0124:0001:f19a:1000:0000\na56f:00d3:0000:0124:0001:0000:0000:0000\na56f:0000:0000:0124:0001:0000:1234:0ff0\na56f:0000:0000:0000:0001:0000:1234:0ff0\n0000:0000:0000:0000:0000:0000:0000:0000\n00ea:0000:0000:0000:004d:00f4:0006:0000\n'] Note: none
```python # coding=utf8 cnt = input() for k in range(int(cnt)): ip = input() if ip == "": print("0000:0000:0000:0000:0000:0000:0000:0000") continue ip = ip.split(":") ret = "" # 扩:: if ip[0] == "": ip = ["0000"] * (8 - len(ip) + 2) + ip[2:] elif ip[-1] == "": ip = ip[:-2] + ["0000"] * (8 - len(ip) + 2) for i in range(len(ip)): if ip[i] == "": ip = ip[:i] + ["0000"] * (8 - len(ip) + 1) + ip[i + 1:] for i in range(len(ip)): if ip[i] != "": ip[i] = "0" * (4 - len(ip[i])) + ip[i] print(":".join(ip)) ```
3
859
B
Lazy Security Guard
PROGRAMMING
1,000
[ "brute force", "geometry", "math" ]
null
null
Your security guard friend recently got a new job at a new security company. The company requires him to patrol an area of the city encompassing exactly *N* city blocks, but they let him choose which blocks. That is, your friend must walk the perimeter of a region whose area is exactly *N* blocks. Your friend is quite lazy and would like your help to find the shortest possible route that meets the requirements. The city is laid out in a square grid pattern, and is large enough that for the sake of the problem it can be considered infinite.
Input will consist of a single integer *N* (1<=≀<=*N*<=≀<=106), the number of city blocks that must be enclosed by the route.
Print the minimum perimeter that can be achieved.
[ "4\n", "11\n", "22\n" ]
[ "8\n", "14\n", "20\n" ]
Here are some possible shapes for the examples: <img class="tex-graphics" src="https://espresso.codeforces.com/e11bef2cf82b55dd583cfc97d12b5aee5e483a65.png" style="max-width: 100.0%;max-height: 100.0%;"/>
750
[ { "input": "4", "output": "8" }, { "input": "11", "output": "14" }, { "input": "22", "output": "20" }, { "input": "3", "output": "8" }, { "input": "1024", "output": "128" }, { "input": "101", "output": "42" }, { "input": "30", "output": "22" }, { "input": "1000000", "output": "4000" }, { "input": "1", "output": "4" }, { "input": "2", "output": "6" }, { "input": "5", "output": "10" }, { "input": "6", "output": "10" }, { "input": "7", "output": "12" }, { "input": "8", "output": "12" }, { "input": "9", "output": "12" }, { "input": "10", "output": "14" }, { "input": "999000", "output": "3998" }, { "input": "999001", "output": "4000" }, { "input": "999999", "output": "4000" }, { "input": "933206", "output": "3866" }, { "input": "718351", "output": "3392" }, { "input": "607443", "output": "3118" }, { "input": "347887", "output": "2360" }, { "input": "246206", "output": "1986" }, { "input": "151375", "output": "1558" }, { "input": "12639", "output": "450" }, { "input": "3751", "output": "246" }, { "input": "3607", "output": "242" }, { "input": "124", "output": "46" }, { "input": "64", "output": "32" }, { "input": "31", "output": "24" }, { "input": "23", "output": "20" }, { "input": "15", "output": "16" }, { "input": "19", "output": "18" }, { "input": "59637", "output": "978" } ]
1,559,754,483
2,147,483,647
Python 3
OK
TESTS
35
109
0
from math import ceil x = int(input()) t = x**(1/2) if int(t)*ceil(t) >= x: print((int(t)+ceil(t))*2) else: print(ceil(t)*4)
Title: Lazy Security Guard Time Limit: None seconds Memory Limit: None megabytes Problem Description: Your security guard friend recently got a new job at a new security company. The company requires him to patrol an area of the city encompassing exactly *N* city blocks, but they let him choose which blocks. That is, your friend must walk the perimeter of a region whose area is exactly *N* blocks. Your friend is quite lazy and would like your help to find the shortest possible route that meets the requirements. The city is laid out in a square grid pattern, and is large enough that for the sake of the problem it can be considered infinite. Input Specification: Input will consist of a single integer *N* (1<=≀<=*N*<=≀<=106), the number of city blocks that must be enclosed by the route. Output Specification: Print the minimum perimeter that can be achieved. Demo Input: ['4\n', '11\n', '22\n'] Demo Output: ['8\n', '14\n', '20\n'] Note: Here are some possible shapes for the examples: <img class="tex-graphics" src="https://espresso.codeforces.com/e11bef2cf82b55dd583cfc97d12b5aee5e483a65.png" style="max-width: 100.0%;max-height: 100.0%;"/>
```python from math import ceil x = int(input()) t = x**(1/2) if int(t)*ceil(t) >= x: print((int(t)+ceil(t))*2) else: print(ceil(t)*4) ```
3
914
B
Conan and Agasa play a Card Game
PROGRAMMING
1,200
[ "games", "greedy", "implementation" ]
null
null
Edogawa Conan got tired of solving cases, and invited his friend, Professor Agasa, over. They decided to play a game of cards. Conan has *n* cards, and the *i*-th card has a number *a**i* written on it. They take turns playing, starting with Conan. In each turn, the player chooses a card and removes it. Also, he removes all cards having a number strictly lesser than the number on the chosen card. Formally, if the player chooses the *i*-th card, he removes that card and removes the *j*-th card for all *j* such that *a**j*<=&lt;<=*a**i*. A player loses if he cannot make a move on his turn, that is, he loses if there are no cards left. Predict the outcome of the game, assuming both players play optimally.
The first line contains an integer *n* (1<=≀<=*n*<=≀<=105)Β β€” the number of cards Conan has. The next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=105), where *a**i* is the number on the *i*-th card.
If Conan wins, print "Conan" (without quotes), otherwise print "Agasa" (without quotes).
[ "3\n4 5 7\n", "2\n1 1\n" ]
[ "Conan\n", "Agasa\n" ]
In the first example, Conan can just choose the card having number 7 on it and hence remove all the cards. After that, there are no cards left on Agasa's turn. In the second example, no matter which card Conan chooses, there will be one one card left, which Agasa can choose. After that, there are no cards left when it becomes Conan's turn again.
1,000
[ { "input": "3\n4 5 7", "output": "Conan" }, { "input": "2\n1 1", "output": "Agasa" }, { "input": "10\n38282 53699 38282 38282 38282 38282 38282 38282 38282 38282", "output": "Conan" }, { "input": "10\n50165 50165 50165 50165 50165 50165 50165 50165 50165 50165", "output": "Agasa" }, { "input": "10\n83176 83176 83176 23495 83176 8196 83176 23495 83176 83176", "output": "Conan" }, { "input": "10\n32093 36846 32093 32093 36846 36846 36846 36846 36846 36846", "output": "Conan" }, { "input": "3\n1 2 3", "output": "Conan" }, { "input": "4\n2 3 4 5", "output": "Conan" }, { "input": "10\n30757 30757 33046 41744 39918 39914 41744 39914 33046 33046", "output": "Conan" }, { "input": "10\n50096 50096 50096 50096 50096 50096 28505 50096 50096 50096", "output": "Conan" }, { "input": "10\n54842 54842 54842 54842 57983 54842 54842 57983 57983 54842", "output": "Conan" }, { "input": "10\n87900 87900 5761 87900 87900 87900 5761 87900 87900 87900", "output": "Agasa" }, { "input": "10\n53335 35239 26741 35239 35239 26741 35239 35239 53335 35239", "output": "Agasa" }, { "input": "10\n75994 64716 75994 64716 75994 75994 56304 64716 56304 64716", "output": "Agasa" }, { "input": "1\n1", "output": "Conan" }, { "input": "5\n2 2 1 1 1", "output": "Conan" }, { "input": "5\n1 4 4 5 5", "output": "Conan" }, { "input": "3\n1 3 3", "output": "Conan" }, { "input": "3\n2 2 2", "output": "Conan" }, { "input": "5\n1 1 1 2 2", "output": "Conan" }, { "input": "4\n1 2 1 2", "output": "Agasa" }, { "input": "7\n7 7 7 7 6 6 6", "output": "Conan" }, { "input": "3\n2 3 3", "output": "Conan" }, { "input": "3\n1 1 100000", "output": "Conan" }, { "input": "1\n100000", "output": "Conan" }, { "input": "5\n3 3 3 4 4", "output": "Conan" }, { "input": "3\n1 2 2", "output": "Conan" }, { "input": "3\n4 4 5", "output": "Conan" }, { "input": "1\n2", "output": "Conan" }, { "input": "3\n97 97 100", "output": "Conan" }, { "input": "5\n100000 100000 100000 1 1", "output": "Conan" }, { "input": "7\n7 7 6 6 5 5 4", "output": "Conan" }, { "input": "5\n100000 100000 100000 2 2", "output": "Conan" }, { "input": "4\n3 3 2 1", "output": "Conan" }, { "input": "1\n485", "output": "Conan" }, { "input": "3\n4 4 100000", "output": "Conan" }, { "input": "3\n1 1 2", "output": "Conan" }, { "input": "3\n1 1 1", "output": "Conan" }, { "input": "5\n1 1 2 2 2", "output": "Conan" } ]
1,538,127,584
2,147,483,647
Python 3
OK
TESTS
91
233
8,294,400
n = int(input()) s = [int(i) for i in input().split()] s.sort() dic = {} for x in s: if x not in dic: dic[x]=1 else: dic[x]+=1 for x in dic: if dic[x]%2==1: print("Conan") exit() print("Agasa") # def f(n,k,ls): # print(ls,type(n),k) # if k==0 and (n=="" or n==None): # return ls # elif k==0: # return -1; # for x in range(1,len(n)+1): # s =ls.copy() # s.append(n[0:x]) # res = f(n[x:],k-1,s) # if res!=-1: # print("res="+str(res)) # f("123456",3,[])
Title: Conan and Agasa play a Card Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Edogawa Conan got tired of solving cases, and invited his friend, Professor Agasa, over. They decided to play a game of cards. Conan has *n* cards, and the *i*-th card has a number *a**i* written on it. They take turns playing, starting with Conan. In each turn, the player chooses a card and removes it. Also, he removes all cards having a number strictly lesser than the number on the chosen card. Formally, if the player chooses the *i*-th card, he removes that card and removes the *j*-th card for all *j* such that *a**j*<=&lt;<=*a**i*. A player loses if he cannot make a move on his turn, that is, he loses if there are no cards left. Predict the outcome of the game, assuming both players play optimally. Input Specification: The first line contains an integer *n* (1<=≀<=*n*<=≀<=105)Β β€” the number of cards Conan has. The next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=105), where *a**i* is the number on the *i*-th card. Output Specification: If Conan wins, print "Conan" (without quotes), otherwise print "Agasa" (without quotes). Demo Input: ['3\n4 5 7\n', '2\n1 1\n'] Demo Output: ['Conan\n', 'Agasa\n'] Note: In the first example, Conan can just choose the card having number 7 on it and hence remove all the cards. After that, there are no cards left on Agasa's turn. In the second example, no matter which card Conan chooses, there will be one one card left, which Agasa can choose. After that, there are no cards left when it becomes Conan's turn again.
```python n = int(input()) s = [int(i) for i in input().split()] s.sort() dic = {} for x in s: if x not in dic: dic[x]=1 else: dic[x]+=1 for x in dic: if dic[x]%2==1: print("Conan") exit() print("Agasa") # def f(n,k,ls): # print(ls,type(n),k) # if k==0 and (n=="" or n==None): # return ls # elif k==0: # return -1; # for x in range(1,len(n)+1): # s =ls.copy() # s.append(n[0:x]) # res = f(n[x:],k-1,s) # if res!=-1: # print("res="+str(res)) # f("123456",3,[]) ```
3
433
B
Kuriyama Mirai's Stones
PROGRAMMING
1,200
[ "dp", "implementation", "sortings" ]
null
null
Kuriyama Mirai has killed many monsters and got many (namely *n*) stones. She numbers the stones from 1 to *n*. The cost of the *i*-th stone is *v**i*. Kuriyama Mirai wants to know something about these stones so she will ask you two kinds of questions: 1. She will tell you two numbers, *l* and *r*Β (1<=≀<=*l*<=≀<=*r*<=≀<=*n*), and you should tell her . 1. Let *u**i* be the cost of the *i*-th cheapest stone (the cost that will be on the *i*-th place if we arrange all the stone costs in non-decreasing order). This time she will tell you two numbers, *l* and *r*Β (1<=≀<=*l*<=≀<=*r*<=≀<=*n*), and you should tell her . For every question you should give the correct answer, or Kuriyama Mirai will say "fuyukai desu" and then become unhappy.
The first line contains an integer *n*Β (1<=≀<=*n*<=≀<=105). The second line contains *n* integers: *v*1,<=*v*2,<=...,<=*v**n*Β (1<=≀<=*v**i*<=≀<=109) β€” costs of the stones. The third line contains an integer *m*Β (1<=≀<=*m*<=≀<=105) β€” the number of Kuriyama Mirai's questions. Then follow *m* lines, each line contains three integers *type*, *l* and *r*Β (1<=≀<=*l*<=≀<=*r*<=≀<=*n*;Β 1<=≀<=*type*<=≀<=2), describing a question. If *type* equal to 1, then you should output the answer for the first question, else you should output the answer for the second one.
Print *m* lines. Each line must contain an integer β€” the answer to Kuriyama Mirai's question. Print the answers to the questions in the order of input.
[ "6\n6 4 2 7 2 7\n3\n2 3 6\n1 3 4\n1 1 6\n", "4\n5 5 2 3\n10\n1 2 4\n2 1 4\n1 1 1\n2 1 4\n2 1 2\n1 1 1\n1 3 3\n1 1 3\n1 4 4\n1 2 2\n" ]
[ "24\n9\n28\n", "10\n15\n5\n15\n5\n5\n2\n12\n3\n5\n" ]
Please note that the answers to the questions may overflow 32-bit integer type.
1,500
[ { "input": "6\n6 4 2 7 2 7\n3\n2 3 6\n1 3 4\n1 1 6", "output": "24\n9\n28" }, { "input": "4\n5 5 2 3\n10\n1 2 4\n2 1 4\n1 1 1\n2 1 4\n2 1 2\n1 1 1\n1 3 3\n1 1 3\n1 4 4\n1 2 2", "output": "10\n15\n5\n15\n5\n5\n2\n12\n3\n5" }, { "input": "4\n2 2 3 6\n9\n2 2 3\n1 1 3\n2 2 3\n2 2 3\n2 2 2\n1 1 3\n1 1 3\n2 1 4\n1 1 2", "output": "5\n7\n5\n5\n2\n7\n7\n13\n4" }, { "input": "18\n26 46 56 18 78 88 86 93 13 77 21 84 59 61 5 74 72 52\n25\n1 10 10\n1 9 13\n2 13 17\n1 8 14\n2 2 6\n1 12 16\n2 15 17\n2 3 6\n1 3 13\n2 8 9\n2 17 17\n1 17 17\n2 5 10\n2 1 18\n1 4 16\n1 1 13\n1 1 8\n2 7 11\n2 6 12\n1 5 9\n1 4 5\n2 7 15\n1 8 8\n1 8 14\n1 3 7", "output": "77\n254\n413\n408\n124\n283\n258\n111\n673\n115\n88\n72\n300\n1009\n757\n745\n491\n300\n420\n358\n96\n613\n93\n408\n326" }, { "input": "56\n43 100 44 66 65 11 26 75 96 77 5 15 75 96 11 44 11 97 75 53 33 26 32 33 90 26 68 72 5 44 53 26 33 88 68 25 84 21 25 92 1 84 21 66 94 35 76 51 11 95 67 4 61 3 34 18\n27\n1 20 38\n1 11 46\n2 42 53\n1 8 11\n2 11 42\n2 35 39\n2 37 41\n1 48 51\n1 32 51\n1 36 40\n1 31 56\n1 18 38\n2 9 51\n1 7 48\n1 15 52\n1 27 31\n2 5 19\n2 35 50\n1 31 34\n1 2 7\n2 15 33\n2 46 47\n1 26 28\n2 3 29\n1 23 45\n2 29 55\n1 14 29", "output": "880\n1727\n1026\n253\n1429\n335\n350\n224\n1063\n247\n1236\n1052\n2215\n2128\n1840\n242\n278\n1223\n200\n312\n722\n168\n166\n662\n1151\n2028\n772" }, { "input": "18\n38 93 48 14 69 85 26 47 71 11 57 9 38 65 72 78 52 47\n38\n2 10 12\n1 6 18\n2 2 2\n1 3 15\n2 1 16\n2 5 13\n1 9 17\n1 2 15\n2 5 17\n1 15 15\n2 4 11\n2 3 4\n2 2 5\n2 1 17\n2 6 16\n2 8 16\n2 8 14\n1 9 12\n2 8 13\n2 1 14\n2 5 13\n1 2 3\n1 9 14\n2 12 15\n2 3 3\n2 9 13\n2 4 12\n2 11 14\n2 6 16\n1 8 14\n1 12 15\n2 3 4\n1 3 5\n2 4 14\n1 6 6\n2 7 14\n2 7 18\n1 8 12", "output": "174\n658\n11\n612\n742\n461\n453\n705\n767\n72\n353\n40\n89\n827\n644\n559\n409\n148\n338\n592\n461\n141\n251\n277\n14\n291\n418\n262\n644\n298\n184\n40\n131\n558\n85\n456\n784\n195" }, { "input": "1\n2\n10\n1 1 1\n1 1 1\n2 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n2 1 1\n1 1 1\n1 1 1", "output": "2\n2\n2\n2\n2\n2\n2\n2\n2\n2" }, { "input": "2\n1 5\n8\n2 1 2\n1 1 1\n1 1 2\n1 1 1\n2 2 2\n2 1 2\n1 1 1\n1 2 2", "output": "6\n1\n6\n1\n5\n6\n1\n5" }, { "input": "8\n2 6 4 6 8 4 7 7\n9\n2 6 8\n1 2 3\n2 3 4\n2 1 2\n2 4 5\n1 3 8\n2 4 4\n2 2 4\n1 2 4", "output": "22\n10\n10\n6\n12\n36\n6\n14\n16" }, { "input": "4\n1 1 2 8\n9\n1 2 4\n1 2 4\n1 1 2\n2 3 4\n2 1 1\n1 2 3\n2 3 4\n1 1 4\n1 1 4", "output": "11\n11\n2\n10\n1\n3\n10\n12\n12" }, { "input": "5\n8 8 1 10 7\n5\n1 2 2\n1 1 4\n1 3 3\n1 2 2\n1 2 5", "output": "8\n27\n1\n8\n26" }, { "input": "10\n10 3 3 2 1 2 7 1 1 1\n4\n2 10 10\n2 6 6\n1 5 10\n1 6 8", "output": "10\n2\n13\n10" }, { "input": "6\n6 6 3 8 5 4\n3\n2 2 3\n2 1 5\n1 1 5", "output": "9\n24\n28" }, { "input": "1\n1\n2\n1 1 1\n2 1 1", "output": "1\n1" } ]
1,667,838,867
2,147,483,647
Python 3
OK
TESTS
46
1,076
8,704,000
R = lambda: map(int, input().split()) L = lambda: list(R()) n,=R() l = L() q,=R() sl=sorted(l) for i in range(1,n) : l[i]+=l[i-1] for i in range(1,n) : sl[i]+=sl[i-1] for i in range(q): t,left,right = R() if left != 1 : if t == 1 :print(l[right-1]-l[left-2]) else :print(sl[right-1]-sl[left-2]) else : if t == 1: print(l[right - 1]) else: print(sl[right - 1])
Title: Kuriyama Mirai's Stones Time Limit: None seconds Memory Limit: None megabytes Problem Description: Kuriyama Mirai has killed many monsters and got many (namely *n*) stones. She numbers the stones from 1 to *n*. The cost of the *i*-th stone is *v**i*. Kuriyama Mirai wants to know something about these stones so she will ask you two kinds of questions: 1. She will tell you two numbers, *l* and *r*Β (1<=≀<=*l*<=≀<=*r*<=≀<=*n*), and you should tell her . 1. Let *u**i* be the cost of the *i*-th cheapest stone (the cost that will be on the *i*-th place if we arrange all the stone costs in non-decreasing order). This time she will tell you two numbers, *l* and *r*Β (1<=≀<=*l*<=≀<=*r*<=≀<=*n*), and you should tell her . For every question you should give the correct answer, or Kuriyama Mirai will say "fuyukai desu" and then become unhappy. Input Specification: The first line contains an integer *n*Β (1<=≀<=*n*<=≀<=105). The second line contains *n* integers: *v*1,<=*v*2,<=...,<=*v**n*Β (1<=≀<=*v**i*<=≀<=109) β€” costs of the stones. The third line contains an integer *m*Β (1<=≀<=*m*<=≀<=105) β€” the number of Kuriyama Mirai's questions. Then follow *m* lines, each line contains three integers *type*, *l* and *r*Β (1<=≀<=*l*<=≀<=*r*<=≀<=*n*;Β 1<=≀<=*type*<=≀<=2), describing a question. If *type* equal to 1, then you should output the answer for the first question, else you should output the answer for the second one. Output Specification: Print *m* lines. Each line must contain an integer β€” the answer to Kuriyama Mirai's question. Print the answers to the questions in the order of input. Demo Input: ['6\n6 4 2 7 2 7\n3\n2 3 6\n1 3 4\n1 1 6\n', '4\n5 5 2 3\n10\n1 2 4\n2 1 4\n1 1 1\n2 1 4\n2 1 2\n1 1 1\n1 3 3\n1 1 3\n1 4 4\n1 2 2\n'] Demo Output: ['24\n9\n28\n', '10\n15\n5\n15\n5\n5\n2\n12\n3\n5\n'] Note: Please note that the answers to the questions may overflow 32-bit integer type.
```python R = lambda: map(int, input().split()) L = lambda: list(R()) n,=R() l = L() q,=R() sl=sorted(l) for i in range(1,n) : l[i]+=l[i-1] for i in range(1,n) : sl[i]+=sl[i-1] for i in range(q): t,left,right = R() if left != 1 : if t == 1 :print(l[right-1]-l[left-2]) else :print(sl[right-1]-sl[left-2]) else : if t == 1: print(l[right - 1]) else: print(sl[right - 1]) ```
3
918
A
Eleven
PROGRAMMING
800
[ "brute force", "implementation" ]
null
null
Eleven wants to choose a new name for herself. As a bunch of geeks, her friends suggested an algorithm to choose a name for her. Eleven wants her name to have exactly *n* characters. Her friend suggested that her name should only consist of uppercase and lowercase letters 'O'. More precisely, they suggested that the *i*-th letter of her name should be 'O' (uppercase) if *i* is a member of Fibonacci sequence, and 'o' (lowercase) otherwise. The letters in the name are numbered from 1 to *n*. Fibonacci sequence is the sequence *f* where - *f*1<==<=1, - *f*2<==<=1, - *f**n*<==<=*f**n*<=-<=2<=+<=*f**n*<=-<=1 (*n*<=&gt;<=2). As her friends are too young to know what Fibonacci sequence is, they asked you to help Eleven determine her new name.
The first and only line of input contains an integer *n* (1<=≀<=*n*<=≀<=1000).
Print Eleven's new name on the first and only line of output.
[ "8\n", "15\n" ]
[ "OOOoOooO\n", "OOOoOooOooooOoo\n" ]
none
500
[ { "input": "8", "output": "OOOoOooO" }, { "input": "15", "output": "OOOoOooOooooOoo" }, { "input": "85", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooo" }, { "input": "381", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooo" }, { "input": "805", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..." }, { "input": "1000", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..." }, { "input": "1", "output": "O" }, { "input": "2", "output": "OO" }, { "input": "3", "output": "OOO" }, { "input": "5", "output": "OOOoO" }, { "input": "17", "output": "OOOoOooOooooOoooo" }, { "input": "49", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooo" }, { "input": "256", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooo" }, { "input": "512", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..." }, { "input": "933", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..." }, { "input": "61", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooo" }, { "input": "781", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..." }, { "input": "999", "output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..." } ]
1,561,532,995
2,147,483,647
PyPy 3
OK
TESTS
18
124
0
a=0 b=1 c=1 arr=[c] n=input() n=int(n) s="" while c<=n: c=a+b a=b b=c arr.append(c) for i in range(1,n+1): if i in arr: s+="O" else: s+="o" print(s)
Title: Eleven Time Limit: None seconds Memory Limit: None megabytes Problem Description: Eleven wants to choose a new name for herself. As a bunch of geeks, her friends suggested an algorithm to choose a name for her. Eleven wants her name to have exactly *n* characters. Her friend suggested that her name should only consist of uppercase and lowercase letters 'O'. More precisely, they suggested that the *i*-th letter of her name should be 'O' (uppercase) if *i* is a member of Fibonacci sequence, and 'o' (lowercase) otherwise. The letters in the name are numbered from 1 to *n*. Fibonacci sequence is the sequence *f* where - *f*1<==<=1, - *f*2<==<=1, - *f**n*<==<=*f**n*<=-<=2<=+<=*f**n*<=-<=1 (*n*<=&gt;<=2). As her friends are too young to know what Fibonacci sequence is, they asked you to help Eleven determine her new name. Input Specification: The first and only line of input contains an integer *n* (1<=≀<=*n*<=≀<=1000). Output Specification: Print Eleven's new name on the first and only line of output. Demo Input: ['8\n', '15\n'] Demo Output: ['OOOoOooO\n', 'OOOoOooOooooOoo\n'] Note: none
```python a=0 b=1 c=1 arr=[c] n=input() n=int(n) s="" while c<=n: c=a+b a=b b=c arr.append(c) for i in range(1,n+1): if i in arr: s+="O" else: s+="o" print(s) ```
3
246
A
Buggy Sorting
PROGRAMMING
900
[ "constructive algorithms", "greedy", "sortings" ]
null
null
Little boy Valera studies an algorithm of sorting an integer array. After studying the theory, he went on to the practical tasks. As a result, he wrote a program that sorts an array of *n* integers *a*1,<=*a*2,<=...,<=*a**n* in the non-decreasing order. The pseudocode of the program, written by Valera, is given below. The input of the program gets number *n* and array *a*. But Valera could have made a mistake, because he hasn't yet fully learned the sorting algorithm. If Valera made a mistake in his program, you need to give a counter-example that makes his program work improperly (that is, the example that makes the program sort the array not in the non-decreasing order). If such example for the given value of *n* doesn't exist, print -1.
You've got a single integer *n* (1<=≀<=*n*<=≀<=50) β€” the size of the sorted array.
Print *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=100) β€” the counter-example, for which Valera's algorithm won't work correctly. If the counter-example that meets the described conditions is impossible to give, print -1. If there are several counter-examples, consisting of *n* numbers, you are allowed to print any of them.
[ "1\n" ]
[ "-1\n" ]
none
500
[ { "input": "1", "output": "-1" }, { "input": "2", "output": "-1" }, { "input": "3", "output": "3 2 1 " }, { "input": "4", "output": "4 3 2 1 " }, { "input": "5", "output": "5 4 3 2 1 " }, { "input": "6", "output": "6 5 4 3 2 1 " }, { "input": "7", "output": "7 6 5 4 3 2 1 " }, { "input": "8", "output": "8 7 6 5 4 3 2 1 " }, { "input": "9", "output": "9 8 7 6 5 4 3 2 1 " }, { "input": "50", "output": "50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 " }, { "input": "22", "output": "22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 " }, { "input": "34", "output": "34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 " }, { "input": "50", "output": "50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 " }, { "input": "12", "output": "12 11 10 9 8 7 6 5 4 3 2 1 " }, { "input": "26", "output": "26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 " }, { "input": "38", "output": "38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 " }, { "input": "4", "output": "4 3 2 1 " }, { "input": "18", "output": "18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 " }, { "input": "30", "output": "30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 " }, { "input": "46", "output": "46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 " }, { "input": "32", "output": "32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 " } ]
1,588,190,586
2,147,483,647
Python 3
OK
TESTS
21
108
0
n = int(input()) res = "" if n<3: print(-1) else: for u in range(-n,0): res = res + "{} ".format(-u) print(res[:-1])
Title: Buggy Sorting Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little boy Valera studies an algorithm of sorting an integer array. After studying the theory, he went on to the practical tasks. As a result, he wrote a program that sorts an array of *n* integers *a*1,<=*a*2,<=...,<=*a**n* in the non-decreasing order. The pseudocode of the program, written by Valera, is given below. The input of the program gets number *n* and array *a*. But Valera could have made a mistake, because he hasn't yet fully learned the sorting algorithm. If Valera made a mistake in his program, you need to give a counter-example that makes his program work improperly (that is, the example that makes the program sort the array not in the non-decreasing order). If such example for the given value of *n* doesn't exist, print -1. Input Specification: You've got a single integer *n* (1<=≀<=*n*<=≀<=50) β€” the size of the sorted array. Output Specification: Print *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=100) β€” the counter-example, for which Valera's algorithm won't work correctly. If the counter-example that meets the described conditions is impossible to give, print -1. If there are several counter-examples, consisting of *n* numbers, you are allowed to print any of them. Demo Input: ['1\n'] Demo Output: ['-1\n'] Note: none
```python n = int(input()) res = "" if n<3: print(-1) else: for u in range(-n,0): res = res + "{} ".format(-u) print(res[:-1]) ```
3
750
A
New Year and Hurry
PROGRAMMING
800
[ "binary search", "brute force", "implementation", "math" ]
null
null
Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5Β·*i* minutes to solve the *i*-th problem. Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first. How many problems can Limak solve if he wants to make it to the party?
The only line of the input contains two integers *n* and *k* (1<=≀<=*n*<=≀<=10, 1<=≀<=*k*<=≀<=240)Β β€” the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house.
Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier.
[ "3 222\n", "4 190\n", "7 1\n" ]
[ "2\n", "4\n", "7\n" ]
In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5 + 10 = 15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2. In the second sample, Limak can solve all 4 problems in 5 + 10 + 15 + 20 = 50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight. In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems.
500
[ { "input": "3 222", "output": "2" }, { "input": "4 190", "output": "4" }, { "input": "7 1", "output": "7" }, { "input": "10 135", "output": "6" }, { "input": "10 136", "output": "5" }, { "input": "1 1", "output": "1" }, { "input": "1 240", "output": "0" }, { "input": "10 1", "output": "9" }, { "input": "10 240", "output": "0" }, { "input": "9 240", "output": "0" }, { "input": "9 1", "output": "9" }, { "input": "9 235", "output": "1" }, { "input": "9 236", "output": "0" }, { "input": "5 225", "output": "2" }, { "input": "5 226", "output": "1" }, { "input": "4 210", "output": "3" }, { "input": "4 211", "output": "2" }, { "input": "4 191", "output": "3" }, { "input": "10 165", "output": "5" }, { "input": "10 166", "output": "4" }, { "input": "8 100", "output": "7" }, { "input": "8 101", "output": "6" }, { "input": "8 60", "output": "8" }, { "input": "8 61", "output": "7" }, { "input": "10 15", "output": "9" }, { "input": "10 16", "output": "8" }, { "input": "4 100", "output": "4" }, { "input": "4 101", "output": "4" }, { "input": "7 167", "output": "4" }, { "input": "10 164", "output": "5" }, { "input": "9 170", "output": "4" }, { "input": "8 160", "output": "5" }, { "input": "1 100", "output": "1" }, { "input": "8 123", "output": "6" }, { "input": "2 99", "output": "2" }, { "input": "10 88", "output": "7" }, { "input": "1 235", "output": "1" }, { "input": "1 1", "output": "1" }, { "input": "4 240", "output": "0" }, { "input": "1 55", "output": "1" }, { "input": "1 240", "output": "0" }, { "input": "3 240", "output": "0" }, { "input": "10 240", "output": "0" }, { "input": "2 240", "output": "0" }, { "input": "10 1", "output": "9" }, { "input": "9 1", "output": "9" }, { "input": "2 236", "output": "0" }, { "input": "10 2", "output": "9" }, { "input": "3 239", "output": "0" }, { "input": "1 237", "output": "0" }, { "input": "7 8", "output": "7" }, { "input": "10 235", "output": "1" } ]
1,697,642,415
2,147,483,647
Python 3
OK
TESTS
52
46
0
n,t = map(int, input().split(' ')) total_time = 0 h_time = 240-t result = 0 for i in range(n+1): n_time = 5 n_time*=i total_time+=n_time if total_time>h_time: pass else: result = i print(result)
Title: New Year and Hurry Time Limit: None seconds Memory Limit: None megabytes Problem Description: Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5Β·*i* minutes to solve the *i*-th problem. Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first. How many problems can Limak solve if he wants to make it to the party? Input Specification: The only line of the input contains two integers *n* and *k* (1<=≀<=*n*<=≀<=10, 1<=≀<=*k*<=≀<=240)Β β€” the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house. Output Specification: Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier. Demo Input: ['3 222\n', '4 190\n', '7 1\n'] Demo Output: ['2\n', '4\n', '7\n'] Note: In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5 + 10 = 15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2. In the second sample, Limak can solve all 4 problems in 5 + 10 + 15 + 20 = 50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight. In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems.
```python n,t = map(int, input().split(' ')) total_time = 0 h_time = 240-t result = 0 for i in range(n+1): n_time = 5 n_time*=i total_time+=n_time if total_time>h_time: pass else: result = i print(result) ```
3
408
A
Line to Cashier
PROGRAMMING
900
[ "implementation" ]
null
null
Little Vasya went to the supermarket to get some groceries. He walked about the supermarket for a long time and got a basket full of products. Now he needs to choose the cashier to pay for the products. There are *n* cashiers at the exit from the supermarket. At the moment the queue for the *i*-th cashier already has *k**i* people. The *j*-th person standing in the queue to the *i*-th cashier has *m**i*,<=*j* items in the basket. Vasya knows that: - the cashier needs 5 seconds to scan one item; - after the cashier scans each item of some customer, he needs 15 seconds to take the customer's money and give him the change. Of course, Vasya wants to select a queue so that he can leave the supermarket as soon as possible. Help him write a program that displays the minimum number of seconds after which Vasya can get to one of the cashiers.
The first line contains integer *n* (1<=≀<=*n*<=≀<=100)Β β€” the number of cashes in the shop. The second line contains *n* space-separated integers: *k*1,<=*k*2,<=...,<=*k**n* (1<=≀<=*k**i*<=≀<=100), where *k**i* is the number of people in the queue to the *i*-th cashier. The *i*-th of the next *n* lines contains *k**i* space-separated integers: *m**i*,<=1,<=*m**i*,<=2,<=...,<=*m**i*,<=*k**i* (1<=≀<=*m**i*,<=*j*<=≀<=100)Β β€” the number of products the *j*-th person in the queue for the *i*-th cash has.
Print a single integer β€” the minimum number of seconds Vasya needs to get to the cashier.
[ "1\n1\n1\n", "4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8\n" ]
[ "20\n", "100\n" ]
In the second test sample, if Vasya goes to the first queue, he gets to the cashier in 100Β·5 + 15 = 515 seconds. But if he chooses the second queue, he will need 1Β·5 + 2Β·5 + 2Β·5 + 3Β·5 + 4Β·15 = 100 seconds. He will need 1Β·5 + 9Β·5 + 1Β·5 + 3Β·15 = 100 seconds for the third one and 7Β·5 + 8Β·5 + 2Β·15 = 105 seconds for the fourth one. Thus, Vasya gets to the cashier quicker if he chooses the second or the third queue.
500
[ { "input": "1\n1\n1", "output": "20" }, { "input": "4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8", "output": "100" }, { "input": "4\n5 4 5 5\n3 1 3 1 2\n3 1 1 3\n1 1 1 2 2\n2 2 1 1 3", "output": "100" }, { "input": "5\n5 3 6 6 4\n7 5 3 3 9\n6 8 2\n1 10 8 5 9 2\n9 7 8 5 9 10\n9 8 3 3", "output": "125" }, { "input": "5\n10 10 10 10 10\n6 7 8 6 8 5 9 8 10 5\n9 6 9 8 7 8 8 10 8 5\n8 7 7 8 7 5 6 8 9 5\n6 5 10 5 5 10 7 8 5 5\n10 9 8 7 6 9 7 9 6 5", "output": "480" }, { "input": "10\n9 10 10 10 9 5 9 7 8 7\n11 6 10 4 4 15 7 15 5\n3 9 11 12 11 1 13 13 1 5\n6 15 9 12 3 2 8 12 11 10\n7 1 1 6 10 2 6 1 14 2\n8 14 2 3 6 1 14 1 12\n6 10 9 3 5\n13 12 12 7 13 4 4 8 10\n5 6 4 3 14 9 13\n8 12 1 5 7 4 13 1\n1 9 5 3 5 1 4", "output": "240" }, { "input": "10\n5 5 5 5 5 5 5 5 5 5\n5 5 4 5 4\n6 5 7 7 6\n5 4 4 5 5\n4 4 5 5 5\n7 6 4 5 7\n4 6 5 4 5\n6 6 7 6 6\n4 5 4 4 7\n7 5 4 4 5\n6 6 7 4 4", "output": "190" }, { "input": "1\n1\n100", "output": "515" }, { "input": "1\n90\n90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90", "output": "41850" } ]
1,396,524,571
870
Python 3
OK
TESTS
20
139
307,200
n = int(input()) people = list(map(int, input().split())) goods = [] for i in range(n): goods += [list(map(int, input().split()))] time = [] for j in range(n): time += [people[j] * 15 + sum(goods[j]) * 5] print(min(time))
Title: Line to Cashier Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Vasya went to the supermarket to get some groceries. He walked about the supermarket for a long time and got a basket full of products. Now he needs to choose the cashier to pay for the products. There are *n* cashiers at the exit from the supermarket. At the moment the queue for the *i*-th cashier already has *k**i* people. The *j*-th person standing in the queue to the *i*-th cashier has *m**i*,<=*j* items in the basket. Vasya knows that: - the cashier needs 5 seconds to scan one item; - after the cashier scans each item of some customer, he needs 15 seconds to take the customer's money and give him the change. Of course, Vasya wants to select a queue so that he can leave the supermarket as soon as possible. Help him write a program that displays the minimum number of seconds after which Vasya can get to one of the cashiers. Input Specification: The first line contains integer *n* (1<=≀<=*n*<=≀<=100)Β β€” the number of cashes in the shop. The second line contains *n* space-separated integers: *k*1,<=*k*2,<=...,<=*k**n* (1<=≀<=*k**i*<=≀<=100), where *k**i* is the number of people in the queue to the *i*-th cashier. The *i*-th of the next *n* lines contains *k**i* space-separated integers: *m**i*,<=1,<=*m**i*,<=2,<=...,<=*m**i*,<=*k**i* (1<=≀<=*m**i*,<=*j*<=≀<=100)Β β€” the number of products the *j*-th person in the queue for the *i*-th cash has. Output Specification: Print a single integer β€” the minimum number of seconds Vasya needs to get to the cashier. Demo Input: ['1\n1\n1\n', '4\n1 4 3 2\n100\n1 2 2 3\n1 9 1\n7 8\n'] Demo Output: ['20\n', '100\n'] Note: In the second test sample, if Vasya goes to the first queue, he gets to the cashier in 100Β·5 + 15 = 515 seconds. But if he chooses the second queue, he will need 1Β·5 + 2Β·5 + 2Β·5 + 3Β·5 + 4Β·15 = 100 seconds. He will need 1Β·5 + 9Β·5 + 1Β·5 + 3Β·15 = 100 seconds for the third one and 7Β·5 + 8Β·5 + 2Β·15 = 105 seconds for the fourth one. Thus, Vasya gets to the cashier quicker if he chooses the second or the third queue.
```python n = int(input()) people = list(map(int, input().split())) goods = [] for i in range(n): goods += [list(map(int, input().split()))] time = [] for j in range(n): time += [people[j] * 15 + sum(goods[j]) * 5] print(min(time)) ```
3
263
A
Beautiful Matrix
PROGRAMMING
800
[ "implementation" ]
null
null
You've got a 5<=Γ—<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix: 1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≀<=*i*<=&lt;<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≀<=*j*<=&lt;<=5). You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
Print a single integer β€” the minimum number of moves needed to make the matrix beautiful.
[ "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n", "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n" ]
[ "3\n", "1\n" ]
none
500
[ { "input": "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "0" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1", "output": "4" }, { "input": "0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "4" }, { "input": "0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "4" }, { "input": "0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0", "output": "1" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0", "output": "4" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0", "output": "3" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0", "output": "2" }, { "input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0", "output": "3" } ]
1,698,777,518
2,147,483,647
Python 3
OK
TESTS
25
62
0
i = 0 while i < 5: g = input() massiv = g.split() j = 0 while j < 5: l = massiv[j] if l == "1": rv = abs(2-i) rg = abs(2-j) print(rv+rg) j=j+1 i=i+1
Title: Beautiful Matrix Time Limit: None seconds Memory Limit: None megabytes Problem Description: You've got a 5<=Γ—<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix: 1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≀<=*i*<=&lt;<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≀<=*j*<=&lt;<=5). You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful. Input Specification: The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one. Output Specification: Print a single integer β€” the minimum number of moves needed to make the matrix beautiful. Demo Input: ['0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n', '0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n'] Demo Output: ['3\n', '1\n'] Note: none
```python i = 0 while i < 5: g = input() massiv = g.split() j = 0 while j < 5: l = massiv[j] if l == "1": rv = abs(2-i) rg = abs(2-j) print(rv+rg) j=j+1 i=i+1 ```
3
903
A
Hungry Student Problem
PROGRAMMING
900
[ "greedy", "implementation" ]
null
null
Ivan's classes at the university have just finished, and now he wants to go to the local CFK cafe and eat some fried chicken. CFK sells chicken chunks in small and large portions. A small portion contains 3 chunks; a large one β€” 7 chunks. Ivan wants to eat exactly *x* chunks. Now he wonders whether he can buy exactly this amount of chicken. Formally, Ivan wants to know if he can choose two non-negative integers *a* and *b* in such a way that *a* small portions and *b* large ones contain exactly *x* chunks. Help Ivan to answer this question for several values of *x*!
The first line contains one integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of testcases. The *i*-th of the following *n* lines contains one integer *x**i* (1<=≀<=*x**i*<=≀<=100) β€” the number of chicken chunks Ivan wants to eat.
Print *n* lines, in *i*-th line output YES if Ivan can buy exactly *x**i* chunks. Otherwise, print NO.
[ "2\n6\n5\n" ]
[ "YES\nNO\n" ]
In the first example Ivan can buy two small portions. In the second example Ivan cannot buy exactly 5 chunks, since one small portion is not enough, but two small portions or one large is too much.
0
[ { "input": "2\n6\n5", "output": "YES\nNO" }, { "input": "100\n1\n2\n3\n4\n5\n6\n7\n8\n9\n10\n11\n12\n13\n14\n15\n16\n17\n18\n19\n20\n21\n22\n23\n24\n25\n26\n27\n28\n29\n30\n31\n32\n33\n34\n35\n36\n37\n38\n39\n40\n41\n42\n43\n44\n45\n46\n47\n48\n49\n50\n51\n52\n53\n54\n55\n56\n57\n58\n59\n60\n61\n62\n63\n64\n65\n66\n67\n68\n69\n70\n71\n72\n73\n74\n75\n76\n77\n78\n79\n80\n81\n82\n83\n84\n85\n86\n87\n88\n89\n90\n91\n92\n93\n94\n95\n96\n97\n98\n99\n100", "output": "NO\nNO\nYES\nNO\nNO\nYES\nYES\nNO\nYES\nYES\nNO\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES" }, { "input": "3\n6\n6\n6", "output": "YES\nYES\nYES" }, { "input": "47\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1", "output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO" }, { "input": "3\n1\n52\n76", "output": "NO\nYES\nYES" }, { "input": "87\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100", "output": "YES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES" }, { "input": "3\n3\n2\n1", "output": "YES\nNO\nNO" }, { "input": "100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100", "output": "YES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES" } ]
1,615,390,261
2,147,483,647
PyPy 3
OK
TESTS
8
92
0
n=int(input()) for i in range(n): a=int(input()) a-=(a%3)*7 if a<0: print('NO') else: print('YES')
Title: Hungry Student Problem Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ivan's classes at the university have just finished, and now he wants to go to the local CFK cafe and eat some fried chicken. CFK sells chicken chunks in small and large portions. A small portion contains 3 chunks; a large one β€” 7 chunks. Ivan wants to eat exactly *x* chunks. Now he wonders whether he can buy exactly this amount of chicken. Formally, Ivan wants to know if he can choose two non-negative integers *a* and *b* in such a way that *a* small portions and *b* large ones contain exactly *x* chunks. Help Ivan to answer this question for several values of *x*! Input Specification: The first line contains one integer *n* (1<=≀<=*n*<=≀<=100) β€” the number of testcases. The *i*-th of the following *n* lines contains one integer *x**i* (1<=≀<=*x**i*<=≀<=100) β€” the number of chicken chunks Ivan wants to eat. Output Specification: Print *n* lines, in *i*-th line output YES if Ivan can buy exactly *x**i* chunks. Otherwise, print NO. Demo Input: ['2\n6\n5\n'] Demo Output: ['YES\nNO\n'] Note: In the first example Ivan can buy two small portions. In the second example Ivan cannot buy exactly 5 chunks, since one small portion is not enough, but two small portions or one large is too much.
```python n=int(input()) for i in range(n): a=int(input()) a-=(a%3)*7 if a<0: print('NO') else: print('YES') ```
3
450
A
Jzzhu and Children
PROGRAMMING
1,000
[ "implementation" ]
null
null
There are *n* children in Jzzhu's school. Jzzhu is going to give some candies to them. Let's number all the children from 1 to *n*. The *i*-th child wants to get at least *a**i* candies. Jzzhu asks children to line up. Initially, the *i*-th child stands at the *i*-th place of the line. Then Jzzhu start distribution of the candies. He follows the algorithm: 1. Give *m* candies to the first child of the line. 1. If this child still haven't got enough candies, then the child goes to the end of the line, else the child go home. 1. Repeat the first two steps while the line is not empty. Consider all the children in the order they go home. Jzzhu wants to know, which child will be the last in this order?
The first line contains two integers *n*,<=*m* (1<=≀<=*n*<=≀<=100;Β 1<=≀<=*m*<=≀<=100). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=100).
Output a single integer, representing the number of the last child.
[ "5 2\n1 3 1 4 2\n", "6 4\n1 1 2 2 3 3\n" ]
[ "4\n", "6\n" ]
Let's consider the first sample. Firstly child 1 gets 2 candies and go home. Then child 2 gets 2 candies and go to the end of the line. Currently the line looks like [3, 4, 5, 2] (indices of the children in order of the line). Then child 3 gets 2 candies and go home, and then child 4 gets 2 candies and goes to the end of the line. Currently the line looks like [5, 2, 4]. Then child 5 gets 2 candies and goes home. Then child 2 gets two candies and goes home, and finally child 4 gets 2 candies and goes home. Child 4 is the last one who goes home.
500
[ { "input": "5 2\n1 3 1 4 2", "output": "4" }, { "input": "6 4\n1 1 2 2 3 3", "output": "6" }, { "input": "7 3\n6 1 5 4 2 3 1", "output": "4" }, { "input": "10 5\n2 7 3 6 2 5 1 3 4 5", "output": "4" }, { "input": "100 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "100" }, { "input": "9 3\n9 5 2 3 7 1 8 4 6", "output": "7" }, { "input": "20 10\n58 4 32 10 73 7 30 39 47 6 59 21 24 66 79 79 46 13 29 58", "output": "16" }, { "input": "50 5\n89 56 3 2 40 37 56 52 83 59 43 83 43 59 29 74 22 58 53 41 53 67 78 30 57 32 58 29 95 46 45 85 60 49 41 82 8 71 52 40 45 26 6 71 84 91 4 93 40 54", "output": "48" }, { "input": "50 1\n4 3 9 7 6 8 3 7 10 9 8 8 10 2 9 3 2 4 4 10 4 6 8 10 9 9 4 2 8 9 4 4 9 5 1 5 2 4 4 9 10 2 5 10 7 2 8 6 8 1", "output": "44" }, { "input": "50 5\n3 9 10 8 3 3 4 6 8 2 9 9 3 1 2 10 6 8 7 2 7 4 2 7 5 10 2 2 2 5 10 5 6 6 8 7 10 4 3 2 10 8 6 6 8 6 4 4 1 3", "output": "46" }, { "input": "50 2\n56 69 72 15 95 92 51 1 74 87 100 29 46 54 18 81 84 72 84 83 20 63 71 27 45 74 50 89 48 8 21 15 47 3 39 73 80 84 6 99 17 25 56 3 74 64 71 39 89 78", "output": "40" }, { "input": "50 3\n31 39 64 16 86 3 1 9 25 54 98 42 20 3 49 41 73 37 55 62 33 77 64 22 33 82 26 13 10 13 7 40 48 18 46 79 94 72 19 12 11 61 16 37 10 49 14 94 48 69", "output": "11" }, { "input": "50 100\n67 67 61 68 42 29 70 77 12 61 71 27 4 73 87 52 59 38 93 90 31 27 87 47 26 57 76 6 28 72 81 68 50 84 69 79 39 93 52 6 88 12 46 13 90 68 71 38 90 95", "output": "50" }, { "input": "100 3\n4 14 20 11 19 11 14 20 5 7 6 12 11 17 5 11 7 6 2 10 13 5 12 8 5 17 20 18 7 19 11 7 7 20 20 8 10 17 17 19 20 5 15 16 19 7 11 16 4 17 2 10 1 20 20 16 19 9 9 11 5 7 12 9 9 6 20 18 13 19 8 4 8 1 2 4 10 11 15 14 1 7 17 12 13 19 12 2 3 14 15 15 5 17 14 12 17 14 16 9", "output": "86" }, { "input": "100 5\n16 8 14 16 12 11 17 19 19 2 8 9 5 6 19 9 11 18 6 9 14 16 14 18 17 17 17 5 15 20 19 7 7 10 10 5 14 20 5 19 11 16 16 19 17 9 7 12 14 10 2 11 14 5 20 8 10 11 19 2 14 14 19 17 5 10 8 8 4 2 1 10 20 12 14 11 7 6 6 15 1 5 9 15 3 17 16 17 5 14 11 9 16 15 1 11 10 6 15 7", "output": "93" }, { "input": "100 1\n58 94 18 50 17 14 96 62 83 80 75 5 9 22 25 41 3 96 74 45 66 37 2 37 13 85 68 54 77 11 85 19 25 21 52 59 90 61 72 89 82 22 10 16 3 68 61 29 55 76 28 85 65 76 27 3 14 10 56 37 86 18 35 38 56 68 23 88 33 38 52 87 55 83 94 34 100 41 83 56 91 77 32 74 97 13 67 31 57 81 53 39 5 88 46 1 79 4 49 42", "output": "77" }, { "input": "100 2\n1 51 76 62 34 93 90 43 57 59 52 78 3 48 11 60 57 48 5 54 28 81 87 23 44 77 67 61 14 73 29 53 21 89 67 41 47 9 63 37 1 71 40 85 4 14 77 40 78 75 89 74 4 70 32 65 81 95 49 90 72 41 76 55 69 83 73 84 85 93 46 6 74 90 62 37 97 7 7 37 83 30 37 88 34 16 11 59 85 19 57 63 85 20 63 97 97 65 61 48", "output": "97" }, { "input": "100 3\n30 83 14 55 61 66 34 98 90 62 89 74 45 93 33 31 75 35 82 100 63 69 48 18 99 2 36 71 14 30 70 76 96 85 97 90 49 36 6 76 37 94 70 3 63 73 75 48 39 29 13 2 46 26 9 56 1 18 54 53 85 34 2 12 1 93 75 67 77 77 14 26 33 25 55 9 57 70 75 6 87 66 18 3 41 69 73 24 49 2 20 72 39 58 91 54 74 56 66 78", "output": "20" }, { "input": "100 4\n69 92 76 3 32 50 15 38 21 22 14 3 67 41 95 12 10 62 83 52 78 1 18 58 94 35 62 71 58 75 13 73 60 34 50 97 50 70 19 96 53 10 100 26 20 39 62 59 88 26 24 83 70 68 66 8 6 38 16 93 2 91 81 89 78 74 21 8 31 56 28 53 77 5 81 5 94 42 77 75 92 15 59 36 61 18 55 45 69 68 81 51 12 42 85 74 98 31 17 41", "output": "97" }, { "input": "100 5\n2 72 10 60 6 50 72 34 97 77 35 43 80 64 40 53 46 6 90 22 29 70 26 68 52 19 72 88 83 18 55 32 99 81 11 21 39 42 41 63 60 97 30 23 55 78 89 35 24 50 99 52 27 76 24 8 20 27 51 37 17 82 69 18 46 19 26 77 52 83 76 65 43 66 84 84 13 30 66 88 84 23 37 1 17 26 11 50 73 56 54 37 40 29 35 8 1 39 50 82", "output": "51" }, { "input": "100 7\n6 73 7 54 92 33 66 65 80 47 2 53 28 59 61 16 54 89 37 48 77 40 49 59 27 52 17 22 78 80 81 80 8 93 50 7 87 57 29 16 89 55 20 7 51 54 30 98 44 96 27 70 1 1 32 61 22 92 84 98 31 89 91 90 28 56 49 25 86 49 55 16 19 1 18 8 88 47 16 18 73 86 2 96 16 91 74 49 38 98 94 25 34 85 29 27 99 31 31 58", "output": "97" }, { "input": "100 9\n36 4 45 16 19 6 10 87 44 82 71 49 70 35 83 19 40 76 45 94 44 96 10 54 82 77 86 63 11 37 21 3 15 89 80 88 89 16 72 23 25 9 51 25 10 45 96 5 6 18 51 31 42 57 41 51 42 15 89 61 45 82 16 48 61 67 19 40 9 33 90 36 78 36 79 79 16 10 83 87 9 22 84 12 23 76 36 14 2 81 56 33 56 23 57 84 76 55 35 88", "output": "47" }, { "input": "100 10\n75 81 39 64 90 58 92 28 75 9 96 78 92 83 77 68 76 71 14 46 58 60 80 25 78 11 13 63 22 82 65 68 47 6 33 63 90 50 85 43 73 94 80 48 67 11 83 17 22 15 94 80 66 99 66 4 46 35 52 1 62 39 96 57 37 47 97 49 64 12 36 63 90 16 4 75 85 82 85 56 13 4 92 45 44 93 17 35 22 46 18 44 29 7 52 4 100 98 87 51", "output": "98" }, { "input": "100 20\n21 19 61 70 54 97 98 14 61 72 25 94 24 56 55 25 12 80 76 11 35 17 80 26 11 94 52 47 84 61 10 2 74 25 10 21 2 79 55 50 30 75 10 64 44 5 60 96 52 16 74 41 20 77 20 44 8 86 74 36 49 61 99 13 54 64 19 99 50 43 12 73 48 48 83 55 72 73 63 81 30 27 95 9 97 82 24 3 89 90 33 14 47 88 22 78 12 75 58 67", "output": "94" }, { "input": "100 30\n56 79 59 23 11 23 67 82 81 80 99 79 8 58 93 36 98 81 46 39 34 67 3 50 4 68 70 71 2 21 52 30 75 23 33 21 16 100 56 43 8 27 40 8 56 24 17 40 94 10 67 49 61 36 95 87 17 41 7 94 33 19 17 50 26 11 94 54 38 46 77 9 53 35 98 42 50 20 43 6 78 6 38 24 100 45 43 16 1 50 16 46 14 91 95 88 10 1 50 19", "output": "95" }, { "input": "100 40\n86 11 97 17 38 95 11 5 13 83 67 75 50 2 46 39 84 68 22 85 70 23 64 46 59 93 39 80 35 78 93 21 83 19 64 1 49 59 99 83 44 81 70 58 15 82 83 47 55 65 91 10 2 92 4 77 37 32 12 57 78 11 42 8 59 21 96 69 61 30 44 29 12 70 91 14 10 83 11 75 14 10 19 39 8 98 5 81 66 66 79 55 36 29 22 45 19 24 55 49", "output": "88" }, { "input": "100 50\n22 39 95 69 94 53 80 73 33 90 40 60 2 4 84 50 70 38 92 12 36 74 87 70 51 36 57 5 54 6 35 81 52 17 55 100 95 81 32 76 21 1 100 1 95 1 40 91 98 59 84 19 11 51 79 19 47 86 45 15 62 2 59 77 31 68 71 92 17 33 10 33 85 57 5 2 88 97 91 99 63 20 63 54 79 93 24 62 46 27 30 87 3 64 95 88 16 50 79 1", "output": "99" }, { "input": "100 70\n61 48 89 17 97 6 93 13 64 50 66 88 24 52 46 99 6 65 93 64 82 37 57 41 47 1 84 5 97 83 79 46 16 35 40 7 64 15 44 96 37 17 30 92 51 67 26 3 14 56 27 68 66 93 36 39 51 6 40 55 79 26 71 54 8 48 18 2 71 12 55 60 29 37 31 97 26 37 25 68 67 70 3 87 100 41 5 82 65 92 24 66 76 48 89 8 40 93 31 95", "output": "100" }, { "input": "100 90\n87 32 30 15 10 52 93 63 84 1 82 41 27 51 75 32 42 94 39 53 70 13 4 22 99 35 44 38 5 23 18 100 61 80 9 12 42 93 9 77 3 7 60 95 66 78 95 42 69 8 1 88 93 66 96 20 76 63 15 36 92 52 2 72 36 57 48 63 29 20 74 88 49 47 81 61 94 74 70 93 47 3 19 52 59 41 5 40 22 3 76 97 91 37 95 88 91 99 76 15", "output": "98" }, { "input": "100 100\n79 75 7 28 6 96 38 35 57 95 41 74 24 96 32 78 81 13 63 84 24 95 3 23 66 1 60 6 96 49 41 5 14 18 31 97 66 19 49 89 49 70 51 28 20 99 18 1 28 77 24 46 69 21 40 32 31 66 28 6 66 97 9 16 70 90 91 30 34 82 93 41 65 11 39 52 1 88 63 43 80 50 60 49 28 56 18 76 24 57 74 1 28 99 36 35 79 54 18 16", "output": "100" }, { "input": "1 3\n5", "output": "1" }, { "input": "1 1\n100", "output": "1" }, { "input": "2 3\n4 2", "output": "1" }, { "input": "2 5\n99 97", "output": "2" }, { "input": "3 4\n7 5 2", "output": "2" }, { "input": "3 50\n47 86 51", "output": "3" }, { "input": "5 100\n82 100 85 1 37", "output": "5" }, { "input": "5 20\n40 39 21 5 20", "output": "3" }, { "input": "1 27\n81", "output": "1" }, { "input": "20 13\n7 8 29 83 74 28 93 85 7 8 3 9 8 70 49 50 39 41 57 1", "output": "7" }, { "input": "2 1\n100 2", "output": "1" }, { "input": "2 2\n6 4", "output": "1" }, { "input": "5 2\n6 4 4 1 1", "output": "1" }, { "input": "1 4\n3", "output": "1" }, { "input": "3 2\n1 5 3", "output": "2" }, { "input": "3 1\n3 2 2", "output": "1" }, { "input": "3 1\n2 3 2", "output": "2" }, { "input": "5 1\n5 1 1 1 1", "output": "1" }, { "input": "2 3\n7 4", "output": "1" } ]
1,634,017,124
2,147,483,647
PyPy 3
OK
TESTS
49
93
20,172,800
import math n, m = map(int, input().split()) arr = list(map(int, input().split())) track, ans = [], [] for i in range(len(arr)): track.append(math.ceil(arr[i] / m)) a = max(track) for i in range(len(track)): if track[i] == a: ans.append(i + 1) print(max(ans))
Title: Jzzhu and Children Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are *n* children in Jzzhu's school. Jzzhu is going to give some candies to them. Let's number all the children from 1 to *n*. The *i*-th child wants to get at least *a**i* candies. Jzzhu asks children to line up. Initially, the *i*-th child stands at the *i*-th place of the line. Then Jzzhu start distribution of the candies. He follows the algorithm: 1. Give *m* candies to the first child of the line. 1. If this child still haven't got enough candies, then the child goes to the end of the line, else the child go home. 1. Repeat the first two steps while the line is not empty. Consider all the children in the order they go home. Jzzhu wants to know, which child will be the last in this order? Input Specification: The first line contains two integers *n*,<=*m* (1<=≀<=*n*<=≀<=100;Β 1<=≀<=*m*<=≀<=100). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=100). Output Specification: Output a single integer, representing the number of the last child. Demo Input: ['5 2\n1 3 1 4 2\n', '6 4\n1 1 2 2 3 3\n'] Demo Output: ['4\n', '6\n'] Note: Let's consider the first sample. Firstly child 1 gets 2 candies and go home. Then child 2 gets 2 candies and go to the end of the line. Currently the line looks like [3, 4, 5, 2] (indices of the children in order of the line). Then child 3 gets 2 candies and go home, and then child 4 gets 2 candies and goes to the end of the line. Currently the line looks like [5, 2, 4]. Then child 5 gets 2 candies and goes home. Then child 2 gets two candies and goes home, and finally child 4 gets 2 candies and goes home. Child 4 is the last one who goes home.
```python import math n, m = map(int, input().split()) arr = list(map(int, input().split())) track, ans = [], [] for i in range(len(arr)): track.append(math.ceil(arr[i] / m)) a = max(track) for i in range(len(track)): if track[i] == a: ans.append(i + 1) print(max(ans)) ```
3
316
B2
EKG
PROGRAMMING
1,600
[ "dfs and similar", "dp" ]
null
null
In the rush of modern life, people often forget how beautiful the world is. The time to enjoy those around them is so little that some even stand in queues to several rooms at the same time in the clinic, running from one queue to another. (Cultural note: standing in huge and disorganized queues for hours is a native tradition in Russia, dating back to the Soviet period. Queues can resemble crowds rather than lines. Not to get lost in such a queue, a person should follow a strict survival technique: you approach the queue and ask who the last person is, somebody answers and you join the crowd. Now you're the last person in the queue till somebody else shows up. You keep an eye on the one who was last before you as he is your only chance to get to your destination) I'm sure many people have had the problem when a stranger asks who the last person in the queue is and even dares to hint that he will be the last in the queue and then bolts away to some unknown destination. These are the representatives of the modern world, in which the ratio of lack of time is so great that they do not even watch foreign top-rated TV series. Such people often create problems in queues, because the newcomer does not see the last person in the queue and takes a place after the "virtual" link in this chain, wondering where this legendary figure has left. The Smart Beaver has been ill and he's made an appointment with a therapist. The doctor told the Beaver the sad news in a nutshell: it is necessary to do an electrocardiogram. The next day the Smart Beaver got up early, put on the famous TV series on download (three hours till the download's complete), clenched his teeth and bravely went to join a queue to the electrocardiogram room, which is notorious for the biggest queues at the clinic. Having stood for about three hours in the queue, the Smart Beaver realized that many beavers had not seen who was supposed to stand in the queue before them and there was a huge mess. He came up to each beaver in the ECG room queue and asked who should be in front of him in the queue. If the beaver did not know his correct position in the queue, then it might be his turn to go get an ECG, or maybe he should wait for a long, long time... As you've guessed, the Smart Beaver was in a hurry home, so he gave you all the necessary information for you to help him to determine what his number in the queue can be.
The first line contains two integers *n* (1<=≀<=*n*<=≀<=103) and *x* (1<=≀<=*x*<=≀<=*n*) β€” the number of beavers that stand in the queue and the Smart Beaver's number, correspondingly. All willing to get to the doctor are numbered from 1 to *n*. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≀<=*a**i*<=≀<=*n*) β€” the number of the beaver followed by the *i*-th beaver. If *a**i*<==<=0, then the *i*-th beaver doesn't know who is should be in front of him. It is guaranteed that values *a**i* are correct. That is there is no cycles in the dependencies. And any beaver is followed by at most one beaver in the queue. The input limits for scoring 30 points are (subproblem B1): - It is guaranteed that the number of zero elements *a**i* doesn't exceed 20. The input limits for scoring 100 points are (subproblems B1+B2): - The number of zero elements *a**i* is arbitrary.
Print all possible positions of the Smart Beaver in the line in the increasing order.
[ "6 1\n2 0 4 0 6 0\n", "6 2\n2 3 0 5 6 0\n", "4 1\n0 0 0 0\n", "6 2\n0 0 1 0 4 5\n" ]
[ "2\n4\n6\n", "2\n5\n", "1\n2\n3\n4\n", "1\n3\n4\n6\n" ]
70
[ { "input": "6 1\n2 0 4 0 6 0", "output": "2\n4\n6" }, { "input": "6 2\n2 3 0 5 6 0", "output": "2\n5" }, { "input": "4 1\n0 0 0 0", "output": "1\n2\n3\n4" }, { "input": "6 2\n0 0 1 0 4 5", "output": "1\n3\n4\n6" }, { "input": "10 7\n10 8 6 5 0 0 0 4 3 9", "output": "1\n5\n6\n10" }, { "input": "10 1\n8 7 0 2 0 10 0 0 3 5", "output": "2\n4\n5\n7\n8\n10" }, { "input": "10 4\n0 1 4 2 7 0 10 0 5 8", "output": "3\n4\n8\n9" }, { "input": "10 2\n0 7 0 10 8 0 4 2 3 0", "output": "4\n5\n6\n7\n8" }, { "input": "10 2\n10 0 9 0 0 4 2 6 8 0", "output": "1\n2\n3\n4\n6\n7\n8\n9" }, { "input": "10 7\n7 9 2 10 0 0 0 3 5 1", "output": "1\n2\n6\n7" }, { "input": "20 20\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "1\n2\n3\n4\n5\n6\n7\n8\n9\n10\n11\n12\n13\n14\n15\n16\n17\n18\n19\n20" } ]
1,601,800,283
2,147,483,647
PyPy 3
OK
TESTS2
54
171
6,451,200
def put(): return map(int, input().split()) n,x = put() a = list(put()) parent = list(range(n+1)) for i in range(n): if a[i]!=0: parent[a[i]] = i+1 cnt = [] z = 0 #print(parent) for i in range(n): if a[i]==0: j = i+1 c = 1 found = False if j==x: z=c found = True while j != parent[j]: j = parent[j] c+=1 if j==x: z=c found = True if not found: cnt.append(c) #print(cnt,z) n,m = len(cnt)+1, sum(cnt)+1 dp = [[0]*(m+1) for i in range(n+1)] dp[0][0]=1 s = set() s.add(0) for i in range(1,n): for j in range(m): if j==0 or dp[i-1][j]==1 or (j-cnt[i-1]>=0 and dp[i-1][j-cnt[i-1]]==1) : dp[i][j] = 1 s.add(j) l = [] for i in s: l.append(i+z) l.sort() print(*l)
Title: EKG Time Limit: None seconds Memory Limit: None megabytes Problem Description: In the rush of modern life, people often forget how beautiful the world is. The time to enjoy those around them is so little that some even stand in queues to several rooms at the same time in the clinic, running from one queue to another. (Cultural note: standing in huge and disorganized queues for hours is a native tradition in Russia, dating back to the Soviet period. Queues can resemble crowds rather than lines. Not to get lost in such a queue, a person should follow a strict survival technique: you approach the queue and ask who the last person is, somebody answers and you join the crowd. Now you're the last person in the queue till somebody else shows up. You keep an eye on the one who was last before you as he is your only chance to get to your destination) I'm sure many people have had the problem when a stranger asks who the last person in the queue is and even dares to hint that he will be the last in the queue and then bolts away to some unknown destination. These are the representatives of the modern world, in which the ratio of lack of time is so great that they do not even watch foreign top-rated TV series. Such people often create problems in queues, because the newcomer does not see the last person in the queue and takes a place after the "virtual" link in this chain, wondering where this legendary figure has left. The Smart Beaver has been ill and he's made an appointment with a therapist. The doctor told the Beaver the sad news in a nutshell: it is necessary to do an electrocardiogram. The next day the Smart Beaver got up early, put on the famous TV series on download (three hours till the download's complete), clenched his teeth and bravely went to join a queue to the electrocardiogram room, which is notorious for the biggest queues at the clinic. Having stood for about three hours in the queue, the Smart Beaver realized that many beavers had not seen who was supposed to stand in the queue before them and there was a huge mess. He came up to each beaver in the ECG room queue and asked who should be in front of him in the queue. If the beaver did not know his correct position in the queue, then it might be his turn to go get an ECG, or maybe he should wait for a long, long time... As you've guessed, the Smart Beaver was in a hurry home, so he gave you all the necessary information for you to help him to determine what his number in the queue can be. Input Specification: The first line contains two integers *n* (1<=≀<=*n*<=≀<=103) and *x* (1<=≀<=*x*<=≀<=*n*) β€” the number of beavers that stand in the queue and the Smart Beaver's number, correspondingly. All willing to get to the doctor are numbered from 1 to *n*. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≀<=*a**i*<=≀<=*n*) β€” the number of the beaver followed by the *i*-th beaver. If *a**i*<==<=0, then the *i*-th beaver doesn't know who is should be in front of him. It is guaranteed that values *a**i* are correct. That is there is no cycles in the dependencies. And any beaver is followed by at most one beaver in the queue. The input limits for scoring 30 points are (subproblem B1): - It is guaranteed that the number of zero elements *a**i* doesn't exceed 20. The input limits for scoring 100 points are (subproblems B1+B2): - The number of zero elements *a**i* is arbitrary. Output Specification: Print all possible positions of the Smart Beaver in the line in the increasing order. Demo Input: ['6 1\n2 0 4 0 6 0\n', '6 2\n2 3 0 5 6 0\n', '4 1\n0 0 0 0\n', '6 2\n0 0 1 0 4 5\n'] Demo Output: ['2\n4\n6\n', '2\n5\n', '1\n2\n3\n4\n', '1\n3\n4\n6\n']
```python def put(): return map(int, input().split()) n,x = put() a = list(put()) parent = list(range(n+1)) for i in range(n): if a[i]!=0: parent[a[i]] = i+1 cnt = [] z = 0 #print(parent) for i in range(n): if a[i]==0: j = i+1 c = 1 found = False if j==x: z=c found = True while j != parent[j]: j = parent[j] c+=1 if j==x: z=c found = True if not found: cnt.append(c) #print(cnt,z) n,m = len(cnt)+1, sum(cnt)+1 dp = [[0]*(m+1) for i in range(n+1)] dp[0][0]=1 s = set() s.add(0) for i in range(1,n): for j in range(m): if j==0 or dp[i-1][j]==1 or (j-cnt[i-1]>=0 and dp[i-1][j-cnt[i-1]]==1) : dp[i][j] = 1 s.add(j) l = [] for i in s: l.append(i+z) l.sort() print(*l) ```
3
271
A
Beautiful Year
PROGRAMMING
800
[ "brute force" ]
null
null
It seems like the year of 2013 came only yesterday. Do you know a curious fact? The year of 2013 is the first year after the old 1987 with only distinct digits. Now you are suggested to solve the following problem: given a year number, find the minimum year number which is strictly larger than the given one and has only distinct digits.
The single line contains integer *y* (1000<=≀<=*y*<=≀<=9000) β€” the year number.
Print a single integer β€” the minimum year number that is strictly larger than *y* and all it's digits are distinct. It is guaranteed that the answer exists.
[ "1987\n", "2013\n" ]
[ "2013\n", "2014\n" ]
none
500
[ { "input": "1987", "output": "2013" }, { "input": "2013", "output": "2014" }, { "input": "1000", "output": "1023" }, { "input": "1001", "output": "1023" }, { "input": "1234", "output": "1235" }, { "input": "5555", "output": "5601" }, { "input": "9000", "output": "9012" }, { "input": "1111", "output": "1203" }, { "input": "8999", "output": "9012" }, { "input": "4572", "output": "4573" }, { "input": "6666", "output": "6701" }, { "input": "2001", "output": "2013" }, { "input": "3000", "output": "3012" }, { "input": "7712", "output": "7801" }, { "input": "8088", "output": "8091" }, { "input": "1594", "output": "1596" }, { "input": "6016", "output": "6017" }, { "input": "8800", "output": "8901" }, { "input": "3331", "output": "3401" }, { "input": "5090", "output": "5091" }, { "input": "2342", "output": "2345" }, { "input": "2334", "output": "2340" }, { "input": "1123", "output": "1203" }, { "input": "8989", "output": "9012" }, { "input": "8977", "output": "9012" }, { "input": "6869", "output": "6870" }, { "input": "8999", "output": "9012" } ]
1,694,530,242
2,147,483,647
Python 3
OK
TESTS
27
92
0
net=int(input())+1 while(len(set(str(net)))<4):net+=1 print(net)
Title: Beautiful Year Time Limit: None seconds Memory Limit: None megabytes Problem Description: It seems like the year of 2013 came only yesterday. Do you know a curious fact? The year of 2013 is the first year after the old 1987 with only distinct digits. Now you are suggested to solve the following problem: given a year number, find the minimum year number which is strictly larger than the given one and has only distinct digits. Input Specification: The single line contains integer *y* (1000<=≀<=*y*<=≀<=9000) β€” the year number. Output Specification: Print a single integer β€” the minimum year number that is strictly larger than *y* and all it's digits are distinct. It is guaranteed that the answer exists. Demo Input: ['1987\n', '2013\n'] Demo Output: ['2013\n', '2014\n'] Note: none
```python net=int(input())+1 while(len(set(str(net)))<4):net+=1 print(net) ```
3
958
B1
Maximum Control (easy)
PROGRAMMING
1,000
[ "implementation" ]
null
null
The Resistance is trying to take control over all planets in a particular solar system. This solar system is shaped like a tree. More precisely, some planets are connected by bidirectional hyperspace tunnels in such a way that there is a path between every pair of the planets, but removing any tunnel would disconnect some of them. The Resistance already has measures in place that will, when the time is right, enable them to control every planet that is not remote. A planet is considered to be remote if it is connected to the rest of the planets only via a single hyperspace tunnel. How much work is there left to be done: that is, how many remote planets are there?
The first line of the input contains an integer *N* (2<=≀<=*N*<=≀<=1000) – the number of planets in the galaxy. The next *N*<=-<=1 lines describe the hyperspace tunnels between the planets. Each of the *N*<=-<=1 lines contains two space-separated integers *u* and *v* (1<=≀<=*u*,<=*v*<=≀<=*N*) indicating that there is a bidirectional hyperspace tunnel between the planets *u* and *v*. It is guaranteed that every two planets are connected by a path of tunnels, and that each tunnel connects a different pair of planets.
A single integer denoting the number of remote planets.
[ "5\n4 1\n4 2\n1 3\n1 5\n", "4\n1 2\n4 3\n1 4\n" ]
[ "3\n", "2\n" ]
In the first example, only planets 2, 3 and 5 are connected by a single tunnel. In the second example, the remote planets are 2 and 3. Note that this problem has only two versions – easy and medium.
0
[ { "input": "5\n4 1\n4 2\n1 3\n1 5", "output": "3" }, { "input": "4\n1 2\n4 3\n1 4", "output": "2" }, { "input": "10\n4 3\n2 6\n10 1\n5 7\n5 8\n10 6\n5 9\n9 3\n2 9", "output": "4" } ]
1,586,521,603
2,147,483,647
Python 3
OK
TESTS
9
155
0
n=int(input()) pairs=[] remote=[] for i in range(n-1): n,k=list(map(int,input().split())) pairs.append(n) pairs.append(k) for i in pairs: if pairs.count(i)==1: remote.append(i) print(len(remote))
Title: Maximum Control (easy) Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Resistance is trying to take control over all planets in a particular solar system. This solar system is shaped like a tree. More precisely, some planets are connected by bidirectional hyperspace tunnels in such a way that there is a path between every pair of the planets, but removing any tunnel would disconnect some of them. The Resistance already has measures in place that will, when the time is right, enable them to control every planet that is not remote. A planet is considered to be remote if it is connected to the rest of the planets only via a single hyperspace tunnel. How much work is there left to be done: that is, how many remote planets are there? Input Specification: The first line of the input contains an integer *N* (2<=≀<=*N*<=≀<=1000) – the number of planets in the galaxy. The next *N*<=-<=1 lines describe the hyperspace tunnels between the planets. Each of the *N*<=-<=1 lines contains two space-separated integers *u* and *v* (1<=≀<=*u*,<=*v*<=≀<=*N*) indicating that there is a bidirectional hyperspace tunnel between the planets *u* and *v*. It is guaranteed that every two planets are connected by a path of tunnels, and that each tunnel connects a different pair of planets. Output Specification: A single integer denoting the number of remote planets. Demo Input: ['5\n4 1\n4 2\n1 3\n1 5\n', '4\n1 2\n4 3\n1 4\n'] Demo Output: ['3\n', '2\n'] Note: In the first example, only planets 2, 3 and 5 are connected by a single tunnel. In the second example, the remote planets are 2 and 3. Note that this problem has only two versions – easy and medium.
```python n=int(input()) pairs=[] remote=[] for i in range(n-1): n,k=list(map(int,input().split())) pairs.append(n) pairs.append(k) for i in pairs: if pairs.count(i)==1: remote.append(i) print(len(remote)) ```
3
464
C
Substitutes in Number
PROGRAMMING
2,100
[ "dp" ]
null
null
Andrew and Eugene are playing a game. Initially, Andrew has string *s*, consisting of digits. Eugene sends Andrew multiple queries of type "*d**i*<=β†’<=*t**i*", that means "replace all digits *d**i* in string *s* with substrings equal to *t**i*". For example, if *s*<==<=123123, then query "2<=β†’<=00" transforms *s* to 10031003, and query "3<=β†’<=" ("replace 3 by an empty string") transforms it to *s*<==<=1212. After all the queries Eugene asks Andrew to find the remainder after division of number with decimal representation equal to *s* by 1000000007Β (109<=+<=7). When you represent *s* as a decimal number, please ignore the leading zeroes; also if *s* is an empty string, then it's assumed that the number equals to zero. Andrew got tired of processing Eugene's requests manually and he asked you to write a program for that. Help him!
The first line contains string *s* (1<=≀<=|*s*|<=≀<=105), consisting of digitsΒ β€” the string before processing all the requests. The second line contains a single integer *n* (0<=≀<=*n*<=≀<=105)Β β€” the number of queries. The next *n* lines contain the descriptions of the queries. The *i*-th query is described by string "*d**i*-&gt;*t**i*", where *d**i* is exactly one digit (from 0 to 9), *t**i* is a string consisting of digits (*t**i* can be an empty string). The sum of lengths of *t**i* for all queries doesn't exceed 105. The queries are written in the order in which they need to be performed.
Print a single integer β€” remainder of division of the resulting number by 1000000007Β (109<=+<=7).
[ "123123\n1\n2-&gt;00\n", "123123\n1\n3-&gt;\n", "222\n2\n2-&gt;0\n0-&gt;7\n", "1000000008\n0\n" ]
[ "10031003\n", "1212\n", "777\n", "1\n" ]
Note that the leading zeroes are not removed from string *s* after the replacement (you can see it in the third sample).
1,500
[ { "input": "123123\n1\n2->00", "output": "10031003" }, { "input": "123123\n1\n3->", "output": "1212" }, { "input": "222\n2\n2->0\n0->7", "output": "777" }, { "input": "1000000008\n0", "output": "1" }, { "input": "100\n5\n1->301\n0->013\n1->013\n0->103\n0->103", "output": "624761980" }, { "input": "21222\n10\n1->\n2->1\n1->1\n1->1\n1->1\n1->22\n2->2\n2->1\n1->21\n1->", "output": "22222222" }, { "input": "21122\n10\n1->\n2->12\n1->\n2->21\n2->\n1->21\n1->\n2->12\n2->\n1->21", "output": "212121" }, { "input": "7048431802\n3\n0->9285051\n0->785476659\n6->3187205", "output": "106409986" }, { "input": "1\n10\n1->111\n1->111\n1->111\n1->111\n1->111\n1->111\n1->111\n1->111\n1->111\n1->111", "output": "97443114" }, { "input": "80125168586785605523636285409060490408816122518314\n0", "output": "410301862" }, { "input": "4432535330257407726572090980499847187198996038948464049414107600178053433384837707125968777715401617\n10\n1->\n3->\n5->\n2->\n9->\n0->\n4->\n6->\n7->\n8->", "output": "0" }, { "input": "332434109630379\n20\n7->1\n0->2\n3->6\n1->8\n6->8\n4->0\n9->8\n2->4\n4->8\n0->1\n1->7\n7->3\n3->4\n4->6\n6->3\n8->4\n3->8\n4->2\n2->8\n8->1", "output": "110333334" }, { "input": "88296041076454194379\n20\n5->62\n8->48\n4->\n1->60\n9->00\n6->16\n0->03\n6->\n3->\n1->\n7->02\n2->35\n8->86\n5->\n3->34\n4->\n8->\n0->\n3->46\n6->84", "output": "425093096" }, { "input": "19693141406182378241404307417907800263629336520110\n49\n2->\n0->\n3->\n9->\n6->\n5->\n1->\n4->\n8->\n7->0649713852\n0->\n4->\n5->\n3->\n1->\n8->\n7->\n9->\n6->\n2->2563194780\n0->\n8->\n1->\n3->\n5->\n4->\n7->\n2->\n6->\n9->8360512479\n0->\n3->\n6->\n4->\n2->\n9->\n7->\n1->\n8->\n5->8036451792\n7->\n6->\n5->\n1->\n2->\n0->\n8->\n9->\n4->", "output": "3333" } ]
1,411,944,561
2,147,483,647
Python 3
OK
TESTS
39
342
13,414,400
def main(): s = input() n = int(input()) M = 1000000007 a = {str(s):[10, s] for s in range(10)} d = [['_', s]] + [input().split('->') for _ in range(n)] for di, ti in reversed(d): _p = 1 _v = 0 for c in ti: _v = (_v * a[c][0] + a[c][1]) % M _p = (_p * a[c][0]) % M a[di] = [_p, _v] print(a['_'][1]) if __name__ == '__main__': main()
Title: Substitutes in Number Time Limit: None seconds Memory Limit: None megabytes Problem Description: Andrew and Eugene are playing a game. Initially, Andrew has string *s*, consisting of digits. Eugene sends Andrew multiple queries of type "*d**i*<=β†’<=*t**i*", that means "replace all digits *d**i* in string *s* with substrings equal to *t**i*". For example, if *s*<==<=123123, then query "2<=β†’<=00" transforms *s* to 10031003, and query "3<=β†’<=" ("replace 3 by an empty string") transforms it to *s*<==<=1212. After all the queries Eugene asks Andrew to find the remainder after division of number with decimal representation equal to *s* by 1000000007Β (109<=+<=7). When you represent *s* as a decimal number, please ignore the leading zeroes; also if *s* is an empty string, then it's assumed that the number equals to zero. Andrew got tired of processing Eugene's requests manually and he asked you to write a program for that. Help him! Input Specification: The first line contains string *s* (1<=≀<=|*s*|<=≀<=105), consisting of digitsΒ β€” the string before processing all the requests. The second line contains a single integer *n* (0<=≀<=*n*<=≀<=105)Β β€” the number of queries. The next *n* lines contain the descriptions of the queries. The *i*-th query is described by string "*d**i*-&gt;*t**i*", where *d**i* is exactly one digit (from 0 to 9), *t**i* is a string consisting of digits (*t**i* can be an empty string). The sum of lengths of *t**i* for all queries doesn't exceed 105. The queries are written in the order in which they need to be performed. Output Specification: Print a single integer β€” remainder of division of the resulting number by 1000000007Β (109<=+<=7). Demo Input: ['123123\n1\n2-&gt;00\n', '123123\n1\n3-&gt;\n', '222\n2\n2-&gt;0\n0-&gt;7\n', '1000000008\n0\n'] Demo Output: ['10031003\n', '1212\n', '777\n', '1\n'] Note: Note that the leading zeroes are not removed from string *s* after the replacement (you can see it in the third sample).
```python def main(): s = input() n = int(input()) M = 1000000007 a = {str(s):[10, s] for s in range(10)} d = [['_', s]] + [input().split('->') for _ in range(n)] for di, ti in reversed(d): _p = 1 _v = 0 for c in ti: _v = (_v * a[c][0] + a[c][1]) % M _p = (_p * a[c][0]) % M a[di] = [_p, _v] print(a['_'][1]) if __name__ == '__main__': main() ```
3
61
A
Ultra-Fast Mathematician
PROGRAMMING
800
[ "implementation" ]
A. Ultra-Fast Mathematician
2
256
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Write one line β€” the corresponding answer. Do not omit the leading 0s.
[ "1010100\n0100101\n", "000\n111\n", "1110\n1010\n", "01110\n01100\n" ]
[ "1110001\n", "111\n", "0100\n", "00010\n" ]
none
500
[ { "input": "1010100\n0100101", "output": "1110001" }, { "input": "000\n111", "output": "111" }, { "input": "1110\n1010", "output": "0100" }, { "input": "01110\n01100", "output": "00010" }, { "input": "011101\n000001", "output": "011100" }, { "input": "10\n01", "output": "11" }, { "input": "00111111\n11011101", "output": "11100010" }, { "input": "011001100\n101001010", "output": "110000110" }, { "input": "1100100001\n0110101100", "output": "1010001101" }, { "input": "00011101010\n10010100101", "output": "10001001111" }, { "input": "100000101101\n111010100011", "output": "011010001110" }, { "input": "1000001111010\n1101100110001", "output": "0101101001011" }, { "input": "01011111010111\n10001110111010", "output": "11010001101101" }, { "input": "110010000111100\n001100101011010", "output": "111110101100110" }, { "input": "0010010111110000\n0000000011010110", "output": "0010010100100110" }, { "input": "00111110111110000\n01111100001100000", "output": "01000010110010000" }, { "input": "101010101111010001\n001001111101111101", "output": "100011010010101100" }, { "input": "0110010101111100000\n0011000101000000110", "output": "0101010000111100110" }, { "input": "11110100011101010111\n00001000011011000000", "output": "11111100000110010111" }, { "input": "101010101111101101001\n111010010010000011111", "output": "010000111101101110110" }, { "input": "0000111111100011000010\n1110110110110000001010", "output": "1110001001010011001000" }, { "input": "10010010101000110111000\n00101110100110111000111", "output": "10111100001110001111111" }, { "input": "010010010010111100000111\n100100111111100011001110", "output": "110110101101011111001001" }, { "input": "0101110100100111011010010\n0101100011010111001010001", "output": "0000010111110000010000011" }, { "input": "10010010100011110111111011\n10000110101100000001000100", "output": "00010100001111110110111111" }, { "input": "000001111000000100001000000\n011100111101111001110110001", "output": "011101000101111101111110001" }, { "input": "0011110010001001011001011100\n0000101101000011101011001010", "output": "0011011111001010110010010110" }, { "input": "11111000000000010011001101111\n11101110011001010100010000000", "output": "00010110011001000111011101111" }, { "input": "011001110000110100001100101100\n001010000011110000001000101001", "output": "010011110011000100000100000101" }, { "input": "1011111010001100011010110101111\n1011001110010000000101100010101", "output": "0000110100011100011111010111010" }, { "input": "10111000100001000001010110000001\n10111000001100101011011001011000", "output": "00000000101101101010001111011001" }, { "input": "000001010000100001000000011011100\n111111111001010100100001100000111", "output": "111110101001110101100001111011011" }, { "input": "1101000000000010011011101100000110\n1110000001100010011010000011011110", "output": "0011000001100000000001101111011000" }, { "input": "01011011000010100001100100011110001\n01011010111000001010010100001110000", "output": "00000001111010101011110000010000001" }, { "input": "000011111000011001000110111100000100\n011011000110000111101011100111000111", "output": "011000111110011110101101011011000011" }, { "input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000", "output": "1011001001111001001011101010101000010" }, { "input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011", "output": "10001110000010101110000111000011111110" }, { "input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100", "output": "000100001011110000011101110111010001110" }, { "input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001", "output": "1101110101010110000011000000101011110011" }, { "input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100", "output": "11001011110010010000010111001100001001110" }, { "input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110", "output": "001100101000011111111101111011101010111001" }, { "input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001", "output": "0111010010100110110101100010000100010100000" }, { "input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100", "output": "11111110000000100101000100110111001100011001" }, { "input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011", "output": "101011011100100010100011011001101010100100010" }, { "input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001", "output": "1101001100111011010111110110101111001011110111" }, { "input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001", "output": "10010101000101000000011010011110011110011110001" }, { "input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100", "output": "011011011100000000010101110010000000101000111101" }, { "input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100", "output": "0101010111101001011011110110011101010101010100011" }, { "input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011", "output": "11001011010010111000010110011101100100001110111111" }, { "input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011", "output": "111011101010011100001111101001101011110010010110001" }, { "input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001", "output": "0100111110110011111110010010010000110111100101101101" }, { "input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100", "output": "01011001110111010111001100010011010100010000111011000" }, { "input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111", "output": "100011101001001000011011011001111000100000010100100100" }, { "input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110", "output": "1100110010000101101010111111101001001001110101110010110" }, { "input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110", "output": "01000111100111001011110010100011111111110010101100001101" }, { "input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010", "output": "110001010001000011000101110101000100001011111001011001001" }, { "input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111", "output": "1110100010111000101001001011101110011111100111000011011011" }, { "input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110", "output": "01110110101110100100110011010000001000101100101111000111011" }, { "input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011", "output": "111100101000000011101011011001110010101111000110010010000000" }, { "input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111", "output": "0100100010111110010011101010000011111110001110010110010111001" }, { "input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111", "output": "00110100000011001101101100100010110010001100000001100110011101" }, { "input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011", "output": "000000011000111011110011101000010000010100101000000011010110010" }, { "input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010", "output": "0010100110110100111100100100101101010100100111011010001001010101" }, { "input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111", "output": "11010110111100101111101001100001110100010110010110110111100110100" }, { "input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111", "output": "111111010011011100101110100110111111111001111110011010111111110000" }, { "input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110", "output": "1010101010100010001001001001100000111000010010010100010011000100000" }, { "input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000", "output": "00011111011111001000011100010011100011010100101011011000001001111110" }, { "input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111", "output": "001111000011001110100111010101111111011100110011001010010010000111011" }, { "input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101", "output": "0110001100110100010000110111000010011010011000011001010011010100010100" }, { "input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010", "output": "00010000000110110101000011001000000100100110111010011111101010001010000" }, { "input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001", "output": "000100100000000110011100100001010110101001100101110010010011111001110111" }, { "input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000", "output": "1000111100010011010110011101000000101010101100011111100001101111001010010" }, { "input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011", "output": "01000010011110111001011011110000001011000111101101101010010110001010100100" }, { "input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101", "output": "101101110110110010011100001011111100100001110000101100110000100011011100110" }, { "input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001", "output": "1110111111110010111000001100101010101011010100101010100101100011001001111111" }, { "input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111", "output": "10111011000111000101110100101000100111011011100011110110000101010001111010111" }, { "input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110", "output": "110100100110000101010010011010011001100110000111010000010100001011110111111101" }, { "input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111", "output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111" }, { "input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001", "output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001" }, { "input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110", "output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011" }, { "input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111", "output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101" }, { "input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010", "output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101" }, { "input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000", "output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001" }, { "input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011", "output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110" }, { "input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011", "output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011" }, { "input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011", "output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011" }, { "input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010", "output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011" }, { "input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001", "output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110" }, { "input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111", "output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010" }, { "input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011", "output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011" }, { "input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100", "output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000" }, { "input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001", "output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101" }, { "input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110", "output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101" }, { "input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011", "output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110" }, { "input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111", "output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110" }, { "input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000", "output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001" }, { "input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010", "output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101" }, { "input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101", "output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011" }, { "input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011", "output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010" }, { "input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010", "output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011" }, { "input": "0\n0", "output": "0" }, { "input": "0\n1", "output": "1" } ]
1,622,182,471
2,147,483,647
Python 3
OK
TESTS
102
77
0
s=input() k=input() l=[] for i in range(len(s)): l.append(int(s[i])^int(k[i])) for i in l: print(i,end="")
Title: Ultra-Fast Mathematician Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate. Input Specification: There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. Output Specification: Write one line β€” the corresponding answer. Do not omit the leading 0s. Demo Input: ['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n'] Demo Output: ['1110001\n', '111\n', '0100\n', '00010\n'] Note: none
```python s=input() k=input() l=[] for i in range(len(s)): l.append(int(s[i])^int(k[i])) for i in l: print(i,end="") ```
3.98075
676
A
Nicholas and Permutation
PROGRAMMING
800
[ "constructive algorithms", "implementation" ]
null
null
Nicholas has an array *a* that contains *n* distinct integers from 1 to *n*. In other words, Nicholas has a permutation of size *n*. Nicholas want the minimum element (integer 1) and the maximum element (integer *n*) to be as far as possible from each other. He wants to perform exactly one swap in order to maximize the distance between the minimum and the maximum elements. The distance between two elements is considered to be equal to the absolute difference between their positions.
The first line of the input contains a single integer *n* (2<=≀<=*n*<=≀<=100)Β β€” the size of the permutation. The second line of the input contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=*n*), where *a**i* is equal to the element at the *i*-th position.
Print a single integerΒ β€” the maximum possible distance between the minimum and the maximum elements Nicholas can achieve by performing exactly one swap.
[ "5\n4 5 1 3 2\n", "7\n1 6 5 3 4 7 2\n", "6\n6 5 4 3 2 1\n" ]
[ "3\n", "6\n", "5\n" ]
In the first sample, one may obtain the optimal answer by swapping elements 1 and 2. In the second sample, the minimum and the maximum elements will be located in the opposite ends of the array if we swap 7 and 2. In the third sample, the distance between the minimum and the maximum elements is already maximum possible, so we just perform some unnecessary swap, for example, one can swap 5 and 2.
500
[ { "input": "5\n4 5 1 3 2", "output": "3" }, { "input": "7\n1 6 5 3 4 7 2", "output": "6" }, { "input": "6\n6 5 4 3 2 1", "output": "5" }, { "input": "2\n1 2", "output": "1" }, { "input": "2\n2 1", "output": "1" }, { "input": "3\n2 3 1", "output": "2" }, { "input": "4\n4 1 3 2", "output": "3" }, { "input": "5\n1 4 5 2 3", "output": "4" }, { "input": "6\n4 6 3 5 2 1", "output": "5" }, { "input": "7\n1 5 3 6 2 4 7", "output": "6" }, { "input": "100\n76 70 67 54 40 1 48 63 64 36 42 90 99 27 47 17 93 7 13 84 16 57 74 5 83 61 19 56 52 92 38 91 82 79 34 66 71 28 37 98 35 94 77 53 73 10 26 80 15 32 8 81 3 95 44 46 72 6 33 11 21 85 4 30 24 51 49 96 87 55 14 31 12 60 45 9 29 22 58 18 88 2 50 59 20 86 23 41 100 39 62 68 69 97 78 43 25 89 65 75", "output": "94" }, { "input": "8\n4 5 3 8 6 7 1 2", "output": "6" }, { "input": "9\n6 8 5 3 4 7 9 2 1", "output": "8" }, { "input": "10\n8 7 10 1 2 3 4 6 5 9", "output": "7" }, { "input": "11\n5 4 6 9 10 11 7 3 1 2 8", "output": "8" }, { "input": "12\n3 6 7 8 9 10 12 5 4 2 11 1", "output": "11" }, { "input": "13\n8 4 3 7 5 11 9 1 10 2 13 12 6", "output": "10" }, { "input": "14\n6 10 13 9 7 1 12 14 3 2 5 4 11 8", "output": "8" }, { "input": "15\n3 14 13 12 7 2 4 11 15 1 8 6 5 10 9", "output": "9" }, { "input": "16\n11 6 9 8 7 14 12 13 10 15 2 5 3 1 4 16", "output": "15" }, { "input": "17\n13 12 5 3 9 16 8 14 2 4 10 1 6 11 7 15 17", "output": "16" }, { "input": "18\n8 6 14 17 9 11 15 13 5 3 18 1 2 7 12 16 4 10", "output": "11" }, { "input": "19\n12 19 3 11 15 6 18 14 5 10 2 13 9 7 4 8 17 16 1", "output": "18" }, { "input": "20\n15 17 10 20 7 2 16 9 13 6 18 5 19 8 11 14 4 12 3 1", "output": "19" }, { "input": "21\n1 9 14 18 13 12 11 20 16 2 4 19 15 7 6 17 8 5 3 10 21", "output": "20" }, { "input": "22\n8 3 17 4 16 21 14 11 10 15 6 18 13 12 22 20 5 2 9 7 19 1", "output": "21" }, { "input": "23\n1 23 11 20 9 3 12 4 7 17 5 15 2 10 18 16 8 22 14 13 19 21 6", "output": "22" }, { "input": "24\n2 10 23 22 20 19 18 16 11 12 15 17 21 8 24 13 1 5 6 7 14 3 9 4", "output": "16" }, { "input": "25\n12 13 22 17 1 18 14 5 21 2 10 4 3 23 11 6 20 8 24 16 15 19 9 7 25", "output": "24" }, { "input": "26\n6 21 20 16 26 17 11 2 24 4 1 12 14 8 25 7 15 10 22 5 13 18 9 23 19 3", "output": "21" }, { "input": "27\n20 14 18 10 5 3 9 4 24 22 21 27 17 15 26 2 23 7 12 11 6 8 19 25 16 13 1", "output": "26" }, { "input": "28\n28 13 16 6 1 12 4 27 22 7 18 3 21 26 25 11 5 10 20 24 19 15 14 8 23 17 9 2", "output": "27" }, { "input": "29\n21 11 10 25 2 5 9 16 29 8 17 4 15 13 6 22 7 24 19 12 18 20 1 3 23 28 27 14 26", "output": "22" }, { "input": "30\n6 19 14 22 26 17 27 8 25 3 24 30 4 18 23 16 9 13 29 20 15 2 5 11 28 12 1 10 21 7", "output": "26" }, { "input": "31\n29 13 26 27 9 28 2 16 30 21 12 11 3 31 23 6 22 20 1 5 14 24 19 18 8 4 10 17 15 25 7", "output": "18" }, { "input": "32\n15 32 11 3 18 23 19 14 5 8 6 21 13 24 25 4 16 9 27 20 17 31 2 22 7 12 30 1 26 10 29 28", "output": "30" }, { "input": "33\n22 13 10 33 8 25 15 14 21 28 27 19 26 24 1 12 5 11 32 20 30 31 18 4 6 23 7 29 16 2 17 9 3", "output": "29" }, { "input": "34\n34 30 7 16 6 1 10 23 29 13 15 25 32 26 18 11 28 3 14 21 19 5 31 33 4 17 8 9 24 20 27 22 2 12", "output": "33" }, { "input": "35\n24 33 20 8 34 11 31 25 2 4 18 13 9 35 16 30 23 32 17 1 14 22 19 21 28 26 3 15 5 12 27 29 10 6 7", "output": "21" }, { "input": "36\n1 32 27 35 22 7 34 15 18 36 31 28 13 2 10 21 20 17 16 4 3 24 19 29 11 12 25 5 33 26 14 6 9 23 30 8", "output": "35" }, { "input": "37\n24 1 12 23 11 6 30 15 4 21 13 20 25 17 5 8 36 19 32 26 14 9 7 18 10 29 37 35 16 2 22 34 3 27 31 33 28", "output": "35" }, { "input": "38\n9 35 37 28 36 21 10 25 19 4 26 5 22 7 27 18 6 14 15 24 1 17 11 34 20 8 2 16 3 23 32 31 13 12 38 33 30 29", "output": "34" }, { "input": "39\n16 28 4 33 26 36 25 23 22 30 27 7 12 34 17 6 3 38 10 24 13 31 29 39 14 32 9 20 35 11 18 21 8 2 15 37 5 19 1", "output": "38" }, { "input": "40\n35 39 28 11 9 31 36 8 5 32 26 19 38 33 2 22 23 25 6 37 12 7 3 10 17 24 20 16 27 4 34 15 40 14 18 13 29 21 30 1", "output": "39" }, { "input": "41\n24 18 7 23 3 15 1 17 25 5 30 10 34 36 2 14 9 21 41 40 20 28 33 35 12 22 11 8 19 16 31 27 26 32 29 4 13 38 37 39 6", "output": "34" }, { "input": "42\n42 15 24 26 4 34 19 29 38 32 31 33 14 41 21 3 11 39 25 6 5 20 23 10 16 36 18 28 27 1 7 40 22 30 9 2 37 17 8 12 13 35", "output": "41" }, { "input": "43\n43 24 20 13 22 29 28 4 30 3 32 40 31 8 7 9 35 27 18 5 42 6 17 19 23 12 41 21 16 37 33 34 2 14 36 38 25 10 15 39 26 11 1", "output": "42" }, { "input": "44\n4 38 6 40 29 3 44 2 30 35 25 36 34 10 11 31 21 7 14 23 37 19 27 18 5 22 1 16 17 9 39 13 15 32 43 8 41 26 42 12 24 33 20 28", "output": "37" }, { "input": "45\n45 29 24 2 31 5 34 41 26 44 33 43 15 3 4 11 21 37 27 12 14 39 23 42 16 6 13 19 8 38 20 9 25 22 40 17 32 35 18 10 28 7 30 36 1", "output": "44" }, { "input": "46\n29 3 12 33 45 40 19 17 25 27 28 1 16 23 24 46 31 8 44 15 5 32 22 11 4 36 34 10 35 26 21 7 14 2 18 9 20 41 6 43 42 37 38 13 39 30", "output": "34" }, { "input": "47\n7 3 8 12 24 16 29 10 28 38 1 20 37 40 21 5 15 6 45 23 36 44 25 43 41 4 11 42 18 35 32 31 39 33 27 30 22 34 14 13 17 47 19 9 46 26 2", "output": "41" }, { "input": "48\n29 26 14 18 34 33 13 39 32 1 37 20 35 19 28 48 30 23 46 27 5 22 24 38 12 15 8 36 43 45 16 47 6 9 31 40 44 17 2 41 11 42 25 4 21 3 10 7", "output": "38" }, { "input": "49\n16 7 42 32 11 35 15 8 23 41 6 20 47 24 9 45 49 2 37 48 25 28 5 18 3 19 12 4 22 33 13 14 10 36 44 17 40 38 30 26 1 43 29 46 21 34 27 39 31", "output": "40" }, { "input": "50\n31 45 3 34 13 43 32 4 42 9 7 8 24 14 35 6 19 46 44 17 18 1 25 20 27 41 2 16 12 10 11 47 38 21 28 49 30 15 50 36 29 26 22 39 48 5 23 37 33 40", "output": "38" }, { "input": "51\n47 29 2 11 43 44 27 1 39 14 25 30 33 21 38 45 34 51 16 50 42 31 41 46 15 48 13 19 6 37 35 7 22 28 20 4 17 10 5 8 24 40 9 36 18 49 12 26 23 3 32", "output": "43" }, { "input": "52\n16 45 23 7 15 19 43 20 4 32 35 36 9 50 5 26 38 46 13 33 12 2 48 37 41 31 10 28 8 42 3 21 11 1 17 27 34 30 44 40 6 51 49 47 25 22 18 24 52 29 14 39", "output": "48" }, { "input": "53\n53 30 50 22 51 31 32 38 12 7 39 43 1 23 6 8 24 52 2 21 34 13 3 35 5 15 19 11 47 18 9 20 29 4 36 45 27 41 25 48 16 46 44 17 10 14 42 26 40 28 33 37 49", "output": "52" }, { "input": "54\n6 39 17 3 45 52 16 21 23 48 42 36 13 37 46 10 43 27 49 7 38 32 31 30 15 25 2 29 8 51 54 19 41 44 24 34 22 5 20 14 12 1 33 40 4 26 9 35 18 28 47 50 11 53", "output": "41" }, { "input": "55\n26 15 31 21 32 43 34 51 7 12 5 44 17 54 18 25 48 47 20 3 41 24 45 2 11 22 29 39 37 53 35 28 36 9 50 10 30 38 19 13 4 8 27 1 42 6 49 23 55 40 33 16 46 14 52", "output": "48" }, { "input": "56\n6 20 38 46 10 11 40 19 5 1 47 33 4 18 32 36 37 45 56 49 48 52 12 26 31 14 2 9 24 3 16 51 41 43 23 17 34 7 29 50 55 25 39 44 22 27 54 8 28 35 30 42 13 53 21 15", "output": "46" }, { "input": "57\n39 28 53 36 3 6 12 56 55 20 50 19 43 42 18 40 24 52 38 17 33 23 22 41 14 7 26 44 45 16 35 1 8 47 31 5 30 51 32 4 37 25 13 34 54 21 46 10 15 11 2 27 29 48 49 9 57", "output": "56" }, { "input": "58\n1 26 28 14 22 33 57 40 9 42 44 37 24 19 58 12 48 3 34 31 49 4 16 47 55 52 27 23 46 18 20 32 56 6 39 36 41 38 13 43 45 21 53 54 29 17 5 10 25 30 2 35 11 7 15 51 8 50", "output": "57" }, { "input": "59\n1 27 10 37 53 9 14 49 46 26 50 42 59 11 47 15 24 56 43 45 44 38 5 8 58 30 52 12 23 32 22 3 31 41 2 25 29 6 54 16 35 33 18 55 4 51 57 28 40 19 13 21 7 39 36 48 34 17 20", "output": "58" }, { "input": "60\n60 27 34 32 54 55 33 12 40 3 47 44 50 39 38 59 11 25 17 15 16 30 21 31 10 52 5 23 4 48 6 26 36 57 14 22 8 56 58 9 24 7 37 53 42 43 20 49 51 19 2 46 28 18 35 13 29 45 41 1", "output": "59" }, { "input": "61\n61 11 26 29 31 40 32 30 35 3 18 52 9 53 42 4 50 54 20 58 28 49 22 12 2 19 16 15 57 34 51 43 7 17 25 41 56 47 55 60 46 14 44 45 24 27 33 1 48 13 59 23 38 39 6 5 36 10 8 37 21", "output": "60" }, { "input": "62\n21 23 34 38 11 61 55 30 37 48 54 51 46 47 6 56 36 49 1 35 12 28 29 20 43 42 5 8 22 57 44 4 53 10 58 33 27 25 16 45 50 40 18 15 3 41 39 2 7 60 59 13 32 24 52 31 14 9 19 26 17 62", "output": "61" }, { "input": "63\n2 5 29 48 31 26 21 16 47 24 43 22 61 28 6 39 60 27 14 52 37 7 53 8 62 56 63 10 50 18 44 13 4 9 25 11 23 42 45 41 59 12 32 36 40 51 1 35 49 54 57 20 19 34 38 46 33 3 55 15 30 58 17", "output": "46" }, { "input": "64\n23 5 51 40 12 46 44 8 64 31 58 55 45 24 54 39 21 19 52 61 30 42 16 18 15 32 53 22 28 26 11 25 48 56 27 9 29 41 35 49 59 38 62 7 34 1 20 33 60 17 2 3 43 37 57 14 6 36 13 10 50 4 63 47", "output": "55" }, { "input": "65\n10 11 55 43 53 25 35 26 16 37 41 38 59 21 48 2 65 49 17 23 18 30 62 36 3 4 47 15 28 63 57 54 31 46 44 12 51 7 29 13 56 52 14 22 39 19 8 27 45 5 6 34 32 61 20 50 9 24 33 58 60 40 1 42 64", "output": "62" }, { "input": "66\n66 39 3 2 55 53 60 54 12 49 10 30 59 26 32 46 50 56 7 13 43 36 24 28 11 8 6 21 35 25 42 57 23 45 64 5 34 61 27 51 52 9 15 1 38 17 63 48 37 20 58 14 47 19 22 41 31 44 33 65 4 62 40 18 16 29", "output": "65" }, { "input": "67\n66 16 2 53 35 38 49 28 18 6 36 58 21 47 27 5 50 62 44 12 52 37 11 56 15 31 25 65 17 29 59 41 7 42 4 43 39 10 1 40 24 13 20 54 19 67 46 60 51 45 64 30 8 33 26 9 3 22 34 23 57 48 55 14 63 61 32", "output": "45" }, { "input": "68\n13 6 27 21 65 23 59 14 62 43 33 31 38 41 67 20 16 25 42 4 28 40 29 9 64 17 2 26 32 58 60 53 46 48 47 54 44 50 39 19 30 57 61 1 11 18 37 24 55 15 63 34 8 52 56 7 10 12 35 66 5 36 45 49 68 22 51 3", "output": "64" }, { "input": "69\n29 49 25 51 21 35 11 61 39 54 40 37 60 42 27 33 59 53 34 10 46 2 23 69 8 47 58 36 1 38 19 12 7 48 13 3 6 22 18 5 65 24 50 41 66 44 67 57 4 56 62 43 9 30 14 15 28 31 64 26 16 55 68 17 32 20 45 52 63", "output": "45" }, { "input": "70\n19 12 15 18 36 16 61 69 24 7 11 13 3 48 55 21 37 17 43 31 41 22 28 32 27 63 38 49 59 56 30 25 67 51 52 45 50 44 66 57 26 60 5 46 33 6 23 34 8 40 2 68 14 39 65 64 62 42 47 54 10 53 9 1 70 58 20 4 29 35", "output": "64" }, { "input": "71\n40 6 62 3 41 52 31 66 27 16 35 5 17 60 2 15 51 22 67 61 71 53 1 64 8 45 28 18 50 30 12 69 20 26 10 37 36 49 70 32 33 11 57 14 9 55 4 58 29 25 44 65 39 48 24 47 19 46 56 38 34 42 59 63 54 23 7 68 43 13 21", "output": "50" }, { "input": "72\n52 64 71 40 32 10 62 21 11 37 38 13 22 70 1 66 41 50 27 20 42 47 25 68 49 12 15 72 44 60 53 5 23 14 43 29 65 36 51 54 35 67 7 19 55 48 58 46 39 24 33 30 61 45 57 2 31 3 18 59 6 9 4 63 8 16 26 34 28 69 17 56", "output": "57" }, { "input": "73\n58 38 47 34 39 64 69 66 72 57 9 4 67 22 35 13 61 14 28 52 56 20 31 70 27 24 36 1 62 17 10 5 12 33 16 73 18 49 63 71 44 65 23 30 40 8 50 46 60 25 11 26 37 55 29 68 42 2 3 32 59 7 15 43 41 48 51 53 6 45 54 19 21", "output": "45" }, { "input": "74\n19 51 59 34 8 40 42 55 65 16 74 26 49 63 64 70 35 72 7 12 43 18 61 27 47 31 13 32 71 22 25 67 9 1 48 50 33 10 21 46 11 45 17 37 28 60 69 66 38 2 30 3 39 15 53 68 57 41 6 36 24 73 4 23 5 62 44 14 20 29 52 54 56 58", "output": "63" }, { "input": "75\n75 28 60 19 59 17 65 26 32 23 18 64 8 62 4 11 42 16 47 5 72 46 9 1 25 21 2 50 33 6 36 68 30 12 20 40 53 45 34 7 37 39 38 44 63 61 67 3 66 51 29 73 24 57 70 27 10 56 22 55 13 49 35 15 54 41 14 74 69 48 52 31 71 43 58", "output": "74" }, { "input": "76\n1 47 54 17 38 37 12 32 14 48 43 71 60 56 4 13 64 41 52 57 62 24 23 49 20 10 63 3 25 66 59 40 58 33 53 46 70 7 35 61 72 74 73 19 30 5 29 6 15 28 21 27 51 55 50 9 65 8 67 39 76 42 31 34 16 2 36 11 26 44 22 45 75 18 69 68", "output": "75" }, { "input": "77\n10 20 57 65 53 69 59 45 58 32 28 72 4 14 1 33 40 47 7 5 51 76 37 16 41 61 42 2 21 26 38 74 35 64 43 77 71 50 39 48 27 63 73 44 52 66 9 18 23 54 25 6 8 56 13 67 36 22 15 46 62 75 55 11 31 17 24 29 60 68 12 30 3 70 49 19 34", "output": "62" }, { "input": "78\n7 61 69 47 68 42 65 78 70 3 32 59 49 51 23 71 11 63 22 18 43 34 24 13 27 16 19 40 21 46 48 77 28 66 54 67 60 15 75 62 9 26 52 58 4 25 8 37 41 76 1 6 30 50 44 36 5 14 29 53 17 12 2 57 73 35 64 39 56 10 33 20 45 74 31 55 38 72", "output": "70" }, { "input": "79\n75 79 43 66 72 52 29 65 74 38 24 1 5 51 13 7 71 33 4 61 2 36 63 47 64 44 34 27 3 21 17 37 54 53 49 20 28 60 39 10 16 76 6 77 73 22 50 48 78 30 67 56 31 26 40 59 41 11 18 45 69 62 15 23 32 70 19 55 68 57 35 25 12 46 14 42 9 8 58", "output": "77" }, { "input": "80\n51 20 37 12 68 11 28 52 76 21 7 5 3 16 64 34 25 2 6 40 60 62 75 13 45 17 56 29 32 47 79 73 49 72 15 46 30 54 80 27 43 24 74 18 42 71 14 4 44 63 65 33 1 77 55 57 41 59 58 70 69 35 19 67 10 36 26 23 48 50 39 61 9 66 38 8 31 22 53 78", "output": "52" }, { "input": "81\n63 22 4 41 43 74 64 39 10 35 20 81 11 28 70 67 53 79 16 61 68 52 27 37 58 9 50 49 18 30 72 47 7 60 78 51 23 48 73 66 44 13 15 57 56 38 1 76 25 45 36 34 42 8 75 26 59 14 71 21 6 77 5 17 2 32 40 54 46 24 29 3 31 19 65 62 33 69 12 80 55", "output": "69" }, { "input": "82\n50 24 17 41 49 18 80 11 79 72 57 31 21 35 2 51 36 66 20 65 38 3 45 32 59 81 28 30 70 55 29 76 73 6 33 39 8 7 19 48 63 1 77 43 4 13 78 54 69 9 40 46 74 82 60 71 16 64 12 14 47 26 44 5 10 75 53 25 27 15 56 42 58 34 23 61 67 62 68 22 37 52", "output": "53" }, { "input": "83\n64 8 58 17 67 46 3 82 23 70 72 16 53 45 13 20 12 48 40 4 6 47 76 60 19 44 30 78 28 22 75 15 25 29 63 74 55 32 14 51 35 31 62 77 27 42 65 71 56 61 66 41 68 49 7 34 2 83 36 5 33 26 37 80 59 50 1 9 54 21 18 24 38 73 81 52 10 39 43 79 57 11 69", "output": "66" }, { "input": "84\n75 8 66 21 61 63 72 51 52 13 59 25 28 58 64 53 79 41 34 7 67 11 39 56 44 24 50 9 49 55 1 80 26 6 73 74 27 69 65 37 18 43 36 17 30 3 47 29 76 78 32 22 12 68 46 5 42 81 57 31 33 83 54 48 14 62 10 16 4 20 71 70 35 15 45 19 60 77 2 23 84 40 82 38", "output": "80" }, { "input": "85\n1 18 58 8 22 76 3 61 12 33 54 41 6 24 82 15 10 17 38 64 26 4 62 28 47 14 66 9 84 75 2 71 67 43 37 32 85 21 69 52 55 63 81 51 74 59 65 34 29 36 30 45 27 53 13 79 39 57 5 70 19 40 7 42 68 48 16 80 83 23 46 35 72 31 11 44 73 77 50 56 49 25 60 20 78", "output": "84" }, { "input": "86\n64 56 41 10 31 69 47 39 37 36 27 19 9 42 15 6 78 59 52 17 71 45 72 14 2 54 38 79 4 18 16 8 46 75 50 82 44 24 20 55 58 86 61 43 35 32 33 40 63 30 28 60 13 53 12 57 77 81 76 66 73 84 85 62 68 22 51 5 49 7 1 70 80 65 34 48 23 21 83 11 74 26 29 67 25 3", "output": "70" }, { "input": "87\n14 20 82 47 39 75 71 45 3 37 63 19 32 68 7 41 48 76 27 46 84 49 4 44 26 69 17 64 1 18 58 33 11 23 21 86 67 52 70 16 77 78 6 74 15 87 10 59 13 34 22 2 65 38 66 61 51 57 35 60 81 40 36 80 31 43 83 56 79 55 29 5 12 8 50 30 53 72 54 9 24 25 42 62 73 28 85", "output": "58" }, { "input": "88\n1 83 73 46 61 31 39 86 57 43 16 29 26 80 82 7 36 42 13 20 6 64 19 40 24 12 47 87 8 34 75 9 69 3 11 52 14 25 84 59 27 10 54 51 81 74 65 77 70 17 60 35 23 44 49 2 4 88 5 21 41 32 68 66 15 55 48 58 78 53 22 38 45 33 30 50 85 76 37 79 63 18 28 62 72 56 71 67", "output": "87" }, { "input": "89\n68 40 14 58 56 25 8 44 49 55 9 76 66 54 33 81 42 15 59 17 21 30 75 60 4 48 64 6 52 63 61 27 12 57 72 67 23 86 77 80 22 13 43 73 26 78 50 51 18 62 1 29 82 16 74 2 87 24 3 41 11 46 47 69 10 84 65 39 35 79 70 32 34 31 20 19 53 71 36 28 83 88 38 85 7 5 37 45 89", "output": "88" }, { "input": "90\n2 67 26 58 9 49 76 22 60 30 77 20 13 7 37 81 47 16 19 12 14 45 41 68 85 54 28 24 46 1 27 43 32 89 53 35 59 75 18 51 17 64 66 80 31 88 87 90 38 72 55 71 42 11 73 69 62 78 23 74 65 79 84 4 86 52 10 6 3 82 56 5 48 33 21 57 40 29 61 63 34 36 83 8 15 44 50 70 39 25", "output": "60" }, { "input": "91\n91 69 56 16 73 55 14 82 80 46 57 81 22 71 63 76 43 37 77 75 70 3 26 2 28 17 51 38 30 67 41 47 54 62 34 25 84 11 87 39 32 52 31 36 50 19 21 53 29 24 79 8 74 64 44 7 6 18 10 42 13 9 83 58 4 88 65 60 20 90 66 49 86 89 78 48 5 27 23 59 61 15 72 45 40 33 68 85 35 12 1", "output": "90" }, { "input": "92\n67 57 76 78 25 89 6 82 11 16 26 17 59 48 73 10 21 31 27 80 4 5 22 13 92 55 45 85 63 28 75 60 54 88 91 47 29 35 7 87 1 39 43 51 71 84 83 81 46 9 38 56 90 24 37 41 19 86 50 61 79 20 18 14 69 23 62 65 49 52 58 53 36 2 68 64 15 42 30 34 66 32 44 40 8 33 3 77 74 12 70 72", "output": "67" }, { "input": "93\n76 35 5 87 7 21 59 71 24 37 2 73 31 74 4 52 28 20 56 27 65 86 16 45 85 67 68 70 47 72 91 88 14 32 62 69 78 41 15 22 57 18 50 13 39 58 17 83 64 51 25 11 38 77 82 90 8 26 29 61 10 43 79 53 48 6 23 55 63 49 81 92 80 44 89 60 66 30 1 9 36 33 19 46 75 93 3 12 42 84 40 54 34", "output": "85" }, { "input": "94\n29 85 82 78 61 83 80 63 11 38 50 43 9 24 4 87 79 45 3 17 90 7 34 27 1 76 26 39 84 47 22 41 81 19 44 23 56 92 35 31 72 62 70 53 40 88 13 14 73 2 59 86 46 94 15 12 77 57 89 42 75 48 18 51 32 55 71 30 49 91 20 60 5 93 33 64 21 36 10 28 8 65 66 69 74 58 6 52 25 67 16 37 54 68", "output": "69" }, { "input": "95\n36 73 18 77 15 71 50 57 79 65 94 88 9 69 52 70 26 66 78 89 55 20 72 83 75 68 32 28 45 74 19 22 54 23 84 90 86 12 42 58 11 81 39 31 85 47 60 44 59 43 21 7 30 41 64 76 93 46 87 48 10 40 3 14 38 49 29 35 2 67 5 34 13 37 27 56 91 17 62 80 8 61 53 95 24 92 6 82 63 33 51 25 4 16 1", "output": "94" }, { "input": "96\n64 3 47 83 19 10 72 61 73 95 16 40 54 84 8 86 28 4 37 42 92 48 63 76 67 1 59 66 20 35 93 2 43 7 45 70 34 33 26 91 85 89 13 29 58 68 44 25 87 75 49 71 41 17 55 36 32 31 74 22 52 79 30 88 50 78 38 39 65 27 69 77 81 94 82 53 21 80 57 60 24 46 51 9 18 15 96 62 6 23 11 12 90 5 14 56", "output": "86" }, { "input": "97\n40 63 44 64 84 92 38 41 28 91 3 70 76 67 94 96 35 79 29 22 78 88 85 8 21 1 93 54 71 80 37 17 13 26 62 59 75 87 69 33 89 49 77 61 12 39 6 36 58 18 73 50 82 45 74 52 11 34 95 7 23 30 15 32 31 16 55 19 20 83 60 72 10 53 51 14 27 9 68 47 5 2 81 46 57 86 56 43 48 66 24 25 4 42 65 97 90", "output": "95" }, { "input": "98\n85 94 69 86 22 52 27 79 53 91 35 55 33 88 8 75 76 95 64 54 67 30 70 49 6 16 2 48 80 32 25 90 98 46 9 96 36 81 10 92 28 11 37 97 15 41 38 40 83 44 29 47 23 3 31 61 87 39 78 20 68 12 17 73 59 18 77 72 43 51 84 24 89 65 26 7 74 93 21 19 5 14 50 42 82 71 60 56 34 62 58 57 45 66 13 63 4 1", "output": "97" }, { "input": "99\n33 48 19 41 59 64 16 12 17 13 7 1 9 6 4 92 61 49 60 25 74 65 22 97 30 32 10 62 14 55 80 66 82 78 31 23 87 93 27 98 20 29 88 84 77 34 83 96 79 90 56 89 58 72 52 47 21 76 24 70 44 94 5 39 8 18 57 36 40 68 43 75 3 2 35 99 63 26 67 73 15 11 53 28 42 46 69 50 51 95 38 37 54 85 81 91 45 86 71", "output": "87" }, { "input": "100\n28 30 77 4 81 67 31 25 66 56 88 73 83 51 57 34 21 90 38 76 22 99 53 70 91 3 64 54 6 94 8 5 97 80 50 45 61 40 16 95 36 98 9 2 17 44 72 55 18 58 47 12 87 24 7 32 14 23 65 41 63 48 62 39 92 27 43 19 46 13 42 52 96 84 26 69 100 79 93 49 35 60 71 59 68 15 10 29 20 1 78 33 75 86 11 85 74 82 89 37", "output": "89" }, { "input": "100\n100 97 35 55 45 3 46 98 77 64 94 85 73 43 49 79 72 9 70 62 80 88 29 58 61 20 89 83 66 86 82 15 6 87 42 96 90 75 63 38 81 40 5 23 4 18 41 19 99 60 8 12 76 51 39 93 53 26 21 50 47 28 13 30 68 59 34 54 24 56 31 27 65 16 32 10 36 52 44 91 22 14 33 25 7 78 67 17 57 37 92 11 2 69 84 95 74 71 48 1", "output": "99" }, { "input": "100\n83 96 73 70 30 25 7 77 58 89 76 85 49 82 45 51 14 62 50 9 31 32 16 15 97 64 4 37 20 93 24 10 80 71 100 39 75 72 78 74 8 29 53 86 79 48 3 68 90 99 56 87 63 94 36 1 40 65 6 44 43 84 17 52 34 95 38 47 60 57 98 59 33 41 46 81 23 27 19 2 54 91 55 35 26 12 92 18 28 66 69 21 5 67 13 11 22 88 61 42", "output": "65" }, { "input": "100\n96 80 47 60 56 9 78 20 37 72 68 15 100 94 51 26 65 38 50 19 4 70 25 63 22 30 13 58 43 69 18 33 5 66 39 73 12 55 95 92 97 1 14 83 10 28 64 31 46 91 32 86 74 54 29 52 89 53 90 44 62 40 16 24 67 81 36 34 7 23 79 87 75 98 84 3 41 77 76 42 71 35 49 61 2 27 59 82 99 85 21 11 45 6 88 48 17 57 8 93", "output": "87" }, { "input": "100\n5 6 88 37 97 51 25 81 54 17 57 98 99 44 67 24 30 93 100 36 8 38 84 42 21 4 75 31 85 48 70 77 43 50 65 94 29 32 68 86 56 39 69 47 20 60 52 53 10 34 79 2 95 40 89 64 71 26 22 46 1 62 91 76 83 41 9 78 16 63 13 3 28 92 27 49 7 12 96 72 80 23 14 19 18 66 59 87 90 45 73 82 33 74 35 61 55 15 58 11", "output": "81" }, { "input": "100\n100 97 92 12 62 17 19 58 37 26 30 95 31 35 87 10 13 43 98 61 28 89 76 1 23 21 11 22 50 56 91 74 3 24 96 55 64 67 14 4 71 16 18 9 77 68 51 81 32 82 46 88 86 60 29 66 72 85 70 7 53 63 33 45 83 2 25 94 52 93 5 69 20 47 49 54 57 39 34 27 90 80 78 59 40 42 79 6 38 8 48 15 65 73 99 44 41 84 36 75", "output": "99" }, { "input": "100\n22 47 34 65 69 5 68 78 53 54 41 23 80 51 11 8 2 85 81 75 25 58 29 73 30 49 10 71 17 96 76 89 79 20 12 15 55 7 46 32 19 3 82 35 74 44 38 40 92 14 6 50 97 63 45 93 37 18 62 77 87 36 83 9 90 61 57 28 39 43 52 42 24 56 21 84 26 99 88 59 33 70 4 60 98 95 94 100 13 48 66 72 16 31 64 91 1 86 27 67", "output": "96" }, { "input": "100\n41 67 94 18 14 83 59 12 19 54 13 68 75 26 15 65 80 40 23 30 34 78 47 21 63 79 4 70 3 31 86 69 92 10 61 74 97 100 9 99 32 27 91 55 85 52 16 17 28 1 64 29 58 76 98 25 84 7 2 96 20 72 36 46 49 82 93 44 45 6 38 87 57 50 53 35 60 33 8 89 39 42 37 48 62 81 73 43 95 11 66 88 90 22 24 77 71 51 5 56", "output": "62" }, { "input": "100\n1 88 38 56 62 99 39 80 12 33 57 24 28 84 37 42 10 95 83 58 8 40 20 2 30 78 60 79 36 71 51 31 27 65 22 47 6 19 61 94 75 4 74 35 15 23 92 9 70 13 11 59 90 18 66 81 64 72 16 32 34 67 46 91 21 87 77 97 82 41 7 86 26 43 45 3 93 17 52 96 50 63 48 5 53 44 29 25 98 54 49 14 73 69 89 55 76 85 68 100", "output": "99" }, { "input": "100\n22 59 25 77 68 79 32 45 20 28 61 60 38 86 33 10 100 15 53 75 78 39 67 13 66 34 96 4 63 23 73 29 31 35 71 55 16 14 72 56 94 97 17 93 47 84 57 8 21 51 54 85 26 76 49 81 2 92 62 44 91 87 11 24 95 69 5 7 99 6 65 48 70 12 41 18 74 27 42 3 80 30 50 98 58 37 82 89 83 36 40 52 19 9 88 46 43 1 90 64", "output": "97" }, { "input": "100\n12 1 76 78 97 82 59 80 48 8 91 51 54 74 16 10 89 99 83 63 93 90 55 25 30 33 29 6 9 65 92 79 44 39 15 58 37 46 32 19 27 3 75 49 62 71 98 42 69 50 26 81 96 5 7 61 60 21 20 36 18 34 40 4 47 85 64 38 22 84 2 68 11 56 31 66 17 14 95 43 53 35 23 52 70 13 72 45 41 77 73 87 88 94 28 86 24 67 100 57", "output": "98" }, { "input": "100\n66 100 53 88 7 73 54 41 31 42 8 46 65 90 78 14 94 30 79 39 89 5 83 50 38 61 37 86 22 95 60 98 34 57 91 10 75 25 15 43 23 17 96 35 93 48 87 47 56 13 19 9 82 62 67 80 11 55 99 70 18 26 58 85 12 44 16 45 4 49 20 71 92 24 81 2 76 32 6 21 84 36 52 97 59 63 40 51 27 64 68 3 77 72 28 33 29 1 74 69", "output": "98" }, { "input": "100\n56 64 1 95 72 39 9 49 87 29 94 7 32 6 30 48 50 25 31 78 90 45 60 44 80 68 17 20 73 15 75 98 83 13 71 22 36 26 96 88 35 3 85 54 16 41 92 99 69 86 93 33 43 62 77 46 47 37 12 10 18 40 27 4 63 55 28 59 23 34 61 53 76 42 51 91 21 70 8 58 38 19 5 66 84 11 52 24 81 82 79 67 97 65 57 74 2 89 100 14", "output": "98" }, { "input": "3\n1 2 3", "output": "2" }, { "input": "3\n1 3 2", "output": "2" }, { "input": "3\n2 1 3", "output": "2" }, { "input": "3\n2 3 1", "output": "2" }, { "input": "3\n3 1 2", "output": "2" }, { "input": "3\n3 2 1", "output": "2" }, { "input": "4\n1 2 3 4", "output": "3" }, { "input": "4\n1 2 4 3", "output": "3" }, { "input": "4\n1 3 2 4", "output": "3" }, { "input": "4\n1 3 4 2", "output": "3" }, { "input": "4\n1 4 2 3", "output": "3" }, { "input": "4\n1 4 3 2", "output": "3" }, { "input": "4\n2 1 3 4", "output": "3" }, { "input": "4\n2 1 4 3", "output": "2" }, { "input": "4\n2 4 1 3", "output": "2" }, { "input": "4\n2 4 3 1", "output": "3" }, { "input": "4\n3 1 2 4", "output": "3" }, { "input": "4\n3 1 4 2", "output": "2" }, { "input": "4\n3 2 1 4", "output": "3" }, { "input": "4\n3 2 4 1", "output": "3" }, { "input": "4\n3 4 1 2", "output": "2" }, { "input": "4\n3 4 2 1", "output": "3" }, { "input": "4\n4 1 2 3", "output": "3" }, { "input": "4\n4 1 3 2", "output": "3" }, { "input": "4\n4 2 1 3", "output": "3" }, { "input": "4\n4 2 3 1", "output": "3" }, { "input": "4\n4 3 1 2", "output": "3" }, { "input": "4\n4 3 2 1", "output": "3" }, { "input": "8\n2 5 6 4 8 3 1 7", "output": "6" }, { "input": "5\n2 3 1 5 4", "output": "3" }, { "input": "6\n2 5 3 6 4 1", "output": "5" }, { "input": "6\n5 4 2 6 1 3", "output": "4" }, { "input": "6\n4 2 3 1 6 5", "output": "4" }, { "input": "6\n5 4 2 1 6 3", "output": "4" }, { "input": "9\n7 2 3 4 5 6 1 9 8", "output": "7" }, { "input": "6\n3 2 1 4 6 5", "output": "4" }, { "input": "6\n2 3 4 1 6 5", "output": "4" }, { "input": "10\n5 2 3 4 1 6 7 8 10 9", "output": "8" }, { "input": "6\n5 2 3 1 6 4", "output": "4" }, { "input": "10\n2 9 3 4 1 10 5 6 7 8", "output": "5" }, { "input": "10\n2 3 4 5 6 7 1 8 10 9", "output": "8" }, { "input": "8\n2 3 4 5 1 6 8 7", "output": "6" }, { "input": "6\n2 1 3 4 5 6", "output": "5" } ]
1,621,466,780
2,147,483,647
Python 3
OK
TESTS
159
77
0
n = int(input()) ; l = [int(x) for x in input().split()] print(max(l.index(n), l.index(1), n - l.index(n) - 1, n - l.index(1) - 1))
Title: Nicholas and Permutation Time Limit: None seconds Memory Limit: None megabytes Problem Description: Nicholas has an array *a* that contains *n* distinct integers from 1 to *n*. In other words, Nicholas has a permutation of size *n*. Nicholas want the minimum element (integer 1) and the maximum element (integer *n*) to be as far as possible from each other. He wants to perform exactly one swap in order to maximize the distance between the minimum and the maximum elements. The distance between two elements is considered to be equal to the absolute difference between their positions. Input Specification: The first line of the input contains a single integer *n* (2<=≀<=*n*<=≀<=100)Β β€” the size of the permutation. The second line of the input contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≀<=*a**i*<=≀<=*n*), where *a**i* is equal to the element at the *i*-th position. Output Specification: Print a single integerΒ β€” the maximum possible distance between the minimum and the maximum elements Nicholas can achieve by performing exactly one swap. Demo Input: ['5\n4 5 1 3 2\n', '7\n1 6 5 3 4 7 2\n', '6\n6 5 4 3 2 1\n'] Demo Output: ['3\n', '6\n', '5\n'] Note: In the first sample, one may obtain the optimal answer by swapping elements 1 and 2. In the second sample, the minimum and the maximum elements will be located in the opposite ends of the array if we swap 7 and 2. In the third sample, the distance between the minimum and the maximum elements is already maximum possible, so we just perform some unnecessary swap, for example, one can swap 5 and 2.
```python n = int(input()) ; l = [int(x) for x in input().split()] print(max(l.index(n), l.index(1), n - l.index(n) - 1, n - l.index(1) - 1)) ```
3
41
A
Translation
PROGRAMMING
800
[ "implementation", "strings" ]
A. Translation
2
256
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the Β«translationΒ». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
[ "code\nedoc\n", "abb\naba\n", "code\ncode\n" ]
[ "YES\n", "NO\n", "NO\n" ]
none
500
[ { "input": "code\nedoc", "output": "YES" }, { "input": "abb\naba", "output": "NO" }, { "input": "code\ncode", "output": "NO" }, { "input": "abacaba\nabacaba", "output": "YES" }, { "input": "q\nq", "output": "YES" }, { "input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk", "output": "NO" }, { "input": "z\na", "output": "NO" }, { "input": "asd\ndsa", "output": "YES" }, { "input": "abcdef\nfecdba", "output": "NO" }, { "input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu", "output": "NO" }, { "input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf", "output": "NO" }, { "input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp", "output": "NO" }, { "input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb", "output": "NO" }, { "input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom", "output": "NO" }, { "input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh", "output": "NO" }, { "input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy", "output": "NO" }, { "input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko", "output": "NO" }, { "input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv", "output": "NO" }, { "input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd", "output": "NO" }, { "input": "w\nw", "output": "YES" }, { "input": "vz\nzv", "output": "YES" }, { "input": "ry\nyr", "output": "YES" }, { "input": "xou\nuox", "output": "YES" }, { "input": "axg\ngax", "output": "NO" }, { "input": "zdsl\nlsdz", "output": "YES" }, { "input": "kudl\nldku", "output": "NO" }, { "input": "zzlzwnqlcl\nlclqnwzlzz", "output": "YES" }, { "input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv", "output": "YES" }, { "input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar", "output": "NO" }, { "input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn", "output": "YES" }, { "input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum", "output": "YES" }, { "input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv", "output": "YES" }, { "input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm", "output": "NO" }, { "input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd", "output": "NO" }, { "input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg", "output": "YES" }, { "input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis", "output": "YES" }, { "input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy", "output": "NO" }, { "input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw", "output": "YES" }, { "input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi", "output": "YES" }, { "input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib", "output": "YES" } ]
1,652,456,519
2,147,483,647
Python 3
OK
TESTS
40
62
0
nor=[char for char in input()] ron=[char for char in input()] ron.reverse() if nor==ron: print('YES') else: print('NO')
Title: Translation Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the Β«translationΒ». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. Input Specification: The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. Output Specification: If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. Demo Input: ['code\nedoc\n', 'abb\naba\n', 'code\ncode\n'] Demo Output: ['YES\n', 'NO\n', 'NO\n'] Note: none
```python nor=[char for char in input()] ron=[char for char in input()] ron.reverse() if nor==ron: print('YES') else: print('NO') ```
3.9845
61
A
Ultra-Fast Mathematician
PROGRAMMING
800
[ "implementation" ]
A. Ultra-Fast Mathematician
2
256
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Write one line β€” the corresponding answer. Do not omit the leading 0s.
[ "1010100\n0100101\n", "000\n111\n", "1110\n1010\n", "01110\n01100\n" ]
[ "1110001\n", "111\n", "0100\n", "00010\n" ]
none
500
[ { "input": "1010100\n0100101", "output": "1110001" }, { "input": "000\n111", "output": "111" }, { "input": "1110\n1010", "output": "0100" }, { "input": "01110\n01100", "output": "00010" }, { "input": "011101\n000001", "output": "011100" }, { "input": "10\n01", "output": "11" }, { "input": "00111111\n11011101", "output": "11100010" }, { "input": "011001100\n101001010", "output": "110000110" }, { "input": "1100100001\n0110101100", "output": "1010001101" }, { "input": "00011101010\n10010100101", "output": "10001001111" }, { "input": "100000101101\n111010100011", "output": "011010001110" }, { "input": "1000001111010\n1101100110001", "output": "0101101001011" }, { "input": "01011111010111\n10001110111010", "output": "11010001101101" }, { "input": "110010000111100\n001100101011010", "output": "111110101100110" }, { "input": "0010010111110000\n0000000011010110", "output": "0010010100100110" }, { "input": "00111110111110000\n01111100001100000", "output": "01000010110010000" }, { "input": "101010101111010001\n001001111101111101", "output": "100011010010101100" }, { "input": "0110010101111100000\n0011000101000000110", "output": "0101010000111100110" }, { "input": "11110100011101010111\n00001000011011000000", "output": "11111100000110010111" }, { "input": "101010101111101101001\n111010010010000011111", "output": "010000111101101110110" }, { "input": "0000111111100011000010\n1110110110110000001010", "output": "1110001001010011001000" }, { "input": "10010010101000110111000\n00101110100110111000111", "output": "10111100001110001111111" }, { "input": "010010010010111100000111\n100100111111100011001110", "output": "110110101101011111001001" }, { "input": "0101110100100111011010010\n0101100011010111001010001", "output": "0000010111110000010000011" }, { "input": "10010010100011110111111011\n10000110101100000001000100", "output": "00010100001111110110111111" }, { "input": "000001111000000100001000000\n011100111101111001110110001", "output": "011101000101111101111110001" }, { "input": "0011110010001001011001011100\n0000101101000011101011001010", "output": "0011011111001010110010010110" }, { "input": "11111000000000010011001101111\n11101110011001010100010000000", "output": "00010110011001000111011101111" }, { "input": "011001110000110100001100101100\n001010000011110000001000101001", "output": "010011110011000100000100000101" }, { "input": "1011111010001100011010110101111\n1011001110010000000101100010101", "output": "0000110100011100011111010111010" }, { "input": "10111000100001000001010110000001\n10111000001100101011011001011000", "output": "00000000101101101010001111011001" }, { "input": "000001010000100001000000011011100\n111111111001010100100001100000111", "output": "111110101001110101100001111011011" }, { "input": "1101000000000010011011101100000110\n1110000001100010011010000011011110", "output": "0011000001100000000001101111011000" }, { "input": "01011011000010100001100100011110001\n01011010111000001010010100001110000", "output": "00000001111010101011110000010000001" }, { "input": "000011111000011001000110111100000100\n011011000110000111101011100111000111", "output": "011000111110011110101101011011000011" }, { "input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000", "output": "1011001001111001001011101010101000010" }, { "input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011", "output": "10001110000010101110000111000011111110" }, { "input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100", "output": "000100001011110000011101110111010001110" }, { "input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001", "output": "1101110101010110000011000000101011110011" }, { "input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100", "output": "11001011110010010000010111001100001001110" }, { "input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110", "output": "001100101000011111111101111011101010111001" }, { "input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001", "output": "0111010010100110110101100010000100010100000" }, { "input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100", "output": "11111110000000100101000100110111001100011001" }, { "input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011", "output": "101011011100100010100011011001101010100100010" }, { "input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001", "output": "1101001100111011010111110110101111001011110111" }, { "input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001", "output": "10010101000101000000011010011110011110011110001" }, { "input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100", "output": "011011011100000000010101110010000000101000111101" }, { "input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100", "output": "0101010111101001011011110110011101010101010100011" }, { "input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011", "output": "11001011010010111000010110011101100100001110111111" }, { "input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011", "output": "111011101010011100001111101001101011110010010110001" }, { "input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001", "output": "0100111110110011111110010010010000110111100101101101" }, { "input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100", "output": "01011001110111010111001100010011010100010000111011000" }, { "input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111", "output": "100011101001001000011011011001111000100000010100100100" }, { "input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110", "output": "1100110010000101101010111111101001001001110101110010110" }, { "input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110", "output": "01000111100111001011110010100011111111110010101100001101" }, { "input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010", "output": "110001010001000011000101110101000100001011111001011001001" }, { "input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111", "output": "1110100010111000101001001011101110011111100111000011011011" }, { "input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110", "output": "01110110101110100100110011010000001000101100101111000111011" }, { "input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011", "output": "111100101000000011101011011001110010101111000110010010000000" }, { "input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111", "output": "0100100010111110010011101010000011111110001110010110010111001" }, { "input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111", "output": "00110100000011001101101100100010110010001100000001100110011101" }, { "input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011", "output": "000000011000111011110011101000010000010100101000000011010110010" }, { "input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010", "output": "0010100110110100111100100100101101010100100111011010001001010101" }, { "input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111", "output": "11010110111100101111101001100001110100010110010110110111100110100" }, { "input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111", "output": "111111010011011100101110100110111111111001111110011010111111110000" }, { "input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110", "output": "1010101010100010001001001001100000111000010010010100010011000100000" }, { "input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000", "output": "00011111011111001000011100010011100011010100101011011000001001111110" }, { "input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111", "output": "001111000011001110100111010101111111011100110011001010010010000111011" }, { "input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101", "output": "0110001100110100010000110111000010011010011000011001010011010100010100" }, { "input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010", "output": "00010000000110110101000011001000000100100110111010011111101010001010000" }, { "input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001", "output": "000100100000000110011100100001010110101001100101110010010011111001110111" }, { "input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000", "output": "1000111100010011010110011101000000101010101100011111100001101111001010010" }, { "input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011", "output": "01000010011110111001011011110000001011000111101101101010010110001010100100" }, { "input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101", "output": "101101110110110010011100001011111100100001110000101100110000100011011100110" }, { "input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001", "output": "1110111111110010111000001100101010101011010100101010100101100011001001111111" }, { "input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111", "output": "10111011000111000101110100101000100111011011100011110110000101010001111010111" }, { "input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110", "output": "110100100110000101010010011010011001100110000111010000010100001011110111111101" }, { "input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111", "output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111" }, { "input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001", "output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001" }, { "input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110", "output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011" }, { "input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111", "output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101" }, { "input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010", "output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101" }, { "input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000", "output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001" }, { "input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011", "output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110" }, { "input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011", "output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011" }, { "input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011", "output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011" }, { "input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010", "output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011" }, { "input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001", "output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110" }, { "input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111", "output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010" }, { "input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011", "output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011" }, { "input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100", "output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000" }, { "input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001", "output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101" }, { "input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110", "output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101" }, { "input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011", "output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110" }, { "input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111", "output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110" }, { "input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000", "output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001" }, { "input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010", "output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101" }, { "input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101", "output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011" }, { "input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011", "output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010" }, { "input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010", "output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011" }, { "input": "0\n0", "output": "0" }, { "input": "0\n1", "output": "1" } ]
1,659,000,013
2,147,483,647
Python 3
OK
TESTS
102
46
0
p = input() h = input() f = -1 g = [] for i in p: f+=1 j = int(i)+int(h[f]) if j==2: j=0 g.append(j) for v in g: print(v,end = "")
Title: Ultra-Fast Mathematician Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second. One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part. In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0. Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length. Now you are going to take part in Shapur's contest. See if you are faster and more accurate. Input Specification: There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. Output Specification: Write one line β€” the corresponding answer. Do not omit the leading 0s. Demo Input: ['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n'] Demo Output: ['1110001\n', '111\n', '0100\n', '00010\n'] Note: none
```python p = input() h = input() f = -1 g = [] for i in p: f+=1 j = int(i)+int(h[f]) if j==2: j=0 g.append(j) for v in g: print(v,end = "") ```
3.9885
993
A
Two Squares
PROGRAMMING
1,600
[ "geometry", "implementation" ]
null
null
You are given two squares, one with sides parallel to the coordinate axes, and another one with sides at 45 degrees to the coordinate axes. Find whether the two squares intersect. The interior of the square is considered to be part of the square, i.e. if one square is completely inside another, they intersect. If the two squares only share one common point, they are also considered to intersect.
The input data consists of two lines, one for each square, both containing 4 pairs of integers. Each pair represents coordinates of one vertex of the square. Coordinates within each line are either in clockwise or counterclockwise order. The first line contains the coordinates of the square with sides parallel to the coordinate axes, the second line contains the coordinates of the square at 45 degrees. All the values are integer and between $-100$ and $100$.
Print "Yes" if squares intersect, otherwise print "No". You can print each letter in any case (upper or lower).
[ "0 0 6 0 6 6 0 6\n1 3 3 5 5 3 3 1\n", "0 0 6 0 6 6 0 6\n7 3 9 5 11 3 9 1\n", "6 0 6 6 0 6 0 0\n7 4 4 7 7 10 10 7\n" ]
[ "YES\n", "NO\n", "YES\n" ]
In the first example the second square lies entirely within the first square, so they do intersect. In the second sample squares do not have any points in common. Here are images corresponding to the samples:
500
[ { "input": "0 0 6 0 6 6 0 6\n1 3 3 5 5 3 3 1", "output": "YES" }, { "input": "0 0 6 0 6 6 0 6\n7 3 9 5 11 3 9 1", "output": "NO" }, { "input": "6 0 6 6 0 6 0 0\n7 4 4 7 7 10 10 7", "output": "YES" }, { "input": "0 0 6 0 6 6 0 6\n8 4 4 8 8 12 12 8", "output": "YES" }, { "input": "2 2 4 2 4 4 2 4\n0 3 3 6 6 3 3 0", "output": "YES" }, { "input": "-5 -5 5 -5 5 5 -5 5\n-5 7 0 2 5 7 0 12", "output": "YES" }, { "input": "-5 -5 5 -5 5 5 -5 5\n-5 12 0 7 5 12 0 17", "output": "NO" }, { "input": "-5 -5 5 -5 5 5 -5 5\n6 0 0 6 -6 0 0 -6", "output": "YES" }, { "input": "-100 -100 100 -100 100 100 -100 100\n-100 0 0 -100 100 0 0 100", "output": "YES" }, { "input": "92 1 92 98 -5 98 -5 1\n44 60 56 48 44 36 32 48", "output": "YES" }, { "input": "-12 -54 -12 33 -99 33 -99 -54\n-77 -40 -86 -31 -77 -22 -68 -31", "output": "YES" }, { "input": "3 45 19 45 19 61 3 61\n-29 45 -13 29 3 45 -13 61", "output": "YES" }, { "input": "79 -19 79 15 45 15 45 -19\n-1 24 -29 52 -1 80 27 52", "output": "NO" }, { "input": "75 -57 75 -21 39 -21 39 -57\n10 -42 -32 0 10 42 52 0", "output": "NO" }, { "input": "-11 53 9 53 9 73 -11 73\n-10 9 -43 42 -10 75 23 42", "output": "YES" }, { "input": "-10 -36 -10 27 -73 27 -73 -36\n44 -28 71 -55 44 -82 17 -55", "output": "NO" }, { "input": "-63 -15 6 -15 6 54 -63 54\n15 -13 -8 10 15 33 38 10", "output": "YES" }, { "input": "47 15 51 15 51 19 47 19\n19 0 -27 46 19 92 65 46", "output": "NO" }, { "input": "87 -5 87 79 3 79 3 -5\n36 36 78 -6 36 -48 -6 -6", "output": "YES" }, { "input": "-4 56 10 56 10 70 -4 70\n-11 47 -35 71 -11 95 13 71", "output": "YES" }, { "input": "-41 6 -41 8 -43 8 -43 6\n-7 27 43 -23 -7 -73 -57 -23", "output": "NO" }, { "input": "44 -58 44 7 -21 7 -21 -58\n22 19 47 -6 22 -31 -3 -6", "output": "YES" }, { "input": "-37 -63 49 -63 49 23 -37 23\n-52 68 -21 37 -52 6 -83 37", "output": "YES" }, { "input": "93 20 93 55 58 55 58 20\n61 -17 39 5 61 27 83 5", "output": "YES" }, { "input": "-7 4 -7 58 -61 58 -61 4\n-28 45 -17 34 -28 23 -39 34", "output": "YES" }, { "input": "24 -79 87 -79 87 -16 24 -16\n-59 21 -85 47 -59 73 -33 47", "output": "NO" }, { "input": "-68 -15 6 -15 6 59 -68 59\n48 -18 57 -27 48 -36 39 -27", "output": "NO" }, { "input": "25 1 25 91 -65 91 -65 1\n24 3 15 12 24 21 33 12", "output": "YES" }, { "input": "55 24 73 24 73 42 55 42\n49 17 10 56 49 95 88 56", "output": "YES" }, { "input": "69 -65 69 -28 32 -28 32 -65\n-1 50 43 6 -1 -38 -45 6", "output": "NO" }, { "input": "86 -26 86 18 42 18 42 -26\n3 -22 -40 21 3 64 46 21", "output": "YES" }, { "input": "52 -47 52 -30 35 -30 35 -47\n49 -22 64 -37 49 -52 34 -37", "output": "YES" }, { "input": "27 -59 27 9 -41 9 -41 -59\n-10 -17 2 -29 -10 -41 -22 -29", "output": "YES" }, { "input": "-90 2 0 2 0 92 -90 92\n-66 31 -86 51 -66 71 -46 51", "output": "YES" }, { "input": "-93 -86 -85 -86 -85 -78 -93 -78\n-13 61 0 48 -13 35 -26 48", "output": "NO" }, { "input": "-3 -45 85 -45 85 43 -3 43\n-22 0 -66 44 -22 88 22 44", "output": "YES" }, { "input": "-27 -73 72 -73 72 26 -27 26\n58 11 100 -31 58 -73 16 -31", "output": "YES" }, { "input": "-40 -31 8 -31 8 17 -40 17\n0 18 -35 53 0 88 35 53", "output": "NO" }, { "input": "-15 -63 -15 7 -85 7 -85 -63\n-35 -40 -33 -42 -35 -44 -37 -42", "output": "YES" }, { "input": "-100 -100 -100 100 100 100 100 -100\n-100 0 0 100 100 0 0 -100", "output": "YES" }, { "input": "67 33 67 67 33 67 33 33\n43 11 9 45 43 79 77 45", "output": "YES" }, { "input": "14 8 9 8 9 3 14 3\n-2 -13 14 3 30 -13 14 -29", "output": "YES" }, { "input": "4 3 7 3 7 6 4 6\n7 29 20 16 7 3 -6 16", "output": "YES" }, { "input": "14 30 3 30 3 19 14 19\n19 -13 11 -5 19 3 27 -5", "output": "NO" }, { "input": "-54 3 -50 3 -50 -1 -54 -1\n3 -50 -6 -41 -15 -50 -6 -59", "output": "NO" }, { "input": "3 8 3 -10 21 -10 21 8\n-9 2 -21 -10 -9 -22 3 -10", "output": "YES" }, { "input": "-35 3 -21 3 -21 -11 -35 -11\n-8 -10 3 -21 -8 -32 -19 -21", "output": "NO" }, { "input": "-5 -23 -5 -31 3 -31 3 -23\n-7 -23 -2 -28 3 -23 -2 -18", "output": "YES" }, { "input": "3 20 10 20 10 13 3 13\n3 20 21 38 39 20 21 2", "output": "YES" }, { "input": "25 3 16 3 16 12 25 12\n21 -2 16 -7 11 -2 16 3", "output": "YES" }, { "input": "-1 18 -1 3 14 3 14 18\n14 3 19 8 14 13 9 8", "output": "YES" }, { "input": "-44 -17 -64 -17 -64 3 -44 3\n-56 15 -44 27 -32 15 -44 3", "output": "YES" }, { "input": "17 3 2 3 2 18 17 18\n22 23 2 3 -18 23 2 43", "output": "YES" }, { "input": "3 -22 3 -36 -11 -36 -11 -22\n11 -44 19 -36 11 -28 3 -36", "output": "YES" }, { "input": "3 45 3 48 0 48 0 45\n13 38 4 47 13 56 22 47", "output": "NO" }, { "input": "3 -10 2 -10 2 -9 3 -9\n38 -10 20 -28 2 -10 20 8", "output": "YES" }, { "input": "-66 3 -47 3 -47 22 -66 22\n-52 -2 -45 5 -52 12 -59 5", "output": "YES" }, { "input": "3 37 -1 37 -1 41 3 41\n6 31 9 34 6 37 3 34", "output": "NO" }, { "input": "13 1 15 1 15 3 13 3\n13 19 21 11 13 3 5 11", "output": "YES" }, { "input": "20 8 3 8 3 -9 20 -9\n2 -11 3 -10 2 -9 1 -10", "output": "NO" }, { "input": "3 41 3 21 -17 21 -17 41\n26 12 10 28 26 44 42 28", "output": "NO" }, { "input": "11 11 11 3 3 3 3 11\n-12 26 -27 11 -12 -4 3 11", "output": "YES" }, { "input": "-29 3 -29 12 -38 12 -38 3\n-35 9 -29 15 -23 9 -29 3", "output": "YES" }, { "input": "3 -32 1 -32 1 -30 3 -30\n4 -32 -16 -52 -36 -32 -16 -12", "output": "YES" }, { "input": "-16 -10 -16 9 3 9 3 -10\n-8 -1 2 9 12 -1 2 -11", "output": "YES" }, { "input": "3 -42 -5 -42 -5 -34 3 -34\n-8 -54 -19 -43 -8 -32 3 -43", "output": "YES" }, { "input": "-47 3 -37 3 -37 -7 -47 -7\n-37 3 -33 -1 -37 -5 -41 -1", "output": "YES" }, { "input": "10 3 12 3 12 5 10 5\n12 4 20 12 12 20 4 12", "output": "YES" }, { "input": "3 -41 -9 -41 -9 -53 3 -53\n18 -16 38 -36 18 -56 -2 -36", "output": "YES" }, { "input": "3 40 2 40 2 41 3 41\n22 39 13 48 4 39 13 30", "output": "NO" }, { "input": "21 26 21 44 3 44 3 26\n-20 38 -32 26 -20 14 -8 26", "output": "NO" }, { "input": "0 7 3 7 3 10 0 10\n3 9 -17 29 -37 9 -17 -11", "output": "YES" }, { "input": "3 21 3 18 6 18 6 21\n-27 18 -11 2 5 18 -11 34", "output": "YES" }, { "input": "-29 13 -39 13 -39 3 -29 3\n-36 -4 -50 -18 -36 -32 -22 -18", "output": "NO" }, { "input": "3 -26 -2 -26 -2 -21 3 -21\n-5 -37 -16 -26 -5 -15 6 -26", "output": "YES" }, { "input": "3 9 -1 9 -1 13 3 13\n-9 17 -1 9 -9 1 -17 9", "output": "YES" }, { "input": "48 8 43 8 43 3 48 3\n31 -4 43 8 55 -4 43 -16", "output": "YES" }, { "input": "-3 1 3 1 3 -5 -3 -5\n20 -22 3 -5 20 12 37 -5", "output": "YES" }, { "input": "14 3 14 -16 -5 -16 -5 3\n14 2 15 1 14 0 13 1", "output": "YES" }, { "input": "-10 12 -10 -1 3 -1 3 12\n1 10 -2 7 -5 10 -2 13", "output": "YES" }, { "input": "39 21 21 21 21 3 39 3\n27 3 47 -17 27 -37 7 -17", "output": "YES" }, { "input": "3 1 3 17 -13 17 -13 1\n17 20 10 27 3 20 10 13", "output": "NO" }, { "input": "15 -18 3 -18 3 -6 15 -6\n29 -1 16 -14 3 -1 16 12", "output": "YES" }, { "input": "41 -6 41 3 32 3 32 -6\n33 3 35 5 33 7 31 5", "output": "YES" }, { "input": "7 35 3 35 3 39 7 39\n23 15 3 35 23 55 43 35", "output": "YES" }, { "input": "19 19 35 19 35 3 19 3\n25 -9 16 -18 7 -9 16 0", "output": "NO" }, { "input": "-20 3 -20 9 -26 9 -26 3\n-19 4 -21 2 -19 0 -17 2", "output": "YES" }, { "input": "13 3 22 3 22 -6 13 -6\n26 3 22 -1 18 3 22 7", "output": "YES" }, { "input": "-4 -8 -4 -15 3 -15 3 -8\n-10 5 -27 -12 -10 -29 7 -12", "output": "YES" }, { "input": "3 15 7 15 7 19 3 19\n-12 30 -23 19 -12 8 -1 19", "output": "NO" }, { "input": "-12 3 5 3 5 -14 -12 -14\n-14 22 5 3 24 22 5 41", "output": "YES" }, { "input": "-37 3 -17 3 -17 -17 -37 -17\n-9 -41 9 -23 -9 -5 -27 -23", "output": "YES" }, { "input": "3 57 3 45 -9 45 -9 57\n8 50 21 37 8 24 -5 37", "output": "YES" }, { "input": "42 3 42 -6 33 -6 33 3\n42 4 41 3 40 4 41 5", "output": "YES" }, { "input": "3 59 3 45 -11 45 -11 59\n-2 50 -8 44 -2 38 4 44", "output": "YES" }, { "input": "-51 3 -39 3 -39 15 -51 15\n-39 14 -53 0 -39 -14 -25 0", "output": "YES" }, { "input": "-7 -15 -7 3 11 3 11 -15\n15 -1 22 -8 15 -15 8 -8", "output": "YES" }, { "input": "3 -39 14 -39 14 -50 3 -50\n17 -39 5 -27 -7 -39 5 -51", "output": "YES" }, { "input": "91 -27 91 29 35 29 35 -27\n59 39 95 3 59 -33 23 3", "output": "YES" }, { "input": "-81 -60 -31 -60 -31 -10 -81 -10\n-58 -68 -95 -31 -58 6 -21 -31", "output": "YES" }, { "input": "78 -59 78 -2 21 -2 21 -59\n48 1 86 -37 48 -75 10 -37", "output": "YES" }, { "input": "-38 -26 32 -26 32 44 -38 44\n2 -27 -44 19 2 65 48 19", "output": "YES" }, { "input": "73 -54 73 -4 23 -4 23 -54\n47 1 77 -29 47 -59 17 -29", "output": "YES" }, { "input": "-6 -25 46 -25 46 27 -6 27\n21 -43 -21 -1 21 41 63 -1", "output": "YES" }, { "input": "-17 -91 -17 -27 -81 -27 -81 -91\n-48 -21 -12 -57 -48 -93 -84 -57", "output": "YES" }, { "input": "-7 16 43 16 43 66 -7 66\n18 -7 -27 38 18 83 63 38", "output": "YES" }, { "input": "-46 11 16 11 16 73 -46 73\n-18 -8 -67 41 -18 90 31 41", "output": "YES" }, { "input": "-33 -64 25 -64 25 -6 -33 -6\n-5 -74 -51 -28 -5 18 41 -28", "output": "YES" }, { "input": "99 -100 100 -100 100 -99 99 -99\n99 -99 100 -98 99 -97 98 -98", "output": "YES" }, { "input": "-100 -100 -100 -99 -99 -99 -99 -100\n-10 -10 -9 -9 -10 -8 -11 -9", "output": "NO" }, { "input": "-4 3 -3 3 -3 4 -4 4\n0 -4 4 0 0 4 -4 0", "output": "NO" }, { "input": "0 0 10 0 10 10 0 10\n11 9 13 7 15 9 13 11", "output": "NO" }, { "input": "1 1 1 6 6 6 6 1\n5 8 8 11 11 8 8 5", "output": "NO" }, { "input": "99 99 99 100 100 100 100 99\n-100 0 0 100 100 0 0 -100", "output": "NO" }, { "input": "0 0 0 2 2 2 2 0\n5 1 9 5 5 9 1 5", "output": "NO" }, { "input": "3 2 3 3 4 3 4 2\n0 4 4 0 0 -4 -4 0", "output": "NO" }, { "input": "0 0 2 0 2 2 0 2\n4 1 7 4 4 7 1 4", "output": "NO" }, { "input": "3 6 3 8 5 8 5 6\n2 9 4 11 6 9 4 7", "output": "YES" }, { "input": "0 0 10 0 10 10 0 10\n-1 5 5 -1 11 5 5 11", "output": "YES" }, { "input": "0 0 1 0 1 1 0 1\n3 0 6 3 3 6 0 3", "output": "NO" }, { "input": "3 7 4 7 4 6 3 6\n0 0 10 10 20 0 10 -10", "output": "NO" }, { "input": "0 0 0 1 1 1 1 0\n0 3 3 6 6 3 3 0", "output": "NO" }, { "input": "0 0 0 4 4 4 4 0\n3 6 7 10 11 6 7 2", "output": "NO" }, { "input": "0 0 0 1 1 1 1 0\n0 10 10 0 20 10 10 20", "output": "NO" } ]
1,672,814,210
2,147,483,647
PyPy 3-64
OK
TESTS
124
62
0
import math # point: () # vector: ((), ()) def product(point: tuple, vector: tuple) -> int: # print(point, vector) return (point[0] - vector[0][0]) * (vector[1][1] - vector[0][1]) - (point[1] - vector[0][1]) * (vector[1][0] - vector[0][0]) # points: ((), (), (), ()) # vectors: (((), ()), ((), ()), ((), ()), ((), ())) def solve(points: tuple, vectors: tuple) -> bool: for point in points: if product(point, vectors[0]) <= 0 and product(point, vectors[1]) <= 0 and product(point, vectors[2]) <= 0 and product(point, vectors[3]) <= 0: return True elif product(point, vectors[0]) >= 0 and product(point, vectors[1]) >= 0 and product(point, vectors[2]) >= 0 and product(point, vectors[3]) >= 0: return True return False parallelSquare = tuple(map(int, input().split(' '))) anotherSquare = tuple(map(int, input().split(' '))) parallelSquare = tuple((parallelSquare[i], parallelSquare[i + 1]) for i in range(0, len(parallelSquare), 2)) anotherSquare = tuple((anotherSquare[i], anotherSquare[i + 1]) for i in range(0, len(anotherSquare), 2)) parallelCenter = ((min(each[0] for each in parallelSquare) + max(each[0] for each in parallelSquare)) // 2, (min(each[1] for each in parallelSquare) + max(each[1] for each in parallelSquare)) / 2) anotherCenter = ((min(each[0] for each in anotherSquare) + max(each[0] for each in anotherSquare)) // 2, (min(each[1] for each in anotherSquare) + max(each[1] for each in anotherSquare)) / 2) parallelVectors = tuple((parallelSquare[i], parallelSquare[(i + 1) % len(parallelSquare)]) for i in range(len(parallelSquare))) anotherVectors = tuple((anotherSquare[i], anotherSquare[(i + 1) % len(anotherSquare)]) for i in range(len(anotherSquare))) if solve(parallelSquare, anotherVectors) or solve(anotherSquare, parallelVectors) or solve((parallelCenter, ), anotherVectors) or solve((anotherCenter, ), parallelVectors): print('YES') else: print('NO') '''-5 -5 5 -5 5 5 -5 5 6 0 0 6 -6 0 0 -6 0 0 6 0 6 6 0 6 8 4 4 8 8 12 12 8 '''
Title: Two Squares Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given two squares, one with sides parallel to the coordinate axes, and another one with sides at 45 degrees to the coordinate axes. Find whether the two squares intersect. The interior of the square is considered to be part of the square, i.e. if one square is completely inside another, they intersect. If the two squares only share one common point, they are also considered to intersect. Input Specification: The input data consists of two lines, one for each square, both containing 4 pairs of integers. Each pair represents coordinates of one vertex of the square. Coordinates within each line are either in clockwise or counterclockwise order. The first line contains the coordinates of the square with sides parallel to the coordinate axes, the second line contains the coordinates of the square at 45 degrees. All the values are integer and between $-100$ and $100$. Output Specification: Print "Yes" if squares intersect, otherwise print "No". You can print each letter in any case (upper or lower). Demo Input: ['0 0 6 0 6 6 0 6\n1 3 3 5 5 3 3 1\n', '0 0 6 0 6 6 0 6\n7 3 9 5 11 3 9 1\n', '6 0 6 6 0 6 0 0\n7 4 4 7 7 10 10 7\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n'] Note: In the first example the second square lies entirely within the first square, so they do intersect. In the second sample squares do not have any points in common. Here are images corresponding to the samples:
```python import math # point: () # vector: ((), ()) def product(point: tuple, vector: tuple) -> int: # print(point, vector) return (point[0] - vector[0][0]) * (vector[1][1] - vector[0][1]) - (point[1] - vector[0][1]) * (vector[1][0] - vector[0][0]) # points: ((), (), (), ()) # vectors: (((), ()), ((), ()), ((), ()), ((), ())) def solve(points: tuple, vectors: tuple) -> bool: for point in points: if product(point, vectors[0]) <= 0 and product(point, vectors[1]) <= 0 and product(point, vectors[2]) <= 0 and product(point, vectors[3]) <= 0: return True elif product(point, vectors[0]) >= 0 and product(point, vectors[1]) >= 0 and product(point, vectors[2]) >= 0 and product(point, vectors[3]) >= 0: return True return False parallelSquare = tuple(map(int, input().split(' '))) anotherSquare = tuple(map(int, input().split(' '))) parallelSquare = tuple((parallelSquare[i], parallelSquare[i + 1]) for i in range(0, len(parallelSquare), 2)) anotherSquare = tuple((anotherSquare[i], anotherSquare[i + 1]) for i in range(0, len(anotherSquare), 2)) parallelCenter = ((min(each[0] for each in parallelSquare) + max(each[0] for each in parallelSquare)) // 2, (min(each[1] for each in parallelSquare) + max(each[1] for each in parallelSquare)) / 2) anotherCenter = ((min(each[0] for each in anotherSquare) + max(each[0] for each in anotherSquare)) // 2, (min(each[1] for each in anotherSquare) + max(each[1] for each in anotherSquare)) / 2) parallelVectors = tuple((parallelSquare[i], parallelSquare[(i + 1) % len(parallelSquare)]) for i in range(len(parallelSquare))) anotherVectors = tuple((anotherSquare[i], anotherSquare[(i + 1) % len(anotherSquare)]) for i in range(len(anotherSquare))) if solve(parallelSquare, anotherVectors) or solve(anotherSquare, parallelVectors) or solve((parallelCenter, ), anotherVectors) or solve((anotherCenter, ), parallelVectors): print('YES') else: print('NO') '''-5 -5 5 -5 5 5 -5 5 6 0 0 6 -6 0 0 -6 0 0 6 0 6 6 0 6 8 4 4 8 8 12 12 8 ''' ```
3