image
listlengths
1
1
messages
listlengths
2
2
task_name
stringclasses
5 values
dataset_name
stringclasses
17 values
rvl_cdip_class
stringclasses
12 values
[ "./val_imgs/PubTabNet/val/PMC1858691_008_00.png" ]
[ { "role": "user", "content": "<|image|>What are the following illustration content in markdown style: <md> | <COLSPAN=2> polymorphism | natural rateb | <COLSPAN=2> EMS | <COLSPAN=2> Az-MNU | \n | type | changea | | obc | exd | ob | ex | \n | --- | --- | --- | --- | --- | --- | --- | \n | transitions | GC->AT | 0.32 | 19 | 8.53 | 20 | 9.48 | \n | | AT->GC | 0.35 | 3 | 9.48 | 6 | 10.53 | \n | transversions | GC->TA | 0.09" }, { "role": "assistant", "content": "| 1 | 2.33 | 0 | 2.59 | \n | | GC->CG | 0.07 | 0 | 1.84 | 0 | 2.05 | \n | | AT->TA | 0.09 | 4 | 2.30 | 2 | 2.55 | \n | | AT->CG | 0.09 | 0 | 2.52 | 2 | 2.80 | \n | <COLSPAN=7> Statistical analysise | \n | transitions | GC->AT | 0.32 | 19 | 8.53 | 20 | 9.48 | \n | | AT->GC | | | | | | \n | transversions | GC->TA | | | | | | \n | | GC->CG | 0.68 | 8 | 18.46 | 10 | 20.52 | \n | | AT->TA | | | | | | \n | | AT->CG | | | | | | \n | <COLSPAN=3> Probability | <COLSPAN=2> 0.0067 | <COLSPAN=2> 0.0042 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4965371_004_00.png" ]
[ { "role": "user", "content": "<|image|>Parse the following content of the figure in markdown code: <md> | Year | Women who went through OSI (n = 29) | Women from national controls (n = 77,514) | Odds ratio (95% CI) | p value | \n | --- | --- | --- | --- | --- | \n | 2011 | 2/7 (29%) | 224/18,953 (1%) | 33.4 (3.2–205.3) | 0.003 | \n | 2012 | 2/5 (40%) | 187/19,072 (1%) | 67.3 (5.6–590) | 0.001 | \n | 2013 | 2/7 (29%) | 158/19,662" }, { "role": "assistant", "content": "(1%) | 49.4 (4.7–303.8) | 0.001 | \n | 2014 | 3/10 (30%) | 231/19,827 (1%) | 36.6 (6–160.3) | < 0.001 | \n | Overall | 9/29 (31%) | 800/77,514 (1%) | 43.2 (17.2–99.6) | < 0.001 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3195757_001_00.png" ]
[ { "role": "user", "content": "<|image|>Continue parse the figure with markdown style: <md> | Method | Sensitivity (%) | Specificity (%) | *PPV(%) | *NPV(%) | *Prevalence(%) | Reference gold standard | Author and date of publication | \n | --- | --- | --- | --- | --- | --- | --- | --- | \n | *KK | 51.1-84.1 | 100 | 100 | 93.2-96.5 | 13.0-18.4 | two repeated KK results (6 slides) | Lin et al. 2008 [13] | \n | | 59.6-70.0 | 100 | 100 | 93.3-97.9 | 6.6-18.6 | two repeated KK results (6 slides) | Zhou et al. 2007 [14] | \n | | 72.2-100.0 | 100 | 100 | 96.3-100.0 | 6.2-12.0 | combined results of KK(3 slides) and MHT | Xu et al. 2007 [15] | \n | | 58.3 | 100 | 100 | 83.5 | 32.1 | MHT | He et al. 2007 [16] | \n | | 67.6 | 100 | 100 | 58.9 | 68.3 | seven repeated KK examinations (14 slides) | Yu et al. 2007 [17] | \n | | 69.9 | 100 | 100 | 95.63 | 13.2 | combined results of KK(3 slides) and MHT | Zhu et al. 2005 [18] | \n | | 50.0 | 100 | 100 | 98.02 | 3.9 | combined results of KK(3 slides) and MHT | Song et al. 2003 [19] | \n | | 40-68 | 100 | 100 | 52.5-80.5 | 36.0-68.3 | seven accumulated KK results(14 slides) | Yu et al. 1998 [20] | \n | *MHT | 24.0-95.0 | 100 | 100 | 95.2-99.6 | 6.2-12.0 | combined results of KK (3 slides) and MHT | Xu et al.2007 [15] | \n | | 79.2 | 100 | 100 | 94.0 | 23.6 | KK(3 slides) | He et al. 2007 [16] | \n | | 32.8 | 100 | 100 | 40.9 | 68.3 | seven accumulated KK" }, { "role": "assistant", "content": "results (14 slides) | Yu et al. 2007 [17] | \n | | 89.8 | 100 | 100 | 98.5 | 13.2 | combined results of KK(3 slides) and MHT | Zhu et al.2005 [18] | \n | | 94.4 | 100 | 100 | 99.8 | 3.9 | combined results of KK(3 slides) and MHT | Song et al. 2003 [19] | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3662594_005_00.png" ]
[ { "role": "user", "content": "<|image|>Parse the following content of the image in markdown code: <md> | Characteristics | Coefficient | SE (coeff.) | Sig. | Partial log likelihood | \n | --- | --- | --- | --- | --- | \n | Life expectancy: maximal increase | 0.735 | 0.152 | *** | −717.7 | \n | Long term side effects improbable (<20%) | 0.408 | 0.147 | ** | −709.5 | \n | Flexibility of dosing: max. 3 tablets/day | 0.454 | 0.151 | ** | −710.1 | \n | Physical quality of life: diarrhoea, nausea less frequent | 1.611 | 0.152 | *** | −769.4 | \n | Emotional quality" }, { "role": "assistant", "content": "of life: disease not obvious for others | 2.984 | 0.153 | *** | −981.7 | \n | Social quality of life: participation in social life possible | 1.140 | 0.153 | *** | −735.4 | \n | Model constant | −3.726 | 0.214 | *** | | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC2773538_003_00.png" ]
[ { "role": "user", "content": "<|image|>Parse the following content of the figure in markdown code: <md> | | PG (n = 21)a | AD (n = 21)a | HC (n = 21)a | Test statistic | Post-hoc effects of group | \n | --- | --- | --- | --- | --- | --- | \n | Cambridge Gamble Task | | | | | | \n | Total points obtained | 1772 ± 1205 | 1605 ± 805 | 1551 ± 592 | F(2,60) = 0.34, NS | – | \n | Bankruptciesb | 5 (24%) | 4 (19%) | 0 (0%) | χ2(1) = 5.25, P = 0.022 | – | \n | % Rational decisions | 90 ± 19 | 94 ± 9 | 96 ± 9 | F(2,60) = 1.15, NS | – | \n | Percentage wager | 59 ± 17 | 56 ± 11 | 48 ± 13 | F(2,56) = 3.31, P = 0.045 | PG>HC | \n | Decision latency (ms) | 2064 ± 739 | 2742 ± 1136 | 1970 ± 753 | F(2,56) = 5.74, P = 0.005 | AD>[PG=HC] | \n | Information Sampling Task | | | | | | \n | Errors | 5.0 ± 3.2 | 4.8 ± 2.5 | 3.2 ± 2.4 | F(2,60) = 2.41, P = 0.099 | PG>HC | \n | Boxes opened (/25) | 8.6 ± 3.6 | 9.8 ± 4.1 | 12.8 ± 4.6 | F(2,60) = 5.92, P = 0.005 | [PG=AD]<HC | \n | Spatial working memory |" }, { "role": "assistant", "content": " | | | | | \n | Total errors | 23.3 ± 22.8 | 40.3 ± 30.0 | 22.8 ± 21.4 | F(2,57) = 3.20, P = 0.048 | AD>[PG=HC] | \n | Strategy | 32.0 ± 6.2 | 31.8 ± 8.5 | 29.5 ± 5.4 | F(2,57) = 0.73, NS | – | \n | Digit span | | | | | | \n | Forwards score (/12) | 9.7 ± 1.8 | 8.3 ± 1.9 | 10.1 ± 1.8 | F(2,57) = 5.30, P = 0.008 | AD<[PG=HC] | \n | Backwards score (/12) | 8.6 ± 3.0 | 6.5 ± 2.2 | 7.8 ± 2.5 | F(2,57) = 3.51, P = 0.037 | AD<PG | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC6029022_003_00.png" ]
[ { "role": "user", "content": "<|image|>What are the following illustration content in markdown style: <md> | <COLSPAN=2> Group | Experimental | Control | Total | <ROWSPAN=2> P-value | \n | <COLSPAN=2> Demographic characteristics | Mean (±SD) | Mean (±SD) | Mean(±SD) | \n | --- | --- | --- | --- | --- | --- | \n | <COLSPAN=2> Age | 34.87 (±7.8) | 36.06 (±8.03) | 33.46(±7.91) | 0.79 | \n | <COLSPAN=2> | Frequency (%) | Frequency (%) | Frequency (%) | | \n | Sex | Female | 27 (90) | 26 (83.8) | 53 (86.9) | 0.48 | \n | <ROWSPAN=2> Education | Bachelor’s degree | 26 (86.7) | 30 (96.8) | 56 (91.8) | <ROWSPAN=2> 0.15 | \n | Master’s degree | 4 (13.3%) | 1 (3.2%) | 5 (8.2) | \n | <ROWSPAN=2> Position | Nurse" }, { "role": "assistant", "content": "| 21 (70) | 27 (87.1) | 48 (78.68) | <ROWSPAN=2> 0.27 | \n | Supervisor | 9 (30) | 4 (12.9) | 13 (21.32) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5289008_004_00.png" ]
[ { "role": "user", "content": "<|image|>Parse the following content of the illustration in markdown code: <md> | Characteristic | Frequency | \n | --- | --- | \n | Mean age | 57 y (SD:±14y) | \n | <ROWSPAN=2> Sex | Fem: 141 (78.3%) | \n | Male: 39 (21.7%) | \n | <ROWSPAN=2> Origin | Urban: 124 (68.9%). | \n | Non-Urban: 56 (31.1%). | \n | Thyroid cancer family backgrounds | N (%) | \n | No | 119 (66.1%) | \n |" }, { "role": "assistant", "content": "Yes | 61 (33.9%) | \n | Accelerated Growth of the Thyroid Nodules | | \n | No | 121 (67.2%) | \n | Yes | 59 (32.8%) | \n | Head Radiation | | \n | No | 163 (90.6%) | \n | Yes | 17 (9.4%) | \n | Firm Nodule | | \n | No | 94 (51.7%) | \n | Yes | 86 (47.8%) | \n | Adjacent structure Attachment | | \n | No | 130 (72.2%) | \n | Yes | 50 (27.8%) | \n | Vocal Chord Paralysis | | \n | No | 130 (72.2%) | \n | Yes | 50 (27.8%) | \n | ≥4 cm nodule | | \n | No | 109 (60.6%) | \n | Yes | 71 (39.4%) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5111226_003_00.png" ]
[ { "role": "user", "content": "<|image|>What are the following photo content in markdown style: <md> | Title | Definition | Numerator | Denominator | Target | \n | --- | --- | --- | --- | --- | \n | <ROWSPAN=3> Retention in care at 12 months of ART | <ROWSPAN=3> Percentage of adults and children known to be alive and on ART 12 months after initiation | <ROWSPAN=3> Number of adults and children who are still alive and on ART 12 months after initiating treatment | <ROWSPAN=3> Total number of adults and children (excluding transfers out) who initiated ART and were expected to achieve 12-month outcomes within the reporting" }, { "role": "assistant", "content": "period | Desirable or excellent performance: >85% | \n | Fair performance: 75–85% | \n | Poor performance: <75% | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4013609_002_00.png" ]
[ { "role": "user", "content": "<|image|>What are the following figure content in markdown style: <md> | Cardiac characteristics | PBS | Cocaine | \n | --- | --- | --- | \n | Number of animals | 8" }, { "role": "assistant", "content": "| 8 | \n | Body weight (BW), gm | 340.70 ± 33.40 | 319.50 ± 11.80 | \n | Whole heart weight (wet WHW), gm | 1.51 ± 0.18 | 1.31 ± 0.18 | \n | WHW/BW (×104) | 44.76 ± 7.14 | 41.21 ± 5.80 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5250640_003_00.png" ]
[ { "role": "user", "content": "<|image|>Interpret the picture as Markdown format." }, { "role": "assistant", "content": "<md> | Baseline characteristics | Mean (SD), median (IQR) or number (%) | Correlation with frailty index at follow-up | \n | --- | --- | --- | \n | Age (years), mean (SD) | 70.0 (7.36) | 0.3012*** | \n | Female, no. (%) | 2982 (54.4) | 0.128*** | \n | <COLSPAN=3> Personality traits, mean (SD) | \n | Extraversion | 3.15 (0.55) | −0.249*** | \n | Agreeableness | 3.51 (0.48) | 0.015 | \n | Openness | 2.86 (0.56) | −0.165*** | \n | Neuroticism | 2.06 (0.58) | 0.161*** | \n | Conscientiousness | 3.27 (0.50) | −0.224*** | \n | Household wealth (£), median (IQR) | 241,102 (131,215–418,219) | −0.292*** | \n | Smoking status, no. (%) | | 0.103*** | \n | Never | 1956 (36.8) | | \n | Ex-smoker | 2822 (53.1) | | \n | Current smoker | 536 (10.1) | | \n | Physical activity, no. (%) | | −0.415*** | \n | Sedentary | 279 (5.25) | | \n | Low | 1294 (24.4) | | \n | Medium | 2749 (51.7) | | \n | High | 992 (18.7) | | \n | Frailty index score, median (IQR) | 0.068 (0.022–0.136) | 0.830*** | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC6060521_005_01.png" ]
[ { "role": "user", "content": "<|image|>Express the photo as Markdown code." }, { "role": "assistant", "content": "<md> | <ROWSPAN=2> | <COLSPAN=2> Crude | | <COLSPAN=2> Adjusted | | \n | HR | 95%-CI | p | HR | 95%-CI | p | \n | --- | --- | --- | --- | --- | --- | --- | \n | <COLSPAN=7> Gender | \n | Men | 1.0 | ref | | 1.0 | ref | | \n | Women | 2.39 | 1.95–2.94 | 0.005 | 0.94 | 0.75–1.17 | 0.58 | \n | <COLSPAN=7> Age | \n | 15–39 | 1.0 | ref | | 1.0 | ref | | \n | 40–64 | 4.28 | 2.72–6.74 | < 0.005 | 3.67 | 2.32–5.81 | < 0.001 | \n | 65–101 | 31.1 | 20.3–47.8 | < 0.005 | 22.9 | 14.7–35.7 | < 0.001 | \n | <COLSPAN=7> Amputation | \n | No | 1.0 | ref | | 1.0 | ref | | \n | Yes | 2.6 | 1.60–4.23 | < 0.005 | 1.79 | 1.08–2.95 | 0.02 | \n | <COLSPAN=7> Length of stay | \n | Unit per extra day | 1.011 | 1.009–1.014 | < 0.005 | 1.01 | 1.009–1.017 | < 0.001 | \n | <COLSPAN=7> Mechanism of injury | \n | Fall from standing height (n = 66) | 1.0 | ref | | 1.0 | ref | | \n | Fall from height (n = 19) | 0.51 | 0.38–0.67 | < 0.005 | 0.59 | 0.44–0.78 | < 0.001 | \n | Unprotected road users (n = 8) | 0.21 | 0.15–0.28 | < 0.005 | 0.34 | 0.25–0.48 | < 0.001 | \n | Car crash (n = 2) | 0.21 | 0.13–0.36 | < 0.005 | 0.36 | 0.21–0.62 | < 0.001 | \n | Other vehicles/objects (n = 4) | 0.17 | 0.10–0.29 | < 0.005 | 0.30 | 0.18–0.51 | < 0.001 | \n | Self-destructive injury (n = 3) | 0.40 | 0.18–0.91 | 0.029 | 1.20 | 0.53–2.75 | 0.66 | \n | Else (n = 10) | 0.43 | 0.29–0.63 | < 0.005 | 0.48 | 0.32–0.72 | < 0.001 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4008307_003_00.png" ]
[ { "role": "user", "content": "<|image|>What are the following figure content in markdown style: <md> | | | IRR | <COLSPAN=2> 95% CI | P-value | | \n | --- | --- | --- | --- | --- | --- | --- | \n | <COLSPAN=2> NDVI 2 weeks before catch | 0.000 | 0.000 | 0.135 | 1.22e-02 | * | \n | <COLSPAN=2> Cumulated precipitation 16 days preceding the catch (per additional mm) | 1.006 | 1.001 | 1.011 | 2.89e-02 | * | \n | <ROWSPAN=2> Aquatic grassland | Absence | 1 | |" }, { "role": "assistant", "content": " | | | \n | Presence | 4.713 | 2.179 | 10.194 | 8.20e-05 | *** | \n | <ROWSPAN=3> Vector control intervention | TLLIN | 1 | | | | | \n | ULLIN | 0.605 | 0.334 | 1.097 | 9.80e-02 | . | \n | ULLIN + CTPS | 0.168 | 0.056 | 0.504 | 1.40e-03 | ** | \n | | TLLIN + IRS | 0.447 | 0.168 | 1.189 | 1.07e-01 | | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5790859_002_00.png" ]
[ { "role": "user", "content": "<|image|>Convert the illustration into Markdown format." }, { "role": "assistant", "content": "<md> | <ROWSPAN=2> Disease group | <ROWSPAN=2> No. of patients | <ROWSPAN=2> Age (years); mean ± SE | <COLSPAN=2> Gender | \n | Male | Female | \n | --- | --- | --- | --- | --- | \n | Dry AMD | 5 | 80 ± 7 | 1 | 4 | \n | nAMD | 11 | 80 ± 5 | 4 | 7 | \n | PDR | 9 | 59 ± 2 | 4 | 5 | \n | ERM | 11 | 71 ± 4 | 5 | 6 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5750627_003_01.png" ]
[ { "role": "user", "content": "<|image|>Encode the photo in Markdown syntax." }, { "role": "assistant", "content": "<md> | | <COLSPAN=4> % Packout by Fruit Grade | \n | | Premium | 2nd | 3rd | Total | \n | --- | --- | --- | --- | --- | \n | No Agsil Drench a | 50.3 | 21.1 | 26.2 | 97.6 | \n | Agsil Drench b | 51.3 | 36.5 | 10.8 | 98.6 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4510702_004_01.png" ]
[ { "role": "user", "content": "<|image|>Convert the photo to Markdown syntax." }, { "role": "assistant", "content": "<md> | | Closed‐loop period (n = 40) | Control period (n = 40) | p | \n | --- | --- | --- | --- | \n | Mean ± s.d. glucose, mmol/l | 8.6 ± 1.2 | 9.1 ± 1.4 | 0.016 | \n | <COLSPAN=4> Mean ± s.d. proportion of time spent at glucose level, % | \n | 3.9–10.0 mmol/l | 63.6 ± 9.9 | 58.8 ± 10.5 | 0.001 | \n | >10.0 mmol/l | 29.5 ± 10.5 | 36.5 ± 13.3 | <0.001 | \n | Median (IQR) proportion of time spent at glucose level <3.9 mmol/l, % | 1.8 (0.91, 3.2) | 2.7 (1.3, 5.7) | 0.015 | \n | Median (IQR) AUCday < 3.5 mmol/l, mmol/l × min | 5.2 (2.0, 12.1) | 6.9 (2.4, 29.5) | 0.078 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC6058706_002_00.png" ]
[ { "role": "user", "content": "<|image|>Encode the diagram in Markdown syntax." }, { "role": "assistant", "content": "<md> | | <COLSPAN=2> Factors levels in actual values | | | | \n | Formula | Pluronic to drug ratio | P123 percentage (%) | EE% + SD (%)a | PS + SD (nm)a | PDI + SDa | \n | --- | --- | --- | --- | --- | --- | \n | M1 | 10 | 10 | 7.27 ± 0.47 | 58.73 ± 1.56 | 0.23 ± 0.01 | \n | M2 | 50 | 10 | 98.72 ± 0.72 | 26.34 ± 0.09 | 0.14 ± 0.01 | \n | M3 | 10 | 90 | 79.22 ± 1.00 | 26.83 ± 0.96 | 0.29 ± 0.03 | \n | M4 | 50 | 90 | 99.55 ± 0.18 | 20.03 ± 0.21 | 0.08 ± 0.02 | \n | M5 | 10 | 50 | 64.28 ± 0.98 | 26.07 ± 1.07 | 0.32 ± 0.04 | \n | M6 | 50 | 50 | 96.69 ± 0.77 | 23.46 ± 0.29 | 0.14 ± 0.02 | \n | M7 | 30 | 10 | 97.35 ± 0.25 | 29.93 ± 0.76 | 0.18 ± 0.01 | \n | M8 | 30 | 90 | 98.15 ± 0.89 | 20.65 ± 0.20 | 0.15 ± 0.01 | \n | M9 | 30 | 50 | 97.75 ± 0.16 | 23.13 ± 0.16 | 0.15 ± 0.03 | \n | M10 | 30 | 50 | 97.23 ± 0.41 | 23.12 ± 0.53 | 0.14 ± 0.01 | \n | M11 | 30 | 50 | 99.43 ± 0.73 | 23.74 ± 0.95 | 0.13 ± 0.03 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5642580_015_01.png" ]
[ { "role": "user", "content": "<|image|>Parse the following content of the diagram in markdown code: <md> | Hematological biochemical parameters | Control | CDDP | Calyxin Y | CDDP + Calyxin Y | \n | --- | --- | --- | --- | --- | \n | Aspartate aminotransferase (U/L) | 101.1 ± 2.9 | 158.5 ± 5.1 | 129.3 ± 3.5 |" }, { "role": "assistant", "content": "160.3 ± 4.7 | \n | Alanine aminotransferase (U/L) | 36.5 ± 3.6 | 40.2 ± 1.2 | 37.5 ± 1.4 | 42.7 ± 1.5 | \n | Alkaline phosphatase (U/L) | 117.2 ± 4.5 | 125.4 ± 0.91 | 115.4 ± 2.7 | 127.6 ± 3.8 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5819672_002_00.png" ]
[ { "role": "user", "content": "<|image|>Parse the table content behind with markdown code: <md> | | Recruitment participants in period | Start SMS weeks in period | Weeks of the year/SMS weeks | Number of invitations | \n | --- | ---" }, { "role": "assistant", "content": "| --- | --- | --- | \n | Batch 1 | October – December ‘12 | December ‘12 - January ‘13 | 49 to 52 and 01 to 04 | 555 | \n | Batch 2 | November ‘12-January ‘13 | January–February ‘13 | 01 to 09 | 537 | \n | Batch 3 | January – March ‘13 | March–April ‘13 | 10 to 18 | 781 | \n | Batch 4 | March – May ‘13 | May–June ‘13 | 19 to 26 | 795 | \n | Batch 5 | May – July ‘13 | July–August ‘13 | 27 to 35 | 794 | \n | Batch 6 | July – September ‘13 | September–October ‘13 | 36 to 44 | 728 | \n | Batch 7 | September – December ‘13 | November ‘13 - January ‘14 | 45 to 01 | 838 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3042971_003_00.png" ]
[ { "role": "user", "content": "<|image|>Convert the image to Markdown syntax." }, { "role": "assistant", "content": "<md> | Panel Member | Board Certification | Practice Setting | Practice Location | \n | --- | --- | --- | --- | \n | William Banner, MD, PhD | Pediatrics, pediatric critical care, medical toxicology | Clinical toxicology service, pediatric intensive care unit | Oklahoma City, Oklahoma, USA | \n | Vikhyat Bebarta, MD | Emergency medicine, medical toxicology | Clinical toxicology service, emergency department | San Antonio, Texas, USA | \n | Jeffrey Bernstein, MD | Emergency medicine, medical toxicology, clinical pharmacology | Emergency department, poison center | Miami, Florida, USA | \n | Sean P. Bush, MD | Emergency medicine | Envenomations clinical service, emergency department | Loma Linda, California, USA | \n | Richard C. Dart, MD | Emergency medicine, medical toxicology | Clinical toxicology service, poison center | Denver, Colorado, USA | \n | William P. Kerns, II, MD | Emergency medicine, medical toxicology | Clinical toxicology service, emergency department, poison center | Charlotte, North Carolina, USA | \n | William H. Richardson, MD | Emergency medicine, medical toxicology | Emergency department, poison center | Columbia, South Carolina, USA | \n | Anne-Michelle Ruha, MD | Emergency medicine, medical toxicology | Clinical toxicology service, emergency department, poison center | Phoenix, Arizona, USA | \n | Steven A. Seifert, MD | Emergency medicine, medical toxicology | Clinical toxicology service, emergency department, poison center | Albuquerque, New Mexico, USA | \n | David A. Tanen, MD | Emergency medicine, medical toxicology | Clinical toxicology service, emergency department, poison center | San Diego, California, USA | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5069933_002_00.png" ]
[ { "role": "user", "content": "<|image|>Convert the photo into Markdown language." }, { "role": "assistant", "content": "<md> | Admission to hospital | 29 January 2016 | \n | --- | --- | \n | Operation procedure | 30 January 2016 | \n | Discharge from hospital | 04 February 2016 | \n | Spontaneous vaginal delivery | 04 May 2016 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC2823661_007_00.png" ]
[ { "role": "user", "content": "<|image|>Render the picture in Markdown format." }, { "role": "assistant", "content": "<md> | Study | Filter Type | No. Patients | Duration of Insertion (mean) (days) (range) | Insertion Complication* | Filter Migration | IVC Penetration | Caval Occlusion | Failed Retrieval Rate | \n | --- | --- | --- | --- | --- | --- | --- | --- | --- | \n | Rosenthal et al. 2004[55] | Optease | 94 | 19 (5-25) | 6 (6.4%) | 0 | 1 | 0 | 0/31 | \n | Allen et al. 2005[54] | Gunther Tulip | 51 | NR | 0/51 | 0 | 0 | 0 | 1/25 (4%) | \n | Offner et al. 2003[53] | Gunther Tulip | 44 | 14 (3-30) | 0/44 | 0 | 0 | 0 | 1/40 (2.5%) | \n | Hoff et al. 2004[52] | Gunther Tulip | 35 | 10 (6-14) | 0/35 | 0 | 0 | 0 | 0/18 | \n | TOTAL | | 224 | | 6/224 (2.6%) | 0 | 1/224 (0.4%) | 0 | 2/114 (2.8%) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4016942_005_00.png" ]
[ { "role": "user", "content": "<|image|>Transcribe the illustration into Markdown format." }, { "role": "assistant", "content": "<md> | Groups | Before immunization | After immunization | After injection into the inner ear | \n | --- | --- | --- | --- | \n | Group A | 0.4231 ± 0.0475 | 0.6683 ± 0.0371 | 0.6587 ± 0.0236 | \n | Group B | 0.4345 ± 0.0453 | 0.6506 ± 0.0284 | 0.6468 ± 0.0352 | \n | Group C | 0.4412 ± 0.0435 | 0.6649 ± 0.0403 | 0.6528 ± 0.0416 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3111372_012_00.png" ]
[ { "role": "user", "content": "<|image|>Interpret the illustration as Markdown format." }, { "role": "assistant", "content": "<md> | | | GRNCOP2 | Soinov et al. | Bulashevska and Eils | RANDOM | \n | --- | --- | --- | --- | --- | --- | \n | Yeastnet | precision | 93.33% | 50.00% | 88.89% | 51.58% | \n | | sensitivity | 14.29% | 3.06% | 8.16% | - | \n | | specificity | 98.91% | 96.74% | 98.91% | - | \n | | score | 3.04 | 1.84 | 2.77 | 1.5303384 | \n | Co-citation | Precision | 93.33% | 50.00% | 88.89% | 43.68% | \n | | sensitivity | 16.87% | 3.61% | 9.64% | - | \n | | specificity | 99.07% | 97.20% | 99.07% | - | \n | | score | 3.26 | 1.85 | 2.84 | 1.3487118 | \n | GO | precision | 73.33% | 50.00% | 55.56% | 45.26% | \n | | sensitivity | 12.79% | 3.49% | 5.81% | - | \n | | specificity | 96.15% | 97.12% | 96.15% | - | \n | <COLSPAN=2> number of associations | 15.00 | 6.00 | 9.00 | - | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4410225_005_01.png" ]
[ { "role": "user", "content": "<|image|>Interpret the diagram as Markdown format." }, { "role": "assistant", "content": "<md> | Non-Native Species | Site 1 | Site 2 | Site 3 | \n | --- | --- | --- | --- | \n | Fishes | | | | \n | Carassius cuvieri | 0.50 | 0.00 | 0.00 | \n | Channa striata | 0.50 | 0.00 | 0.00 | \n | Oreochromis spp. | 5.00 | 19.50 | 57.00 | \n | Trichogaster trichopterus | 0.00 | 101.00 | 0.00 | \n | Birds | | | | \n | Acridotheres javanicus | 0.00 | 0.33 | 2.00 | \n | Acridotheres tristis | 0.33 | 0.00 | 0.00 | \n | Columba livia | 5.67 | 0.00 | 0.67 | \n | Threskiornis aethiopicus | 2.67 | 0.00 | 0.00 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5597084_014_00.png" ]
[ { "role": "user", "content": "<|image|>Parse the table content behind with markdown code: <md> | <ROWSPAN=2> Measure | <COLSPAN=2> AB | <COLSPAN=2> CD | <COLSPAN=2> P | <ROWSPAN=2> F(2, 148), p | \n | M | SD | M | SD | M | SD | \n | --- | --- | --- | --- | --- | --- | --- | --- | \n | Unaided baselines | | | | | | | | \n | HHIE | 27.7 | 13.6 | 29.3 | 17.3 | 29.0 | 16.4 | 0.24, .79 | \n | CST (RAU) | 53.8 | 27.1 | 51.8 | 20.5 | 53.4 | 24.7 | 0.13, .88 | \n | PHAPglobal | 0.36 | 0.12 | 0.38 | 0.13 | 0.40 | 0.13 | 1.53, .22 | \n | PHAPavds | 0.20 | 0.10 | 0.23 | 0.14 | 0.25 | 0.12 | 2.43, .09 | \n | Outcome Measures | | | | | | | | \n | PHABglobal | 0.17 | 0.12 | 0.12 | 0.12 | 0.04 | 0.10 | 18.56, < .001 | \n | PHABavds | 0.02 | 0.13 | 0.01 | 0.10 | 0.02 | 0.10 | 0.10, .90 | \n | CST benefit (RAU) | 21.3 | 19.4 | 26.6 | 16.1 | 8.7 | 21.2 | 11.78, < .001 | \n | HHIE benefit | 18.2 | 14.2 | 12.3 | 14.1 | 5.5 | 11.6 | 12.09, < .001 | \n | HASShaf | 3.80 | 0.45 |" }, { "role": "assistant", "content": "3.48 | 0.62 | 3.42 | 0.58 | 6.92, .001 | \n | HASSdisp | 4.56 | 0.28 | 4.23 | 0.40 | 4.52 | 0.43 | 11.40, < .001 | \n | Usage (hours/day) | 7.09 | 3.95 | 6.12 | 3.93 | 5.99 | 3.39 | 1.33, .27 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC2575575_003_00.png" ]
[ { "role": "user", "content": "<|image|>Transcribe the diagram into Markdown format." }, { "role": "assistant", "content": "<md> | | Cardiac arrest (n = 354) | Hospital non-survivors (n = 204) | Completed questionnaire (n = 81) | GCS score below 6 points (n = 7) | \n | --- | --- | --- | --- | --- | \n | Age in years, mean ± SD | 66 ± 13 | 68 ± 12 | 61 ± 13 | 61 ± 12 | \n | Median (25th/75th percentile) | 68 (60/75) | 70 (62/77) | 61 (53/72) | 64 (50/68) | \n | Gender male/female, number (percentage) | 252/102 (71/29) | 148/56 (73/27) | 57/24 (70/30) | 6/1 (86/14) | \n | ICU stay in days, mean ± SD (minimum-maximum) | 9 ± 16 (1–113) | 8 ± 14 (1–98) | 7 ± 11 (1–78) | 17 ± 23 (2–67) | \n | Median (25th/75th percentile) | 3 (1/9) | 4 (1/9) | 3 (2/7) | 6 (2/18) | \n | Hospital stay in days, mean ± SD (minimum-maximum) | 25 ± 28 (1–176) | 4 ± 18 (1–150)a | 19 ± 18 (1–103) | 35 ± 30 (2–101) | \n | Median (25th/75th percentile) | 15 (5/33) | NA | 14 (10/22) | 26 (15/38) | \n | SAPS II, mean ± SD | 47 ± 23 | 58 ± 19a | 38 ± 20 | 47 ± 21 | \n | Median (25th/75th percentile) | 45 (31/63) | 58 (44/71)a | 33 (23/53) | 53 (24/66) | \n | SAPS II PRM as a percentage, mean ± SD | 42 ± 33 | 58 ± 30a | 42 ± 33 | 45 ± 36 | \n | Median (25th/75th percentile) | 35 (12/74) | 64 (33/85)a | 14 (5/52) | 53 (6/78) | \n | Simplified TISS-28 day 1, mean ± SD | 34 ± 11 | 36 ± 10 | 31 ± 8 | 37 ± 3 | \n | Median (25th/75th percentile) | 34 (28/40) | 36 (28/43) | 32 (26/37) | 37 (34/40) | \n | TMS, mean ± SD | 9.6 ± 5.2 | 11.8 ± 4.5a | 6.3 ± 5.0 | 7.7 ± 5.3 | \n | Median (25th/75th percentile) | 11 (5/13) | 13 (10/15)a | 5 (2/11) | 9 (1/10) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC2760574_011_02.png" ]
[ { "role": "user", "content": "<|image|>Parse the photo content behind with markdown code: <md> | Rs10954213 | <COLSPAN=2> Allele | <COLSPAN=3> Genotype | \n | --- | --- | --- | --- | --- | --- | \n | Group | A | G | AA | AG | GG | \n | BPD | 129 | 153 | 33 | 63 | 45 | \n | C | 183 | 197 | 44 | 95 | 51 | \n | MDD | 8 | 6 | 1 | 6 |" }, { "role": "assistant", "content": "0 | \n | SZ | 100 | 96 | 25 | 50 | 23 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5686947_003_00.png" ]
[ { "role": "user", "content": "<|image|>Interpret the figure as Markdown format." }, { "role": "assistant", "content": "<md> | Variable | Hypertonic saline (n = 60) | Normal saline (n = 60) | P value | \n | --- | --- | --- | --- | \n | <COLSPAN=4> Demographic and clinical characteristics | \n | Age (years) | 76.6 ± 5.8 | 75.6 ± 5.6 | 0.382 | \n | Sex, female (%) | 31 (52) | 27 (45) | 0.534 | \n | BMI (kg/m2) | 28.7 ± 3.4 | 28.5 ± 3.3 | 0.845 | \n | Education (years) | 9.2 ± 3.3 | 9.6 ± 3.3 | 0.492 | \n | ASA score of 2, n (%) | 38 (63.3) | 35 (58.3) | 0.315 | \n | MMSE (point) | 25.7 ± 1.4 | 25.5 ± 1.3 | 0.343 | \n | Duration of anesthesia (min) | 98.5 ± 12.3 | 102.2 ± 13.3 | 0.113 | \n | <COLSPAN=4> Frequency of comorbidities: | \n | Coronary artery disease, n (%) | 14 (23.3) | 18 (30) | 0.682 | \n | Diabetes, n (%) | 15 (25.0) | 10 (16.7) | 0.261 | \n | Hypertension, n (%) | 47 (78.3) | 50 (83.3) | 0.484 | \n | Cerebral infarction, n (%) | 14 (23.3) | 19 (31.7) | 0.307 | \n | <COLSPAN=4> Cytokines | \n | IL-1β (pg/ml) | 1.33 ± 0.17 | 1.75 ± 0.15 | 0.000 | \n | IL-6 (pg/ml) | 91.03 ± 9.32 | 121.44 ± 9.58 | 0.000 | \n | IL-10 (pg/ml) | 6.89 ± 1.78 | 5.45 ± 1.68 | 0.000 | \n | TNF-α (pg/ml) | 20.64 ± 3.78 | 44.03 ± 3.52 | 0.000 | \n | S100β (ng/mL) | 0.26 ± 0.09 | 0.34 ± 0.11 | 0.000 | \n | CD14 + CD16+ monocytes (%) | 19.70 ± 4.57 | 35.75 ± 4.31 | 0.000 | \n | Prevalence of delirium, n (%) | 7 (11.7) | 23 (38.3) | 0.001 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5504675_003_00.png" ]
[ { "role": "user", "content": "<|image|>Translate the illustration into Markdown format." }, { "role": "assistant", "content": "<md> | Group | Acupoint | Manipulation | \n | --- | --- | --- | \n | <ROWSPAN=2> Group Atraditional acupuncture | EX-HN 15 (Jingbailao) | <ROWSPAN=2> The needle-punching depth in the each acupoint is 0.5 to 0.8 cun. The sensation (denominated de-qi) is necessary | \n | SI 15 (Jianzhongshu) | \n | <ROWSPAN=2> Group Bacupoints shallow puncture | EX-HN 15 (Jingbailao) | <ROWSPAN=2> The needles are pierced through the skin for 0.2 cun and not enough to produce de-qi | \n | SI 15 (Jianzhongshu) | \n | <ROWSPAN=2> Group Cnon-acupoint acupuncture | Non-acupoint 1 | <ROWSPAN=2> The needle-punching depth in the acupoints is 0.5 to 0.8 cun. The sensation (denominated de-qi) is necessary | \n | Non-acupoint 2 | \n | <ROWSPAN=2> Group Dnon-acupoint shallow puncture | Non-acupoint 1 | <ROWSPAN=2> The needles are pierced through the skin for 0.2 cun and not enough to produce de-qi | \n | Non-acupoint 2 | \n | <ROWSPAN=2> Group Esham puncture | EX-HN 15 (Jingbailao) | <ROWSPAN=2> The placebo needle tip is pressed and fixed on the skin of the acupoint | \n | SI 15 (Jianzhongshu) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC2784441_004_00.png" ]
[ { "role": "user", "content": "<|image|>Encode the image in Markdown syntax." }, { "role": "assistant", "content": "<md> | Tau | Bmax (μM) | Kapp (μM) | R | \n | --- | --- | --- | --- | \n | tau | 2.31 ± 0.05 | 0.03 ± 0.004 | 0.99 | \n | tauPRD | 0.81 ± 0.05 | 0.57 ± 0.09 | 0.99 | \n | tauMTBD | 1.09 ± 0.01 | 0.29 ± 0.01 | 0.99 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5035134_001_00.png" ]
[ { "role": "user", "content": "<|image|>Convert the figure into Markdown format." }, { "role": "assistant", "content": "<md> | Variable | All HD Patients(N = 33) | \n | --- | --- | \n | Primary renal diagnosis (%) | | \n | Diabetic nephropathy | 24.2 [8] | \n | Polycystic kidney disease | 15.2 [5] | \n | Renovascular disease | 12.1 [4] | \n | Glomerulonephritis | 24.2 [8] | \n | Unknown cause | 12.1 [4] | \n | Other known | 12.1 [4] | \n | Length of time on HD (mo) | 5.5 ± 2.7 | \n | Mean UF volume (l) | 1.7 ± 1.0 | \n | Dialysis access (%) | | \n | Fistula | 81.8 [27] | \n | Graft | 3 [1] | \n | Tunneled line | 15.2 [5] | \n | Diabetes [%] | 24.2 [8] | \n | Hypertension [%] | 60.6 [20] | \n | Myocardial infarction [%] | 12.1 [4] | \n | Ischemic heart disease [%] | 18.2 [6] | \n | Stroke [%] | 15.2 [5] | \n | Peripheral vascular disease [%] | 9.1 [3] | \n | Systolic blood pressure (mm Hg) | 138 (131–155) | \n | Diastolic blood pressure (mm Hg) | 78 (67–83) | \n | Hemoglobin (mg/dl) | 111 (103–118) | \n | Urea reduction ratio (%) | 73 (68–78) | \n | Albumin (g/l) | 35 (32–36) | \n | C-reactive protein (mmol/l) | 8 (3–14) | \n | Phosphate (mmol/l) | 1.73 (1.33–2.18) | \n | Corrected calcium (mmol/l) | 2.35 (2.24–2.39) | \n | Parathyroid hormone (mmol/l) | 48.1 (24.5–85.9) | \n | Galectin-3 (ng/ml) | 17.5 (13.4–22.0) | \n | hs-Troponin Ta (pg/ml) | 33.7 (23.5–46.9) | \n | NT-BNPa (pg/ml) | 1934 (1111–5111.5) | \n | ECG QTcb (m/s) | 435 (412.8–453) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4931433_006_01.png" ]
[ { "role": "user", "content": "<|image|>Parse the following content of the figure in markdown code: <md> | Source | d.f. | MS | F | P | \n | --- | --- | --- | --- | --- | \n | Line | 3 | 0.048 | 3.723 | 0.150 | \n | Cactus | 1 | 0.014 | 1.273 | 0.336 | \n | Line × Cactus | 3 | 0.014 | 7.539 | 0.001 | \n | Wing Length | 1 | 0.001 | 0.806" }, { "role": "assistant", "content": "| 0.372 | \n | Error | 79 | 0.002 | | | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5289910_002_00.png" ]
[ { "role": "user", "content": "<|image|>Render the table in Markdown format." }, { "role": "assistant", "content": "<md> | Park use measurement | Sample mean (%) | \n | --- | --- | \n | Loops empty (% of observations) | 35.1 | \n | Average use per hour | 3.8 persons/hr | \n | Average use per week | 291 persons hr/week | \n | Average use by sex | \n | Females | 1.6/hr (43) | \n | Males | 2.1/hr (57) | \n | Average use by age group | \n | Children | 1.0/hr (27) | \n | Teens | 0.4/hr (11) | \n | Adults | 2.0/hr (54) | \n | Seniors | 0.3/hr (8) | \n | Apparent race/ethnicity of users | \n | Latino | 1.1/hr (29) | \n | African American | 0.9/hr (24) | \n | White | 1.5/hr (39) | \n | Asian and other | 0.3/hr (8) | \n | Observed activity levels of users | \n | Sedentary | 0.2/hr (5) | \n | Moderate | 2.9/hr (76) | \n | Vigorous | 0.7/hr (18) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC2760526_010_00.png" ]
[ { "role": "user", "content": "<|image|>What are the following photo content in markdown style: <md> | <underline>Category</underline> | <underline>Type</underline> | <underline>Count</underline> | <underline>Percent</underline> | \n | --- | --- | --- | --- | \n | False Positive Calls | Simple False Positives | 8 | 44% | \n | False Positive Calls | Reflected Duplication | 8 | 44% | \n | False Positive Calls | Reflected Overlap | 2 | 11% | \n | False Positive Calls | Total | 18 | 100% | \n | Missed Calls | Too Close | 14 | 58% | \n | Missed Calls | Overlapping Intervals | 3 | 13% | \n | Missed Calls | Ambiguous | 4 | 17% | \n" }, { "role": "assistant", "content": "| Missed Calls | Chromosome Ends | 3 | 13% | \n | Missed Calls | Total | 24 | 100% | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4932768_004_00.png" ]
[ { "role": "user", "content": "<|image|>What are the following image content in markdown style: <md> | Liking scores | Sex | Mean | SD a | Quartile 1 “Low liking” | Quartile 2 | Quartile 3 | Quartile 4 “High liking” | \n | --- | --- | --- | --- | --- | --- | --- | --- | \n | Fat | Women | 3.75 b | 1.40 | 0.00, 2.76 | 2.76, 3.65 | 3.65, 4.64 | 4.64, 8.80 | \n | | Men | 3.95 | 1.42 | 0.09, 2.97 | 2.97, 3.86 | 3.86, 4.84 | 4.84, 9.61 | \n | Sweet | Women | 3.64 b | 1.28 | 0.00, 2.72 | 2.72, 3.54 | 3.54, 4.47 | 4.47, 9.35 | \n | | Men |" }, { "role": "assistant", "content": "4.03 | 1.35 | 0.12, 3.07 | 3.07, 3.97 | 3.97, 4.94 | 4.94, 9.55 | \n | Salt | Women | 3.76 | 1.52 | 0.00, 2.77 | 2.77, 3.77 | 3.77, 4.72 | 4.72, 10.0 | \n | | Men | 3.80 | 1.59 | 0.00, 2.76 | 2.77, 3.82 | 3.82, 4.86 | 4.87, 10.0 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC2924253_001_00.png" ]
[ { "role": "user", "content": "<|image|>What are the following picture content in markdown style: <md> | | Controls | Cases | \n | --- | --- | --- | \n | Number | 96 | 96 | \n | Age | 43.2 | 42.8 | \n | Sex (M/F) | 47/49 | 48/48" }, { "role": "assistant", "content": "| \n | Age at Diagnosis | 16.3 | 16.2 | \n | Duration T1D | 27.8 | 27.5 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4772492_006_00.png" ]
[ { "role": "user", "content": "<|image|>Translate the image into Markdown format." }, { "role": "assistant", "content": "<md> | Variable | <COLSPAN=2> Chronic respiratory symptoms | COR (95 % CI) | AOR (95 % CI) | \n | --- | --- | --- | --- | --- | \n | | Yes | No | | | \n | <COLSPAN=5> Sex | \n | Male | 187 | 77 | 2.65(1.73,.4.05) | 2.07(1.18,3.63)* | \n | Female | 67 | 73 | 1.00 | 1.00 | \n | <COLSPAN=5> Age (years) | \n | 14-29 | 99 | 112 | 1.00 | 1.00 | \n | 30-44 | 86 | 24 | 4.05(2.39,6.87) | 3.56(1.80,7.02)*** | \n | 45+ | 69 | 14 | 5.58(2.96,10.52) | 4.20(1.94,9.12)*** | \n | <COLSPAN=5> Educational status | \n | ≤ Grade 8 | 77 | 29 | 3.46(1.93,6.20) | 4.07(1.86,8.92)*** | \n | Secondary school (Grade 9–12) | 134 | 65 | 2.69(1.64,4.41) | 2.63(1.35,5.12)** | \n | TVET and above | 43 | 56 | 1.00 | 1.00 | \n | <COLSPAN=5> Working department | \n | Raw mill | 76 | 94 | 1.00 | 1.00 | \n | Burner and clinker | 68 | 33 | 2.55(1.52,4.26) | 2.28(1.18,4.43)* | \n | Cement mill | 110 | 23 | 5.92(3.44,10.17) | 3.72(1.92,7.21)*** | \n | <COLSPAN=5> Service year | \n | ≤5 | 102 | 120 | 1.00 | 1.00 | \n | >5 | 152 | 30 | 5.96(3.72,9.56) | 5.44(3.09,9.59)*** | \n | <COLSPAN=5> Training on respiratory health | \n | Yes | 33 | 44 | 1.00 | 1.00 | \n | No | 221 | 106 | 2.78(1.67,4.62) | 2.73(1.41,5.29)** | \n | Smoking status | | | | | \n | Never smokers | 211 | 146 | 1.00 | 1.00 | \n | Ever Smokers | 43 | 4 | 7.44(2.61,21.17) | 5.38(1.42,20.39)** | \n | <COLSPAN=5> Previous chronic respiratory disease | \n | Yes | 38 | 3 | 8.62(2.61,28.45) | 7.79(2.02,30.04)*** | \n | No | 216 | 147 | 1.00 | | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4197215_003_03.png" ]
[ { "role": "user", "content": "<|image|>What are the following table content in markdown style: <md> | | Time (h) | TMA | IGG | PFA | \n | --- | ---" }, { "role": "assistant", "content": "| --- | --- | --- | \n | C. albicans | 24 | 7.69 | 4.00 | 4.00 | \n | A. fumigatus | | 33.33 | 33.33 | 4.00 | \n | C. neoformans | | 7.69 | 33.33 | 7.69 | \n | C. albicans | 48 | 4.00 | 4.00 | 4.00 | \n | A. fumigatus | | 33.33 | 33.33 | 4.00 | \n | C. neoformans | | 7.69 | 33.33 | 7.69 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5907559_007_00.png" ]
[ { "role": "user", "content": "<|image|>Convert the image into Markdown language." }, { "role": "assistant", "content": "<md> | Outcome | HR | 95% CI | P Value | \n | --- | --- | --- | --- | \n | <COLSPAN=4> Incident MI | \n | All participants (N=991) | 2.68 | 1.86–3.85 | <0.001 | \n | Obstructive CAD (n=619) | 1.87 | 1.16–3.00 | 0.01 | \n | Nonobstructive CAD (N=226) | 8.41 | 2.77–25.5 | <0.001 | \n | <COLSPAN=4> Incident HF | \n | All participants (N=991) | 1.60 | 1.21–2.13 | 0.001 | \n | Obstructive CAD (n=619) | 1.17 | 0.76–1.80 | 0.46 | \n | Nonobstructive CAD (n=226) | 1.61 | 0.85–3.06 | 0.14 | \n | <COLSPAN=4> Cardiovascular death | \n | All participants (N=991) | 2.29 | 1.40–3.75 | 0.001 | \n | Obstructive CAD (n=619) | 2.74 | 1.48–5.06 | 0.001 | \n | Nonobstructive CAD (n=226) | 3.60 | 1.15–11.3 | 0.03 | \n | <COLSPAN=4> All‐cause death | \n | All participants (N=991) | 1.84 | 1.22–2.78 | 0.004 | \n | Obstructive CAD (n=619) | 2.06 | 1.26–3.37 | 0.004 | \n | Nonobstructive CAD (n=226) | 2.25 | 0.83–6.12 | 0.11 | \n | <COLSPAN=4> Incident MI/HF/all‐cause death | \n | All participants (N=991) | 1.62 | 1.26–2.08 | <0.001 | \n | Obstructive CAD (n=619) | 1.71 | 1.25–2.33 | <0.001 | \n | Nonobstructive CAD (n=226) | 1.60 | 0.88–2.90 | 0.12 | \n | <COLSPAN=4> Incident MI/cardiovascular death | \n | All participants (N=991) | 2.22 | 1.60–3.08 | <0.001 | \n | Obstructive CAD (n=619) | 2.06 | 1.40–3.05 | <0.001 | \n | Nonobstructive CAD (n=226) | 4.70 | 2.17–10.18 | <0.001 | \n | <COLSPAN=4> Incident MI/all‐cause death | \n | All participants (N=991) | 2.13 | 1.56–2.90 | <0.001 | \n | Obstructive CAD (n=619) | 2.06 | 1.42–2.98 | <0.001 | \n | Nonobstructive CAD (n=226) | 3.62 | 1.78–7.37 | <0.001 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC1751069_002_00.png" ]
[ { "role": "user", "content": "<|image|>Express the illustration as Markdown code." }, { "role": "assistant", "content": "<md> | Characteristic | All studied patients | 'High-scoring patients' | 'Low-scoring patients' | \n | --- | --- | --- | --- | \n | Risk for development of PTSD, n (percentage) | 65 | 18 (29%) | 44 (71%) | \n | PTSD score (mean ± SD) | 28.1 ± 13.9 | 46.3 ± 8.9 | 20.6 ± 7.1a | \n | Age, years (mean ± SD) | 39 ± 15 | 41 ± 13 | 39 ± 15 | \n | Sex, n (male/female) | 35/30 | 8/10 | 25/19 | \n | Period between discharge and study, months (mean ± SD) | 57 ± 32 | 56 ± 33 | 59 ± 31 | \n | Lung Injury Score (mean ± SD) | 3.2 ± 0.5 | 3.3 ± 0.5 | 3.2 ± 0.5 | \n | APACHE II score (mean ± SD) | 16 ± 6 | 15 ± 4 | 16 ± 6 | \n | ICU length of stay, days (mean ± SD) | 47 ± 32 | 59 ± 37.0 | 42 ± 29b | \n | Duration of mechanical ventilation, days (mean ± SD) | 30 ± 22 | 37 ± 22 | 27 ± 22 | \n | Cause of ARDS, n (percentage within group) | | | | \n | Sepsis | 13 (20) | 5 (28) | 8 (18) | \n | Pneumonia | 28 (43) | 7 (39) | 20 (45.5) | \n | Multiple trauma | 20 (31) | 5 (28) | 14 (32) | \n | Other | 4 (6) | 1 (6) | 2 (4,5) | \n | ECMO, n (percentage within group) | 7 (11) | 3 (17) | 4 (9) | \n | Current status of employment, n (percentage within group) | | | | \n | Work/training | 29 (46) | 7 (39) | 22 (50) | \n | Unemployed/working at home | 5 (8) | 1 (5.5) | 4 (9) | \n | Retired | 7 (10) | 1 (5.5) | 6 (14) | \n | Disabled | 12 (18) | 8 (44) | 4 (9)b | \n | Others | 6 (13) | 1 (5.5) | 5 (11) | \n | No data | 3 (5) | - | 3 (7) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5297998_014_01.png" ]
[ { "role": "user", "content": "<|image|>Convert the picture into Markdown language." }, { "role": "assistant", "content": "<md> | <ROWSPAN=2> Interaction covariate | <COLSPAN=3> One‐stage | Two‐stage | \n | Amalgamated interaction (95% CI), p‐value | Within‐trial interaction (95% CI), p‐value | Across‐trial interaction (95% CI), p‐value | Within‐trial interaction (95% CI), p‐value | \n | --- | --- | --- | --- | --- | \n | Age | −0.067 (−0.094 to −0.040), <0.001 | −0.050 (−0.116 to 0.017), 0.142 | −0.071 (−0.100 to −0.041), <0.001 | −0.049 (−0.115 to 0.017), 0.142 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5838477_003_00.png" ]
[ { "role": "user", "content": "<|image|>Transcribe the image into Markdown format." }, { "role": "assistant", "content": "<md> | <ROWSPAN=2> Functional scale | <COLSPAN=2> Therapist-assisted | <ROWSPAN=2> P value | <COLSPAN=2> Robot-assisted | <ROWSPAN=2> P value | \n | Pre | Post | Pre | Post | \n | --- | --- | --- | --- | --- | --- | --- | \n | BBS | 27.3 ± 10.8 | 35.5 ± 14.1 | 0.012∗ | 26.6 ± 18.0 | 32.4 ± 18.8 | 0.018∗ | \n | TUG | 0 : 28 ± 0 : 11 | 0 : 22 ± 0 : 10 | 0.017∗ | 0 : 46 ± 0.40 | 0 : 27 ± 0 : 17 | 0.011∗ | \n | FIM | 80.9 ± 9.6 | 85.4 ± 8.2 | 0.016∗ | 73.9 ± 14.6 | 78.5 ± 12.9 | 0.042∗ | \n | SARA | 18.9 ± 6.8 | 15.4 ± 5.6 | 0.012∗ | 18.7 ± 7.6 | 15.2 ± 6.8 | 0.018∗ | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5069909_002_00.png" ]
[ { "role": "user", "content": "<|image|>Transform the diagram into Markdown format." }, { "role": "assistant", "content": "<md> | Groups | Mean (SD) | Median | Min | Max | \n | --- | --- | --- | --- | --- | \n | Control | 23 (100) | 103000 | 11000 | 271000 | \n | NaOCl gel | 21 (91.3) | 1 | 0 | 17 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5011806_003_00.png" ]
[ { "role": "user", "content": "<|image|>Parse the following content of the table in markdown code: <md> | <ROWSPAN=2> Pair | <ROWSPAN=2> pol distance (%) | <COLSPAN=2> No. of env sequences | <ROWSPAN=2> env distance (%) | <COLSPAN=2> env diversity (%) | <COLSPAN=2> Infection stage | \n | T | R | T | R | T | R | \n | --- | --- | --- | --- | --- | --- | --- | --- | --- | \n | T1–R1 | 0.24 | 28 | 23 | 1.45 | 3.05 | 0.26 | Chronic | Acute | \n | T2–R2 | 0.48 | 21 | 27 | 2.45 | 4.61 | 0.18 | Chronic | Acute | \n | T3–R3 | 0.71 | 20 | 11 | 1.49 | 3.37 | 0.10 | Chronic |" }, { "role": "assistant", "content": "Acute | \n | T4–R4 | 0.48 | 30 | 10 | 0.85 | 1.69 | 0.07 | Chronic | Acute | \n | T5–R5 | 0.23 | 18 | 19 | 0.28 | 0.93 | 0.22 | Chronic | Acute | \n | T6–R6 | 0.24 | 25 | 18 | 0.11 | 0.51 | 0.34 | Recent | Acute | \n | T7–R7 | 0.15 | 5 | 18 | 0.12 | 0.34 | 0.12 | eART-STIb | Acute | \n | T8–R8 | 0.08 | 17 | 19 | 0.32 | 0.50 | 0.11 | eART-STIb | Acute | \n | T9–R9 | 0.16 | 5a | 8 | 1.40 | 1.08 | 0.35 | Recent | Acute | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3305645_001_00.png" ]
[ { "role": "user", "content": "<|image|>Parse the following content of the diagram in markdown code: <md> | Case No. | ITV (cc) | PTV (cc) | <COLSPAN=2> Location | \n | --- | --- | --- | --- | --- | \n | 1 | 9.4 | 31.4 | Rt | S1 | \n | 2 | 5.1 | 22.2 | Rt | S6 | \n | 3 | 29.8 | 74.6 | Rt | S10 | \n | 4 | 8.4 | 30.3 | Rt | S3 | \n | 5 | 4.0 | 17.4 | Lt | S1+2 | \n | 6 | 9.6 | 33.0 | Rt | hilum | \n | 7 | 16.9 | 48.5 | Lt | S1+2 | \n | 8 | 15.6 | 45.7 | Lt | S10 | \n | 9 | 8.7 | 33.6 | Rt | S8" }, { "role": "assistant", "content": "| \n | 10 | 7.6 | 29.1 | Rt | S8 | \n | 11 | 7.5 | 26.7 | Rt | S8 | \n | 12 | 41.1 | 98.3 | Rt | hilum | \n | 13 | 9.7 | 33.3 | Rt | S3 | \n | 14 | 8.8 | 30.7 | Rt | S8 | \n | 15 | 42.2 | 98.8 | Lt | S1+2 | \n | 16 | 3.8 | 16.2 | Lt | S1+2 | \n | 17 | 2.3 | 12.2 | Lt | S8 | \n | 18 | 38.9 | 85.4 | Rt | S10 | \n | 19 | 2.3 | 12.1 | Rt | S5 | \n | 20 | 6.6 | 23.0 | Rt | S3 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4676856_008_00.png" ]
[ { "role": "user", "content": "<|image|>Render the table in Markdown format." }, { "role": "assistant", "content": "<md> | Outcomes | Screening | Screening + HPV vaccination | Incremental value | ICER (ZAR/QALY) | \n | --- | --- | --- | --- | --- | \n | <COLSPAN=5> NO DISCOUNTING | \n | Total costs | ZAR 295 251 951 | ZAR 248 833 762 | ZAR −46 418 189 | | \n | Vaccine cost | ZAR 0 | ZAR 183 228 152 | ZAR 183 228 152 | | \n | Screening cost | ZAR 19 794 328 | ZAR 21 262 010 | ZAR 1 467 682 | | \n | CIN1 treatment cost | ZAR 3 641 306 | ZAR 557 658 | ZAR −3 083 648 | | \n | CIN2/3 treatment cost | ZAR 3 545 580 | ZAR 561 971 | ZAR −2 983 609 | | \n | CC treatment cost | ZAR 268 270 736 | ZAR 43 223 970 | ZAR −225 046 766 | | \n | Life years | 3 179 736 | 3 186 707 | 6 971 | | \n | CC cases | 2 161 | 348 | −1 813 | | \n | CC cancer deaths | 2 035 | 328 | −1 707 | | \n | QALYs | 2 573 677 | 2 580 925 | 7 248 | V + S dominant | \n | <COLSPAN=5> DISCOUNTED AT 5 % | \n | Total costs | ZAR 62 169 185 | ZAR 198 527 858 | ZAR 136 358 673 | | \n | Vaccine cost | ZAR 0 | ZAR 183 228 152 | ZAR 183 228 152 | | \n | Screening cost | ZAR 5 766 054 | ZAR 6 223 334 | ZAR 457 279 | | \n | CIN1 treatment cost | ZAR 1 126 206 | ZAR 177 452 | ZAR −948 755 | | \n | CIN2/3 treatment cost | ZAR 1 183 601 | ZAR 190 676 | ZAR −992 925 | | \n | CC treatment cost | ZAR 54 093 324 | ZAR 8 708 245 | ZAR −45 385 079 | | \n | Life years | 1 283 817 | 1 285 076 | 1 259 | | \n | QALYs | 1 039 522 | 1 040 852 | 1 331 | ZAR 102 479 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5818953_005_00.png" ]
[ { "role": "user", "content": "<|image|>Express the diagram as Markdown code." }, { "role": "assistant", "content": "<md> | <ROWSPAN=2> Case number | <ROWSPAN=2> Age (years) | <ROWSPAN=2> Sex | <ROWSPAN=2> Number of leakage points | <ROWSPAN=2> Location of leakage points | <ROWSPAN=2> Number of laser shots | <COLSPAN=2> Energy, μJ | \n | Minimum | Maximum | \n | --- | --- | --- | --- | --- | --- | --- | --- | \n | 1 | 54 | F | 2 | Extrafoveal | 7 | 120 | 140 | \n | 2 | 40 | M | 1 | Extrafoveal | 4 | 90 | 90 | \n | 3 | 48 | M | 1 | Extrafoveal | 5 | 100 | 110 | \n | 4 | 34 | M | 1 | Extrafoveal | 6 | 80 | 90 | \n | 5 | 38 | M | 1 | Extrafoveal | 5 | 105 | 120 | \n | 6 | 35 | M | 2 | Extrafoveal | 7 | 100 | 100 | \n | 7 | 45 | M | 1 | Juxtafoveal | 5 | 90 | 100 | \n | 8 | 35 | M | 1 | Extrafoveal | 4 | 95 | 100 | \n | 9 | 39 | M | 2 | Extrafoveal | 8 | 100 | 110 | \n | 10 | 50 | M | 1 | Extrafoveal | 4 | 80 | 80 | \n | 11 | 48 | M | 1 | Extrafoveal | 5 | 100 | 100 | \n | 12 | 51 | M | 2 | Extrafoveal | 5 | 95 | 110 | \n | 13 | 53 | F | 1 | Extrafoveal | 5 | 105 | 110 | \n | 14 | 53 | F | 1 | Extrafoveal | 5 | 100 | 100 | \n | 15 | 39 | M | 1 | Extrafoveal | 7 | 95 | 120 | \n | 16 | 52 | M | 1 | Extrafoveal | 5 | 90 | 90 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4693015_005_00.png" ]
[ { "role": "user", "content": "<|image|>Transcribe the picture into Markdown format." }, { "role": "assistant", "content": "<md> | Origin | Testing agents | Effects | Model | Ref. | \n | --- | --- | --- | --- | --- | \n | Sweet taste receptor | | | | | \n | <ROWSPAN=5> Panax ginseng | <ROWSPAN=2> Rb1 | Decrease food intake, body weight, and body fat mass; decrease fasting blood glucose; decrease blood glucose during the IPGTT; increase plasma insulin | HFD obese rats | [22] | \n | GLP-1 secretion | Human L cell line | [23] | \n | Rb2 | GLP-1 secretion | Human L cell line | [23] | \n | Re | Reduces fasting blood glucose | ob/ob mice | [24] | \n | Rg3 | Insulin secretionDecrease blood glucose during the OGTT | Rodent β cell lineICR mice | [25] | \n | Bitter taste receptor | | | | | \n | Plasmodium falciparum | Quinine | GLP-1 secretion | Human L cell line | [26] | \n | Anemarrhena asphodeloides | EA fr. | GLP-1 secretion | Human L cell line | [27] | \n | Bupleurum falcatum | HX fr. | GLP-1 secretionDecrease blood glucose during the OGTT | Human L cell linedb/db mice | [28] | \n | Citrus aurantium | HX fr. | GLP-1 secretion | Human L cell line | [29] | \n | <ROWSPAN=2> Gentiana scabra | ExtractLoganic acid | GLP-1 secretion | Human L cell line | <ROWSPAN=2> [30] | \n | Extract | Increase plasma GLP-1 and plasma insulin; decrease blood glucose during the OGTT | db/db mice | \n | Cannabinoid receptor | | | | | \n | <ROWSPAN=2> Hoodia extract | <ROWSPAN=2> ExtractGordonoside F | Decreases blood glucose during the OGTT; increases plasma GLP-1 and insulin; decreases cumulative food intake | C57BL/6 mice | <ROWSPAN=2> [31] | \n | Glucose stimulated insulin secretion | Isolated rat islets | \n | Bile acid receptor | | | | | \n | Panax ginseng | Compound K | GLP-1 secretion | Human L cell line | [32] | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4367981_007_00.png" ]
[ { "role": "user", "content": "<|image|>Interpret the diagram as Markdown format." }, { "role": "assistant", "content": "<md> | Gene | Fold-change of down-regulation in response to 1% O2* | \n | --- | --- | \n | cards1 | 4.93 ± 0.78† | \n | glpF | 1.67 ± 0.88 | \n | katE | 5.37 ± 2.60† | \n | sodA | 1.35 ± 1.06 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5508649_004_01.png" ]
[ { "role": "user", "content": "<|image|>Parse the diagram content behind with markdown code: <md> | | <COLSPAN=2> Gender | Overall (N = 108) | \n | (Cronbach’s α 0.845) | Female (N = 84) | Male (N = 24) | Male and female | \n | --- | --- | --- | --- | \n | 1. Standardized (e.g. simulated) patients’ assessment of their interactions with students | 6.84 ± 1.70 | 7.04 ± 1.68 | 6.89 ± 1.69 | \n | 2. Faculty direct observation of students’ interactions with actual patients | 7.60 ± 1.31 | 7.67 ± 1.13 | 7.62 ± 1.26 | \n | 3. Faculty observation of videotaped interactions of students with actual patients | 6.45 ± 2.04 | 6.46 ± 2.13 | 6.45 ± 2.05 | \n | 4. Faculty observation of students’ interactions with clinical team members | 7.31 ± 1.51 | 7.29 ± 1.33 | 7.31 ± 1.46 | \n | 5. Students’ written and observational skills in analyzing ‘trigger’ videotapes | 5.77 ± 2.14 | 5.92 ± 1.56 | 5.80 ± 2.02 | \n" }, { "role": "assistant", "content": "| 6. Written exercises as follow-ups to standardized (e.g., simulated) patient interactions | 5.73 ± 1.95 | 6.00 ± 2.00 | 5.79 ± 1.95 | \n | 7. Evaluation of students by non-faculty staff | 6.54 ± 1.98 | 6.33 ± 2.60 | 6.50 ± 2.12 | \n | 8. Evaluation of students by patients | 7.20 ± 1.99 | 7.13 ± 2.86 | 7.19 ± 2.20 | \n | Group means | 6.68 ± 1.31 | 6.73 ± 1.28 | 6.69 ± 1.30 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4575746_003_00.png" ]
[ { "role": "user", "content": "<|image|>Convert the diagram into Markdown format." }, { "role": "assistant", "content": "<md> | Number | Constituent | RT (min) | Peak area (%) | \n | --- | --- | --- | --- | \n | 1 | α-Phellandrene | 9.02 | 0.081 | \n | 2 | α-Pinene | 9.28 | 0.159 | \n | 3 | β-Pinene | 10.91 | 11.438 | \n | 4 | α-Myrcene | 11.01 | 0.146 | \n | 5 | Terpinolene | 11.66 | 0.018 | \n | 6 | Limonene | 12.37 | 0.049 | \n | 7 | β-Phellandrene | 12.70 | 0.037 | \n | 8 | Benzene | 12.85 | 2.642 | \n | 9 | Eucalyptol | 13.05 | 0.037 | \n | 10 | γ-Terpinene | 13.44 | 10.698 | \n | 11 | Linalool | 16.58 | 0.011 | \n | 12 | 2,6-Dimethyl-3,5,7-octatriene-2-ol | 19.10 | 0.011 | \n | 13 | 4-Methyl-1-(1-methylethyl)- | 19.43 | 0.031 | \n | 14 | 1,3-Cyclohexadiene-1-methanol | 20.37 | 2.023 | \n | 15 | Cuminaldehyde | 23.18 | 48.773 | \n | 16 | 3-Cyclohexene-1-carboxaldehyde, 1,3,4-trimethyl- | 24.07 | 0.064 | \n | 17 | 1H-Cyclopropa[a]naphthalene,1a,2,3,5,6,7,7a,7b-octahydro-1,1,7,7a-tetramethyl-, [1aR-(1aà,7à,7aà,7bà)]- | 24.26 | 0.034 | \n | 18 | 3-Caren-10-al | 24.59 | 14.000 | \n | 19 | 2-Caren-10-al | 24.77 | 9.355 | \n | 20 | Benzenemethanol, 4-(1-methylethyl)- | 25.35 | 0.078 | \n | 21 | Bicyclo[3.1.1]hept-2-ene-2-methanol, 6,6-dimethyl- | 25.85 | 0.016 | \n | 22 | cis-à-Bisabolene | 26.29 | 0.026 | \n | 23 | 1,6,10-Dodecatriene, 7,11-dimethyl-3-methylene-, (E)- | 26.52 | 0.029 | \n | 24 | γ-Elemene | 27.70 | 0.031 | \n | 25 | Naphthalene | 27.78 | 0.012 | \n | 26 | Carotol | 31.81 | 0.011 | \n | | Total identified | | 99.81 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3462142_004_01.png" ]
[ { "role": "user", "content": "<|image|>Translate the illustration into Markdown format." }, { "role": "assistant", "content": "<md> | | CM | SC | Pvalue | \n | | (n=18) | (n=156) | | \n | --- | --- | --- | --- | \n | Operation time (min) | | | | \n | Mean | 129±34 | 108±48 | 0.084 | \n | Range | 63–190 | 50–375 | | \n | Amount of bleeding (mL) | | | | \n | Mean | 146.7±185.2 | 79.7±236.4 | 0.247 | \n | Range | 0–675 | 0–1970 | | \n | Success rate of | | | <0.001 | \n | intraoperative cholangiography | | | | \n | Possible | 9 | 145 | | \n | Not possible | 9 | 11 | | \n | Site of proximal bile duct stump | | | <0.001 | \n | Cystic duct | 11 | 148 | | \n | Neck of gallbladder | 7 | 8 | | \n | Methodology of treatment | | | | \n | for bile duct stump | | | | \n | Clip | 6 | 131 | <0.001 | \n | Endoloop | 1 | 2 | | \n | Ligation | 4 | 7 | | \n | Suture | 3 | 6 | | \n | Elastic yarn (for transcystic drainage) | 2 | 10 | | \n | None | 2 | 0 | | \n | Conversion rate (%) | 6/17(35.3) | 7/146(4.8) | <0.001 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3226184_004_00.png" ]
[ { "role": "user", "content": "<|image|>Transcribe the illustration into Markdown format." }, { "role": "assistant", "content": "<md> | Rank | AFX_1 | AFX_2 | ABI | AG1 | GEH | \n | --- | --- | --- | --- | --- | --- | \n | 1 | neoplasia | tumor | tumor | cancer | tumorigenesis | \n | 2 | cancer | cancer | cancer | tumorigenesis | neoplasia | \n | 3 | tumor | primary tumor | neoplasia | neoplasia | cancer | \n | 4 | primary tumor | malignant tumor | primary tumor | tumor | tumor | \n | 5 | malignant tumor | carcinoma | malignant tumor | primary tumor | primary tumor | \n | 6 | carcinoma | inflammatory response | carcinoma | malignant tumor | malignant tumor | \n | 7 | colorectal cancer | immune response | genetic disorder | carcinoma | carcinoma | \n | 8 | inflammatory response | digestive organ tumor | digestive organ tumor | digestive organ tumor | inflammatory response | \n | 9 | morphogenesis | dermatological disorder | inflammatory disorder | inflammatory disorder | colorectal cancer | \n | 10 | immunological disorder | inflammatory disorder | colorectal cancer | immunological disorder | endometriosis | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4240846_004_00.png" ]
[ { "role": "user", "content": "<|image|>Translate the photo into Markdown format." }, { "role": "assistant", "content": "<md> | | Family planning services | Disease specific approach | Capacity building approach | Use of ICT | Support of research initiatives | \n | --- | --- | --- | --- | --- | --- | \n | Random effects | | | | | | \n | Between donors (within donors) | 1.07 (1.03) | 0.71 (0.84) | 1.02 (1.01) | 1.44 (1.20) | 1.24 (1.11) | \n | Fixed effects | | | | | | \n | (Intercept) | −0.14 (0.50) | −1.83*** (0.47) | 0.70 (0.50) | −3.68*** (0.80) | −2.67*** (0.62) | \n | Corporations | −1.31# (0.77) | 0.09 (0.75) | 1.42# (0.85) | 2.71** (1.05) | −0.30 (1.06) | \n | Foundations | −2.36** (0.90) | −1.50# v | −1.85* (0.74) | 1.31 (1.05) | 2.66** (0.85) | \n | AIC | 310.2 | 207 | 288.7 | 184.4 | 205.6 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4071018_001_00.png" ]
[ { "role": "user", "content": "<|image|>Convert the table into Markdown language." }, { "role": "assistant", "content": "<md> | Study | Region | Diagnostic criteria | Prevalence (per million population) | Prevalence > 50 yrs (per million population) | \n | --- | --- | --- | --- | --- | \n | Lingberg et al.[2] | Sweden | Biopsy and clinical data | 2.2 | n/a | \n | Kaipiainen-Seppanen and Aho[4] | Finland | Not mentioned | 0.9 | n/a | \n | Philips et al.[5] | Australia | Griggs et al. criteria | 9.3 | 35.3 | \n | Badrising et al.[3] | Netherlands | ENMC criteria | 4.9 | 16 | \n | Felice and North (Connecticut, USA)[6] | Connecticut, USA | Griggs et al. criteria | 10.7 | 28.9 (>45 yrs) | \n | Needham et al.[1] | Western Australia | Clinical and biopsy criteria | 14.9 | 51.2 | \n | Wilson et al.[7] | Olmsted County, USA | Griggs et al. criteria | 71 | n/a | \n | Oflazer et al.[8] | Istanbul, Turkey | Own criteria from the study (biopsy and clinical data) | 1.0 | 6.0 | \n | <ROWSPAN=2> Suzuki et al.[9] | <ROWSPAN=2> Japan | <ROWSPAN=2> Clinical and biopsy criteria | 1.3 (in 1991) | n/a | \n | 9.8 (in 2003) | n/a | \n | Tan et al.[10] | South Australia | Biopsy and clinical data | 50.5 | 139.3 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5187424_002_01.png" ]
[ { "role": "user", "content": "<|image|>Parse the photo content behind with markdown code: <md> | Gene set | Number of genes | Enrichment Score | P-value | Qvalue | Rank | \n | --- | --- | --- | --- | --- | --- | \n | Cilia-microtubule function | 8 | 2.05 | 2.1 × 10−8 | 0.01 | 1 | \n | Reactome loss of nlp from mitotic centrosomes | 27 | 1.93 | 3.1 × 10−4 | 0.11 | 2 | \n | Chromosome segregation | 16 | 1.84 | 1.8 × 10−3 | 0.37 | 3 | \n | Reactome recruitment of mitotic centrosome proteins and complexes | 31 | 1.83 | 6.7 × 10−4 | 0.34 | 4 | \n | Reactome glutathione conjugation | 10 | 1.82 | 2.2 × 10−3 | 0.34 | 5 | \n | Response to light stimulus | 23 | 1.81 | 2.1 × 10−3 | 0.33 | 6 | \n | Respiratory gaseous exchange | 6 | 1.80 | 8.3 × 10−4 | 0.31 | 7 | \n | Response to radiation | 29 | 1.78 | 2.8 × 10−3 | 0.37 | 8 | \n | Kegg abc transporters | 30 | 1.78 | 2.1 × 10−3 | 0.36 | 9 | \n | Response to ultraviolet | 15 | 1.76 | 6.1 × 10−3 | 0.41 | 10 | \n | Photoreceptor cell maintenance | 7 | 1.75 | 3.8 × 10−3 | 0.45 | 11 | \n | Chromosome organization and biogenesis | 41 | 1.74 | 1.7 × 10−3 | 0.46 | 12 | \n | Regulation of" }, { "role": "assistant", "content": "endocytosis | 6 | 1.72 | 4.4 × 10−3 | 0.55 | 13 | \n | Reactome mitotic g2 g2 m phases | 35 | 1.72 | 4.1 × 10−3 | 0.54 | 14 | \n | Membrane fusion | 11 | 1.71 | 9.4 × 10−3 | 0.52 | 15 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3488573_002_00.png" ]
[ { "role": "user", "content": "<|image|>Continue parse the illustration with markdown style: <md> | Gene Name | Forward Primer (5'-3') |" }, { "role": "assistant", "content": "Reverse Primer (5'-3') | \n | --- | --- | --- | \n | Claudin-2 | GACCCCTAAGGCTGAGGAAC | AGAAGAGGAGGCCCAAGGAAG | \n | Cdx-2 | GCCAGGTCCTCTGAGAAGTG | CCTCTGAGAGCCAGGTCTGT | \n | Cdx-2-siRNA | GACAAGGACGUGAGCAUGUACCCUA | UAGGGUACAUGCUCACGUCCUUGUC | \n | 18srRNA | AAACGGCTACCACATCCAAG | TAACGAGGATCCATTGGAGG | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3130658_005_00.png" ]
[ { "role": "user", "content": "<|image|>Parse the following content of the illustration in markdown code: <md> | Predictor | Coefficient B | 95% confidence interval for B | P value | \n | --- | --- | --- | --- | \n | PCS on entry into prison | -0.45 | -0.67 to -0.24 | <0.001 | \n | Age | -0.17 | -0.39 to 0.07 | 0.16 | \n | Self reported ethnicity: white | 4.56 | -0.43 to 9.55 | 0.073 | \n | Left school aged 16 years or less | 3.20 | -2.58 to 8.98 | 0.27 | \n | Unemployed before coming into prison | -0.27 | -5.98 to 5.44 | 0.93 | \n | Has been in prison before | 0.52 | -5.15 to" }, { "role": "assistant", "content": "6.20 | 0.85 | \n | Intravenous drug use in week prior to imprisonment | 5.69 | -2.65 to 14.04 | 0.18 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4082174_005_00.png" ]
[ { "role": "user", "content": "<|image|>Parse the following content of the image in markdown code: <md> | | | Preoperative | Postoperative | Difference | p-value | \n | --- | --- | --- | --- | --- | --- | \n | <ROWSPAN=2> RA | base | - 11 ± 3 | - 5 ± 2 | 6 ± 3 | <0.001 | \n | mid | - 10 ± 3 | - 4 ± 2 | 6 ± 3 | <0.001 | \n | <ROWSPAN=2> IAS | base | - 7 ± 2 | - 6 ± 2 | 1 ± 2 | <0.001 | \n | mid | - 7 ± 2" }, { "role": "assistant", "content": "| - 5 ± 2 | 2 ± 2 | <0.001 | \n | <ROWSPAN=2> LA lat | base | - 8 ± 2 | - 6 ± 2 | 2 ± 2 | <0.001 | \n | mid | - 8 ± 3 | - 5 ± 2 | 3 ± 2 | <0.001 | \n | LA post | base | - 8 ± 2 | - 6 ± 2 | 2 ± 2 | 0.002 | \n | | mid | - 6 ± 2 | - 4 ± 1 | 2 ± 3 | <0.001 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5237462_004_03.png" ]
[ { "role": "user", "content": "<|image|>What are the following diagram content in markdown style: <md> | <ROWSPAN=2> Species | <COLSPAN=4> Concentration | \n | 100 mg·mL−1 | 50 mg·mL−1 | 10 mg·mL−1 | 1 mg·mL−1 | \n | --- | --- | --- | --- | --- | \n | M." }, { "role": "assistant", "content": "piperita | 7.6 ± 0.57 | 7 ± 0.0 | 9 ± 1.0 | 7.3 ± 0.57 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5964707_004_00.png" ]
[ { "role": "user", "content": "<|image|>What are the following picture content in markdown style: <md> | | Mean (SD) | Response rate (%) | Floora (%) | Ceilingb (%) | \n | --- | --- | --- | --- | --- | \n | Pain | 55.4 (22.3) | 98 | 0 | 2 | \n | Symptoms | 53.3 (13.4) | 100 | 0 | 0 | \n | Activities of Daily Living | 67.4 (23.0) | 100 | 0 |" }, { "role": "assistant", "content": "3 | \n | Sport and Recreation Function | 32.9 (25.9) | 98 | 9 | 3 | \n | Knee-related Quality of Life | 32.3 (22.5) | 100 | 7 | 2 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4587577_007_00.png" ]
[ { "role": "user", "content": "<|image|>Parse the following content of the diagram in markdown code: <md> | Motif number | Length (aa) | Conserved sequence | \n | --- | --- | --- | \n | motif1 | 30 | PGAFVVNVGDTLQALSNGRFKSVLHRVVVN | \n | motif2 | 18 | HTDPTILTILHQDQVGGL | \n | motif3 | 30 | ARLVVKACEEWGFFQVVNHGVPAELISRAE | \n | motif4 |" }, { "role": "assistant", "content": "19 | FEESDSILRLNHYPPCPEP | \n | motif5 | 19 | RLYRDFTWSEYLEFTQKHY | \n | motif6 | 19 | RLSMAYFLGPPLDKVISPL | \n | motif7 | 30 | GPPDPFGYGSKRIGPNGDVGWLEYLLLNTN | \n | motif8 | 19 | VVEEYCEAMKKLALKLLEL | \n | motif9 | 14 | RFSSKLPWKETLSF | \n | motif10 | 30 | DRFFALPLSQKQKAQRSPGEVCGYASAFIG | \n | motif11 | 14 | RADMNTLDAFSNWL | \n | motif12 | 30 | LSNGSYRWGTPTATSLRQLSWSEAFHIPLT | \n | motif13 | 19 | SVKDYFRKTWGNDFEQFGK | \n | motif14 | 19 | SEAYREHPLHLKHIIPLDF | \n | motif15 | 10 | LGDNRLGPFE | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5682902_005_02.png" ]
[ { "role": "user", "content": "<|image|>Parse the table content behind with markdown code: <md> | | OBS | SHY | PAS | MOODS | ABS | \n | --- | --- | --- | --- | --- | --- | \n | Global well-being | 26.80∗∗ | 27.58∗∗ | 32.79 | 29.07 | 27.25∗ | \n | IBS well-being | 4.60∗∗ | 10.32 | 8.24 | 6.30∗ | 4.00∗∗ | \n | FB well-being | 5.20 | 1.61∗ | 2.50 | 4.63 | 2.50 | \n | FD well-being | 11.20 | 13.70 | 13.82 | 11.85 |" }, { "role": "assistant", "content": "13.50 | \n | FC well-being | 5.80 | 1.94∗ | 8.23 | 6.30 | 7.25 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3292468_001_00.png" ]
[ { "role": "user", "content": "<|image|>What are the following figure content in markdown style: <md> | Characteristic | Value | \n | --- | --- | \n | Age (years) | | \n | Median | 73 | \n | Range | 42-89 | \n | Tumor size (cm) | | \n | Median | 1.0 | \n | Range | 0.1-3.5 | \n | Histology | | \n | Invasive ductal | 213 (68%) | \n | Invasive lobular | 31 (10%) | \n | DCIS | 68 (22%) | \n | Grade | | \n | Grade 1 | 142 (46%) | \n | Grade 2 | 114 (37%) | \n | Grade 3 | 53 (17%) | \n | Not stated | 3 (1%) | \n | Invasive tumors - EIC present | | \n | Yes | 34 (14%) | \n | No | 206 (84%) | \n | Not stated | 4 (2%) | \n | Invasive tumors - LVI present | | \n | Yes | 5 (2%) | \n | No | 235 (96%) | \n | Not stated | 4 (2%) | \n | DCIS tumors - Necrosis present | | \n | Yes | 36 (53%) | \n | No | 28 (41%) | \n | Not stated | 4 (6%) | \n | Nodal Status of invasive cancer | | \n | N0 | 207 (85%) | \n | N1 | 2 (1%) | \n | Nx | 35 (14%) | \n | ER/PR status | | \n | Positive | 282 (90%) | \n | Negative | 23 (7%) | \n | Not stated | 7 (2%) | \n | HER-2/neu status of invasive cancer | | \n | Positive | 11 (5%) | \n | Negative | 231 (95%) | \n | Not stated | 2 (1%) | \n | Surgical margins | | \n | Negative (≥" }, { "role": "assistant", "content": "2 mm) | 264 (85%) | \n | Close (< 2 mm) | 41 (13%) | \n | Positive | 7 (2%) | \n | Chemotherapy | | \n | Yes | 7 (2%) | \n | No | 305 (98%) | \n | Hormonal therapy | | \n | Yes | 166 (53%) | \n | No | 146 (47%) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4867990_003_00.png" ]
[ { "role": "user", "content": "<|image|>What are the following figure content in markdown style: <md> | | Total length (bp) | No. | Max length(bp) | Average length (bp) | N50 | GC % | \n | --- | --- | --- | --- | --- | --- | --- | \n | Contig | 92,485,665 | 273,199 | 17,250 | 338.53 | 409 | 46.05 | \n | Transcript | 84,205,775 | 162,496 | 17,250 | 518 | 634 | 43.60 | \n" }, { "role": "assistant", "content": "| Unigene | 21,739,745 | 25,925 | 17,250 | 839 | 1,250 | 39.51 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3180368_001_00.png" ]
[ { "role": "user", "content": "<|image|>What are the following table content in markdown style: <md> | | <COLSPAN=2> 2000 | <COLSPAN=2> 2009 | \n | | Number of visit | Percentage | Number of visit | Percentage | \n | --- | --- | --- | --- | --- | \n | 0-6 Y/O | 93210 | 53.4 | 62703 | 44.1 | \n | 7-18 Y/O |" }, { "role": "assistant", "content": "81441 | 46.6 | 79497 | 55.9 | \n | Total | 174651 | | 142200 | | \n | Male | 92386 | 52.9 | 75689 | 53.2 | \n | Female | 82005 | 47.0 | 66497 | 46.8 | \n | Missing | 260 | 0.1 | 14 | 0.0 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5381974_002_00.png" ]
[ { "role": "user", "content": "<|image|>Parse the following content of the photo in markdown code: <md> | Characteristics | Females [n (%)] | Males [n (%)] | \n | --- | --- | --- | \n | Age (years) at baselinea* | 30.0 ± 4.1 | 31.8 ± 4.9 | \n | BMI at baseline* | \n | Under/healthy (BMI < 25) | 229 (46) | 84 (17) | \n | Overweight (25 ≤ BMI < 30) | 136 (27) | 206 (42) | \n | Obese (30 ≤ BMI < 35) | 66 (13) | 131 (26) | \n | Morbidly obese (BMI ≥ 35) | 69 (14) | 75 (15) | \n | Missing values | 1 (< 1) | 5 (< 1) | \n | Mean ± SD* | 27.6 ± 7.3 | 29.8 ± 5.6 | \n | Race/Ethnicity | \n | Non-Hispanic white | 393 (79) | 394 (79) | \n | Non-Hispanic black | 24 (5) | 23 (5) | \n | Hispanic | 50 (10) | 45 (9) | \n | Other | 31 (6) | 36 (7) | \n | Missing values | 3 (< 1) | 3 (< 1) | \n | Household income | \n | < $70,000 | 157 (32) | 163 (33) | \n | ≥ $70,000 | 334 (68) | 328 (67) | \n | Missing values | 10 (2) | 10 (2) | \n | Parity conditional on gravidity | \n | No prior pregnancy | 210 (42) |" }, { "role": "assistant", "content": "215 (43) | \n | Prior pregnancy | \n | Without live birth(s) | 53 (11) | 44 (9) | \n | With live birth(s) | 235 (47) | 239 (48) | \n | Missing values | 3 (< 1) | 3 (< 1) | \n | Active smoking status* | \n | Yes (serum cotinine ≥ 10 ng/mL) | 58 (12) | 106 (22) | \n | No (serum cotinine < 10 ng/mL) | 431 (88) | 387 (79) | \n | Missing values | 12 (2) | 9 (2) | \n | <COLSPAN=3> BMI, body mass index (kg/m2). aMean ± SD. *p < 0.05 from independent t-test for continuous characteristics or chi-square test for categorical characteristics. | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC2265719_003_00.png" ]
[ { "role": "user", "content": "<|image|>What are the following diagram content in markdown style: <md> | Variable | Body Weight (Kg) | Total Body Fat (Kg) | Trunk Fat (Kg) | \n | --- | --- | --- | --- | \n | EGG | | | | \n | Baseline | 98.9 ± 15.3 | 30.2 ± 8.0 | 18.6 ± 5.5 | \n | 12 Weeks | 92.2 ± 12.7 | 25.4 ± 8.4 | 15.3 ± 5.7 | \n | SUB | | | | \n | Baseline | 97.6 ± 19.9 | 31.6 ± 12.4 | 19.8 ± 7.8 | \n | 12 Weeks | 91.7 ± 15.7 | 27.0 ± 12.0 | 16.6 ± 7.4 | \n | Time Effect | P < 0.0001 | P < 0.0001 |" }, { "role": "assistant", "content": "P < 0.0001 | \n | Diet Effect | NS | NS | NS | \n | Interaction | NS | NS | NS | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5855844_002_01.png" ]
[ { "role": "user", "content": "<|image|>Parse the following content of the illustration in markdown code: <md> | Treatments | Biomass (g) | Shoot Biomass (g) | Root Biomass (g) | Pn (μmol CO2·m−2·s−1) | Nodule Number per Plant | Dry Weight per Nodule (mg) | \n | --- | --- | --- | --- | --- | --- | --- | \n | <COLSPAN=7> Maize | \n | NS | 118.40 ± 6.26a | 95.13 ± 4.71a | 23.27 ± 1.55a | 40.38 ± 1.81a | / | / | \n | SS | 120.22 ± 5.56a | 94.95 ± 4.81a | 25.27 ± 0.75a | 40.23 ± 3.52a | / | / | \n | CS | 94.19 ± 2.98b | 76.16 ± 2.58b | 18.03 ± 0.40b | 34.48 ± 1.08b | / | / | \n | <COLSPAN=7> Peanut | \n | NS | 13.95 ± 0.99a | 12.36 ± 0.76a | 1.59" }, { "role": "assistant", "content": "± 0.23a | 26.60 ± 1.53a | 528.33 ± 25.42a | 0.51 ± 0.03ab | \n | SS | 14.60 ± 1.07a | 12.83 ± 0.70a | 1.77 ± 0.37a | 27.60 ± 1.63a | 626.00 ± 40.00a | 0.57 ± 0.06a | \n | CS | 14.30 ± 0.72a | 13.17 ± 0.66a | 1.13 ± 0.06b | 24.98 ± 1.67a | 310.00 ± 50.20b | 0.43 ± 0.04b | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC2014755_004_00.png" ]
[ { "role": "user", "content": "<|image|>Continue parse the illustration with markdown style: <md> | | Low | Intermediate | High | Mean score | \n | --- | --- | --- | --- | --- | \n | Hospital physicians | 8" }, { "role": "assistant", "content": "(4–15) | 15 | 77 (68–85) | 6.39 (6.04–6.73) | \n | General Practitioners | 15 (9–24) | 26 | 59 (49–69) | 5.74 (5.35–6.13) | \n | Public Health Nurses | 6 (2–13) | 23 | 71 (61–80) | 6.28 (5.97–6.58) | \n | Both panels together | 8 (4–15) | 22 | 70 (60–79) | 6.27 (5.96–6.58) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4006612_007_00.png" ]
[ { "role": "user", "content": "<|image|>Convert the figure into Markdown format." }, { "role": "assistant", "content": "<md> | Study | N subjects | Place of stimulation | Number of sessions | Length | Frequency | Intensity of stimulation | Sham stimulation | Assessment | Findings | \n | --- | --- | --- | --- | --- | --- | --- | --- | --- | --- | \n | Camprodon et al. (2007) [55] | 6 | Bilateral DLPFC | 2 sessions | 20 trains of 10 s | 10 Hz | 90% MT | No | Craving, anxiety, happiness, sadness, and discomfort, assessed by VAS | Reduction in craving (with right DLPFC rTMS); reduction in anxiety after right-sided rTMS; increase in happiness after right-sided and in sadness after left-sided rTMS; increase in discomfort equally by left- and right-sided stimulation | \n | Politi et al. (2008) [56] | 36 | Left DLPFC | 10 daily sessions | 20 trains of 2 s | 15 Hz | 100% MT | No | Clinical assessment of craving related symptoms | Reduction in craving | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3514327_003_00.png" ]
[ { "role": "user", "content": "<|image|>Convert the picture into Markdown language." }, { "role": "assistant", "content": "<md> | | <COLSPAN=3> Number of pen samples by the categories of the outcome variable | | <COLSPAN=3> Number of pen samples by the categories of the outcome variable | \n | --- | --- | --- | --- | --- | --- | --- | --- | \n | | 1 | 2 | 3 | | 1 | 2 | 3 | \n | <COLSPAN=8> PEN VARIABLES | \n | The pen has direct access to outside | | | | Sanitary gap before breeders entering | | | | \n | No | 1146 | 30 | 92 | No | 626 | 19 | 44 | \n | Yes | 354 | 16 | 32 | Yes | 874 | 27 | 80 | \n | Individual pen | | | | Feed | | | | \n | No | 1194 | 41 | 98 | Dry pellet | 229 | 7 | 27 | \n | Yes | 306 | 5 | 24 | Dry non pellet | 1230 | 36 | 97 | \n | Missing observations | 0 | 0 | 2 | Wet | 41 | 3 | 0 | \n | Diarrhoea in the last 3 months | | | | Floor | | | | \n | No | 1445 | 45 | 118 | Fully slatted | 139 | 5 | 10 | \n | Yes | 33 | 1 | 2 | Others | 1361 | 41 | 114 | \n | Missing observations | 22 | 0 | 4 | Source of feed | | | | \n | Age of the breeding sows | | | | Exclusively own | 199 | 8 | 8 | \n | Only gilts or gilts and others | 874 | 38 | 73 | Bought + Mixture | 1301 | 38 | 116 | \n | Without gilts | 626 | 8 | 51 | Potential Salmonella control substances added to water | | | | \n | Sex of the breeding pigs | | | | No | 1291 | 38 | 111 | \n | Only females | 1430 | 44 | 114 | Yes | 209 | 8 | 13 | \n | Males and females | 70 | 2 | 10 | Use of antibiotics in the last 4 weeks in breeders | | | | \n | Breeding sector | | | | No | 1229 | 45 | 103 | \n | Mating room | 210 | 10 | 21 | Yes | 271 | 1 | 21 | \n | Gestation room | 789 | 26 | 62 | Way how was collected the sample | | | | \n | Mixture of room | 58 | 1 | 14 | Compose sample | 121 | 1 | 11 | \n | Farrowing room | 390 | 7 | 22 | Swab | 1379 | 45 | 113 | \n | Replacement breeders | 44 | 2 | 5 | Number of pigs in the pen | | | | \n | | | | | =10 | 1284 | 34 | 94 | \n | | | | | >10 | 216 | 12 | 30 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4510414_002_02.png" ]
[ { "role": "user", "content": "<|image|>Continue parse the image with markdown style: <md> | Sites of recurrence | Frequency | \n | --- | --- | \n | Lymph nodes | 38 (71.7%) | \n | Supradiaphragmatic | 5 | \n | Supra and infradiaphragmatic | 12 | \n | Pelvis | 7 (13.2%) | \n | Liver | 10" }, { "role": "assistant", "content": "(18.9%) | \n | Bone | 2 (3.7%) | \n | Lung | 4 (7.5%) | \n | Peritoneal lesion | 16 (30.2%) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC2288615_002_01.png" ]
[ { "role": "user", "content": "<|image|>Parse the following content of the table in markdown code: <md> | Sampling location | Sample abbreviation | Freq. of Pan IA | Pan I genotype | No of fish | \n | --- | --- | --- | --- | --- | \n | Båtsfjord | NEAC | 0.125 |" }, { "role": "assistant", "content": "BB | 45 | \n | Malangen | NCC-N | 0.872 | AA | 11 | \n | Molde | NCC-S1 | 0.966 | AA | 30 | \n | Florø/Nærøysund | NCC-S2 | 0.980 | AA | 9 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC1557538_002_01.png" ]
[ { "role": "user", "content": "<|image|>Transcribe the diagram into Markdown format." }, { "role": "assistant", "content": "<md> | County of residence | Records reviewed | County errors (%) | Zip code errors (%) | \n | --- | --- | --- | --- | \n | Potter | 243 | 2 (0.82) | 14 (5.8) | \n | Randall | 111 | 16 (14.4) | 7 (6.3) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC2949606_002_00.png" ]
[ { "role": "user", "content": "<|image|>Express the diagram as Markdown code." }, { "role": "assistant", "content": "<md> | Trait | Unit | Biological importance | n | AVG | SD | max | min | \n | --- | --- | --- | --- | --- | --- | --- | --- | \n | Body weight | kg | | 162 | 51 | 9.0 | 31 | 77 | \n | Carcass weight | kg | | 165 | 28 | 4.4 | 16 | 40 | \n | Dressing percentage | % | Proportion final weight to carcass weight | 161 | 55 | 3 | 71 | 46 | \n | Total fat | kg | Indicator of total fatness | 165 | 14 | 5.6 | 4.6 | 33 | \n | Carcass fat | kg | Indicator of carcass fatness | 165 | 8.7 | 2.4 | 3.5 | 18 | \n | Internal fat | kg | Indicator of fatness in the internal depots | 165 | 3.8 | 1.6 | 1.1 | 8.8 | \n | Percent fat in carcass | % | Proportion of fat in the carcass | 165 | 31 | 4 | 22 | 45 | \n | Subcutaneous fat depth* | Pixel | Indicator of fatness | 161 | 5.9 | 2.3 | 1 | 13 | \n | Subcutaneous fat area | mm2 | Indicator of fatness | 165 | 980 | 480 | 36 | 2597 | \n | Total lean | kg | Indicator of total lean | 152 | 22 | 5.61 | 12 | 32 | \n | Carcass lean | kg | Indicator of muscularity | 165 | 16 | 2.34 | 10 | 22 | \n | Percent lean in carcass | % | Proportion of lean in carcass | 165 | 59 | 3 | 48 | 67 | \n | Eye muscle area* | mm2 | Indicator of muscularity | 165 | 4205 | 502 | 1245 | 5333 | \n | Total bone | kg | Indicator of total bone | 152 | 7.4 | 4.4 | 2.5 | 12 | \n | Carcass bone | kg | Indicator of size/quantity of bone | 165 | 2.9 | 0.34 | 1.98 | 4.2 | \n | Percent bone in carcass | % | Proportion of bone in carcass | 165 | 11 | 2 | 7 | 16 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5047873_004_00.png" ]
[ { "role": "user", "content": "<|image|>Continue parse the picture with markdown style: <md> | | Mannose | Rhamnose | Glucuronic acid | Galacturonic acid | Glucose | Galactose | Xylose | \n | --- | --- | --- | --- | --- | --- | --- | --- | \n | 0 h | 0.84 | 0.19 | 0 | 0 |" }, { "role": "assistant", "content": "38.3 | 0.69 | 0.58 | \n | 3 h | 9.7 | 13.59 | 0 | 0.29 | 72.07 | 38.46 | 17.22 | \n | 6 h | 13.41 | 25.68 | 0 | 0.35 | 78.17 | 78 | 53.9 | \n | 9 h | 10.37 | 37.32 | 0 | 0.51 | 51.51 | 70.69 | 66.75 | \n | 12 h | 8.37 | 32.64 | 0 | 0.78 | 42.36 | 57.11 | 65.33 | \n | 15 h | 7.37 | 28.78 | 0 | 0.9 | 38.24 | 44.51 | 58.58 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4921459_005_00.png" ]
[ { "role": "user", "content": "<|image|>Convert the picture into Markdown format." }, { "role": "assistant", "content": "<md> | | <COLSPAN=2> Entrance | <COLSPAN=2> Bragg peak | \n | | KES | MPS | KES | MPS | \n | --- | --- | --- | --- | --- | \n | 100 MeV | 0.82 | 1.42 | 0.35 | 0.65 | \n | 160 MeV | 2.92 | 1.87 | 1.19 | 1.71 | \n | 230 MeV | 3.15 | 1.62 | 2.01 | 4.44 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4235220_005_00.png" ]
[ { "role": "user", "content": "<|image|>Convert the diagram to Markdown syntax." }, { "role": "assistant", "content": "<md> | | No. of studies | No. of patients | HR (95%CI) | p-value | I2 (%) | \n | --- | --- | --- | --- | --- | --- | \n | Different Metastatic Positions | | | | | | \n | Peritoneal Dissmination [26,29,36,37] | 4 | 832 | 0.76 (0.63, 0.92) | 0.005 | 68 | \n | Liver Metastasis [29,36,38] | 3 | 365 | 0.41 (0.30, 0.55) | <0.00001 | 23 | \n | Lymph Node Metastasis [29,36] | 2 | 155 | 0.36 (0.23, 0.59) | <0.00001 | 90 | \n | Different Regions | | | | | | \n | Western Countries [27,30,32,35,39] | 5 | 639 | 0.65 (0.58, 0.73) | <0.00001 | 31 | \n | Asian Countries [26,29,31,33,34,36-38] | 8 | 2304 | 0.23 (0.17, 0.31) | <0.00001 | 93 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4475302_004_02.png" ]
[ { "role": "user", "content": "<|image|>Parse the following content of the illustration in markdown code: <md> | Responses explaining the main benefit of participation | n (%) | \n" }, { "role": "assistant", "content": "| --- | --- | \n | Improves my household’s current livelihood or access to services | 61 (13.5) | \n | Important in times of emergency/in future | 73 (16.1) | \n | Benefits the community | 239 (52.8) | \n | Enjoyment/recreation | 8 (1.8) | \n | Spiritual, social status, self-esteem | 5 (1.1) | \n | Other | 67 (14.8) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4426782_005_00.png" ]
[ { "role": "user", "content": "<|image|>Parse the diagram content behind with markdown code: <md> | Risk factors | Patients with risk factors accounting for the population of SMM | Probability of 2-year progression to symptomatic MM | \n | --- |" }, { "role": "assistant", "content": "--- | --- | \n | Bone marrow plasma cells ≥ 60% | 2–10% | 90% | \n | Serum-free light-chain ratio ≥ 100 | 15% | 80% | \n | Abnormal magnetic resonance imaging (>1 focal lesion) | 15% | 70% | \n | High peripheral blood plasma cellsa | 15% | 70% | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4748498_006_00.png" ]
[ { "role": "user", "content": "<|image|>Express the photo as Markdown code." }, { "role": "assistant", "content": "<md> | Gene name | Gene symbol | p value | FC | \n | --- | --- | --- | --- | \n | Non-SMC condensin I complex, subunit H | NCAPH | 1.46E−09 | 2.24 | \n | Polo-like kinase 1 | PLK1 | 1.54E−09 | 4.71 | \n | Cyclin A2 | CCNA2 | 1.94E−09 | 2.57 | \n | Serine/arginine-rich splicing factor 4 | SRSF4 | 1.15E−08 | −1.73 | \n | Protein regulator of cytokinesis 1 | PRC1 | 1.17E−08 | 2.17 | \n | TIMP metallopeptidase inhibitor 3 | TIMP3 | 1.24E−08 | 2.14 | \n | Lysine (K)-specific demethylase 5D | KDM5D | 2.59E−08 | 1.86 | \n | TPX2, microtubule-associated, homolog (Xenopus laevis) | TPX2 | 6.63E−08 | 2.64 | \n | Cell division cycle 20 homolog (S. cerevisiae) | CDC20 | 8.42E−08 | 3.08 | \n | Olfactory receptor, family 2, subfamily L, member 13 | OR2L13 | 9.20E−08 | −1.93 | \n | Prohibitin | PHB | 9.25E−08 | 1.99 | \n | ZW10 interactor | ZWINT | 9.82E−08 | 1.93 | \n | X-ray repair complementing defective repair in Chinese hamster cells 2 | XRCC2 | 1.44E−07 | 1.61 | \n | Brain expressed, X-linked 4 | BEX4 | 1.47E−07 | −1.76 | \n | Protein kinase, membrane associated tyrosine/threonine 1 | PKMYT1 | 1.61E−07 | 2.14 | \n | Golgin A8 family, member B | GOLGA8B | 1.62E−07 | −1.64 | \n | Holliday junction recognition protein | HJURP | 1.67E−07 | 2.55 | \n | S100 calcium binding protein A8 | S100A8 | 2.10E−07 | −5.24 | \n | TIMP metallopeptidase inhibitor 1 | TIMP1 | 6.34E−06 | 2.36 | \n | Chemokine (C–X–C motif) ligand 10 | CXCL10 | 2.04E−02 | 1.89 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5649065_004_00.png" ]
[ { "role": "user", "content": "<|image|>Convert the picture into Markdown language." }, { "role": "assistant", "content": "<md> | Level of care | Standard Zvandiri support | Enhanced Zvandiri support | \n | --- | --- | --- | \n | Eligibility criteria | • A viral load < 1000 copies/ml in last 6 months• CD4 count ≥ 200 cells/ml in last 6 months• Attending all scheduled clinic visits in last 3 months• Psychologically stable• Safe | • Commencing ART in past 3 months• A viral load ≥ 1000 copies/ml in the last 6 months• CD4 count < 200 cells/ml last 6 months• Pregnancy• Failing to attend ≥ 1 scheduled clinic visit(s) in last 3 months• Psychological distress• Abuse or neglect | \n | Intervention | • Monthly support group• Monthly home visit• Weekly SMS reminder• Zvandiri Centre contact• Caregiver workshop | • Monthly support group• Bi-weekly home visits• Daily SMS reminder• Weekly phone calls• Zvandiri Centre contact• Caregiver workshop• Referral and linkages• Community outreach visits | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3724692_003_00.png" ]
[ { "role": "user", "content": "<|image|>Convert the illustration to Markdown syntax." }, { "role": "assistant", "content": "<md> | Axis | Direction | Conditions | Mean | SD | SEM (95% CI) | ICC (95% CI) | P value | \n | --- | --- | --- | --- | --- | --- | --- | --- | \n | <ROWSPAN=3> X | <ROWSPAN=3> Anterior (+)/Posterior (−) | BL | 2.5 | 1.4 | 0.07 (0.02 to 0.27) | 0.999 (0.996 to 0.100) | <ROWSPAN=3> 0.10 | \n | SW | 2.4 | 1.4 | 0.03 (0.01 to 0.18) | 0.999 (0.998 to 0.100) | \n | RS | 2.1 | 1.2 | 0.04 (0.01 to 0.17) | 0.999 (0.998 to 0.100) | \n | <ROWSPAN=3> Y | <ROWSPAN=3> Superior (+)/Inferior (−) | BL | −1.4 | 1.2 | 0.03 (0.02 to 0.12) | 0.999 (0.998 to 0.100) | <ROWSPAN=3> 0.32 | \n | SW | −1.1 | 0.9 | 0.07 (0.04 to 0.41) | 0.993 (0.978 to 0.998) | \n | RS | −1.3 | 1.1 | 0.05 (0.04 to 0.25) | 0.997 (0.992 to 0.99.9) | \n | <ROWSPAN=3> Z | <ROWSPAN=3> Lateral (−)/Medial(+) | BL | −4.5 | 2.6 | 0.04 (0.01 to 0.18) | 0.100 (0.100 to 0.100) | <ROWSPAN=3> <0.001a | \n | SW | −2.9 | 2.6 | 0.06 (0.01 to 0.36) | 0.999 (0.998 to 0.100) | \n | RS | −4.4 | 2.7 | 0.05 (0.05 to 0.12) | 0.100 (0.999 to 0.100) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5828183_002_00.png" ]
[ { "role": "user", "content": "<|image|>Render the illustration in Markdown format." }, { "role": "assistant", "content": "<md> | <ROWSPAN=2> cells | <COLSPAN=2> Compound/IC50 | \n | Cisplatin (uM) | NVP-BEZ235 (nM) | \n | --- | --- | --- | \n | U2OS | 10.793 ± 0.097 | 198.433 ± 0.981 | \n | Saos-2 | 15.643 ± 0.193 | 197.800 ± 1.778 | \n | MG-63 | 7.873 ± 0.161 | 88.03 ± 0.531 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5466743_003_00.png" ]
[ { "role": "user", "content": "<|image|>Parse the image content behind with markdown code: <md> | | Study population (n = 185) | Israeli experts in Family Medicine (n = 1901) | Israeli physicians working as primary care physicians (n = 4627) | \n | --- | --- | --- | --- | \n | Gender | 56.9% Female | 56% Female | 45% Female | \n | Age | Average 45.4 ± 8.8 (Range 30-69) | 50.4% < 50a | 37% < 50a | \n | Country of Birth | 53.5% Israel | ND | 34.5% Israel | \n | <ROWSPAN=3> Country of MD training | 62.8% Israel | <ROWSPAN=3> ND | 35.7% Israel | \n | 17.8% Former USSR | 41.1% Former USSR | \n | 11.6% Europe/America | 24% Europe/America | \n | <ROWSPAN=3> Specialization | 66.4% Family Medicine | <ROWSPAN=3> Not relevant | 32% Family Medicine | \n | 16% Residents | 44% Non-specialists | \n | 17.6% Other specialization or non-specialists | 24% Other specialization (approx. 50% of whom are specialists in Internal Medicine) | \n | <ROWSPAN=3> Form of employment | 80% Employed | 62% Employed | <ROWSPAN=3> ND | \n | <ROWSPAN=2> 20% Self Employed | 6% Self Employed | \n | 32% Both | \n | <ROWSPAN=4> HMO | 44.4% Clalit | <ROWSPAN=4> ND | 52% Clalit | \n | 43% Maccabi | 25% Maccabi | \n | 11% Meuhedet | 13.6% Meuhedet | \n | 2.4% Leumit | 9%" }, { "role": "assistant", "content": "Leumit | \n | <ROWSPAN=4> Place of employment | 80% community clinic | <ROWSPAN=4> 79% community clinics | 39% community clinics | \n | 14% rural community clinic | <ROWSPAN=3> 54% hospitals | \n | 3.2% IDF military clinics | \n | 2.4% mostly in hospitals | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5822792_002_01.png" ]
[ { "role": "user", "content": "<|image|>Parse the photo content behind with markdown code: <md> | <ROWSPAN=2> Strains | <ROWSPAN=2> REP-PCR group | <COLSPAN=4> Colistin + sulbactam | <COLSPAN=4> Colistin + fosfomycin | \n | FICI(Col) | FICI(Sul) | ΣFICI (Col + Sul) | Interpretation(Col + Sul) | FICI(Col) | FICI(Fos) | ΣFICI (Col + Fos) | Interpretation(Col + Fos) | \n | --- | --- | --- | --- | --- | --- | --- | --- | --- | --- | \n | AB 1 | A | 0.06 | 2 | 2.06 | Indifference | 0.5 | 0.5 | 1 | Additive | \n | AB 2 | A | 0.25 | 0.5 | 0.75 | Additive | 0.5 | 0.13 | 0.63 | Additive | \n | AB 4 | A | 0.13 | 0.25 | 0.38 | Synergism | 0.5 | 0.25 | 0.75 | Additive | \n | AB 6 | A | 0.5 | 0.06 | 0.56 | Additive | 0.5 | 0.25 | 0.75 | Additive | \n | AB 7 | A | 0.25 | 0.25 | 0.5 | Synergism | 0.25 | 0.13 | 0.38 | Synergism | \n | AB 13 | A | 0.13 | 0.5 | 0.63 | Additive | 0.13 | 1 | 1.13 | Indifference | \n | AB 14 | A | 0.5 | 0.5 | 1 | Additive | 0.5 | 0.5 | 1 | Additive | \n | AB 15 | A | 0.03 | 1 | 1.03 | Indifference | 0.13 | 0.25 | 0.38 | Synergism | \n | AB 3 | B | 0.5 | 0.5 | 1 | Additive | 1 | 0.25 | 1.25 | Indifference | \n | AB 5 | C | 0.13 | 1.0 | 1.13 | Indifference | 0.25 | 0.25 | 0.5 | Synergism | \n | AB 8 | D | 0.06 | 1 | 1.06 | Indifference | 0.25 | 0.5 | 0.75 | Additive | \n | AB 9 | E | 0.008 | 1 | 1.01 | Indifference | 0.03 | 0.25 | 0.28 | Synergism |" }, { "role": "assistant", "content": "\n | AB 10 | F | 0.004 | 2 | 2.00 | Indifference | 0.02 | 1 | 1.02 | Indifference | \n | AB 11 | G | 1 | 0.004 | 1.004 | Indifference | 0.01 | 1 | 1.01 | Indifference | \n | AB 12 | H | 0.06 | 0.5 | 0.56 | Additive | 0.25 | 0.5 | 0.75 | Additive | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3495841_005_00.png" ]
[ { "role": "user", "content": "<|image|>Convert the diagram into Markdown language." }, { "role": "assistant", "content": "<md> | Band position (cm-1) | Assignment | \n | --- | --- | \n | 1730 | C = O stretching vibration in acetyl groups of hemicelluloses | \n | 1600 | C = C stretching vibration in aromatic ring of lignin | \n | 1510 | C = C stretching vibration in aromatic ring of lignin | \n | 1421 | CH2 scissoring at C(6) in cellulose | \n | 1368 | Symmetric C–H bending in cellulose | \n | 1236 | C-O stretching vibration in lignin, xylan and ester groups | \n | 1100 | O-H association band in cellulose and hemicelluloses (associated with crystalline cellulose) | \n | 1030 | C-O stretching vibration in cellulose and hemicelluloses | \n | 974 | C-O stretching vibration in arabinosyl side chains in hemicellulose | \n | 895 | Glucose ring stretch, C1-H deformation | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5395886_003_00.png" ]
[ { "role": "user", "content": "<|image|>Render the picture in Markdown format." }, { "role": "assistant", "content": "<md> | <ROWSPAN=2> | <COLSPAN=4> PC health domain | \n | Urinary | Sexual | Bowel | Vitality, general health | \n | --- | --- | --- | --- | --- | \n | Symptom | Leaked urine, increased frequency, dysuria | Erectile dysfunction, compromised masculinity, poor libido, poor communication, unable to engage in sexual activity | Diarrhea, fecal incontinence, increased urgency to defecate, increased frequency, pain, hematochezia | Depression, fatigue, hot flashes, weight gain, metabolic syndrome | \n | Self-management strategy | Pelvic floor exercises (Kegels) [29–32]Bladder training (timed voiding) [33, 34]Fluid management (drinking) [35]Physical activity [36]Weight loss [37]Diet (avoid bladder irritants/caffeine) [38]Using a penile clamp [39]How to protect clothing and bedding [40] | Partner communicationMaking time for and enhancing intimacy [41]Creative intimacy (non-penile) [42–46]Having an orgasm without erection/avoiding climacturia [47–49]Reduce alcohol and tobacco [50, 51]Using a vacuum erection device [52–55] (NOTE: medical strategy following self-management approach) | Pelvic floor exercises (Kegels) [56, 57]Diet for softer stools (fiber) [58]Diet to avoid irritationProper fluid intakeReducing painful bowel mvtsUsing OTC medications [58]Managing stress [59] | Decrease fatigue [60, 61]ExerciseImprove mood/depressionDeal with weight changes [62]Deal with hot flashes [63]Evaluate breast or nipple tenderness | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4308883_002_00.png" ]
[ { "role": "user", "content": "<|image|>What are the following illustration content in markdown style: <md> | Parameter | Sex | Geographic origin | Mean age | Mean age, female subgroup | Mean age, male subgroup | Case/ratio fatality | \n | --- | --- | --- | --- |" }, { "role": "assistant", "content": "--- | --- | --- | \n | | 81 females (58%) | 76 from urban areas (54%) | <ROWSPAN=2> 35 years (min. 16 years; max. 71 years) | <ROWSPAN=2> 30 years (min. 16 years; max. 69 years) | <ROWSPAN=2> 39 years (min. 17 years; max. 71 years) | <ROWSPAN=2> 317/140 (44%) | \n | | 59 males (42%) | 64 from rural areas (46%) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5625749_003_00.png" ]
[ { "role": "user", "content": "<|image|>Parse the table content behind with markdown code: <md> | Event | Screening/baseline | D1 | D2 | D3 | M1 | M3 | M6 | M12 | \n | --- | --- | --- | --- | --- | --- | --- | --- | --- | \n | Informed consent | X | | | | | | | | \n | History/physical | X | X | | X | X | X | X | X | \n | NYHA | X | X | | | X | X | X | X | \n | CCS | X | X | | | X | X | X | X | \n | ECG | X | X | | X | X | X | X | X | \n | Biochemistry local laboratory | X | X | X" }, { "role": "assistant", "content": "| X | X | X | X | X | \n | Biomarkers | X | X | | | X | X | X | X | \n | HLA tissue typing | X | | | | | | | | \n | HLA tissue antibodies | X | | | | X | X | X | X | \n | 6-minute walking test | X | | | | | X | X | X | \n | Chest X-ray | X | | | | | | | | \n | CCT | X | | | | | | X | X | \n | KCCQ | X | | | | | X | X | X | \n | SAQ | X | | | | | X | X | X | \n | EQ5D3L | X | | | | | X | X | X | \n | NOGA mapping | | | X | | | | | | \n | IMP injection | | | X | | | | | | \n | Echocardiography | X | | X | | | | X | | \n | Holter monitoring | X | X | X | X | | | | | \n | AE evaluation | | | X | X | X | X | X | X | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3677606_002_00.png" ]
[ { "role": "user", "content": "<|image|>Render the table in Markdown format." }, { "role": "assistant", "content": "<md> | | Patients completing Part 1 of ARMS questionnaire (N = 103) | \n | --- | --- | \n | Age, years, mean (SD) | 42.5 (11.2) | \n | Sex, n (%) | | \n | Male | 14 (14) | \n | Female | 89 (86) | \n | Type of MS, n (%) | (n = 97*) | \n | RRMS | 95 (98) | \n | SPMS | 2 (2) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3180252_002_00.png" ]
[ { "role": "user", "content": "<|image|>Transform the photo into Markdown format." }, { "role": "assistant", "content": "<md> | SNP (dbSNP ID) | chr11 position | variant amino acid | minor allele frequency in chronic tinnitus | homozygous/heterozygous carriers of the minor allele (pHWE) | \n | --- | --- | --- | --- | --- | \n | g.15,002T>C | 74,168,599 | T4A | 0.000 | - | \n | g.15,041G>A | 74,168,560 | V17M | 0.000 | - | \n | g.15,108C>G (rs34604640) | 74,168,493 | P39R | 0.000 | - | \n | g.15,131C>G (rs17215444) | 74,168,470 | R47G | 0.000 | - | \n | g.15,150G>A | 74,168,451 | R53H | 0.000 | - | \n | g.15,190T>C (rs2270676) | 74,168,411 | F66F | 0.125 | 5/62 (0.788) | \n | g.15,220C>T (rs17221826) | 74,168,381 | I76I | 0.000 | - | \n | g.15,240G>A (rs17215437) | 74,168,361 | R83H | 0.005 | 0/3 (0.930) | \n | g.15,255G>A (rs17221833) | 74,168,346 | R88H | 0.000 | - | \n | g.15,288G>A | 74,168,313 | R99H | 0.000 | - | \n | g.15,321C>T (rs11822977) | 74,168,280 | - | 0.000 | - | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3270339_002_01.png" ]
[ { "role": "user", "content": "<|image|>Translate the image into Markdown format." }, { "role": "assistant", "content": "<md> | Antibody concentration | Number of subjects | Percent | \n | --- | --- | --- | \n | <10 IU/ml | 25 | 21.9 | \n | ≥10 IU/ml and ≤ 100IU/ml | 28 | 24.6 | \n | > 100IU/ml | 61 | 53.5 | \n | Total | 114 | 100 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3590492_007_00.png" ]
[ { "role": "user", "content": "<|image|>What are the following diagram content in markdown style: <md> | | <COLSPAN=2> US1 | <COLSPAN=2> US2 | \n | | Valence | Arousal | Valence | Arousal | \n | --- | --- | --- |" }, { "role": "assistant", "content": "--- | --- | \n | Exp I | 3.00 (±0.29) | 3.15 (±1.26) | 6.77 (±0.33) | 5.08 (±1.47) | \n | Exp II Group 1 | 4.44 (±0.43) | 2.38 (±0.85) | 6.50 (±0.74) | 4.56 (±1.63) | \n | Exp II Group 2 | 4.45 (±0.45) | 2.50 (±0.71) | 6.60 (±0.74) | 4.40 (±1.05) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC3850736_002_00.png" ]
[ { "role": "user", "content": "<|image|>Convert the figure into Markdown format." }, { "role": "assistant", "content": "<md> | Missing | n(%) | \n | --- | --- | \n | ER | 16,247 (9.0%) | \n | PR | 21,306 (11.8%) | \n | HER2* | 45,021 (24.9%) | \n | Tumor grade | 10,594 (5.9%) | \n | Unknown cause of death | 2,386 (1.5%) | \n | Total cases with one or more of the above variables missing† | 57,695 (31.9%) | \n | Total cases with complete data | 123,395 (68.1%) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC2686705_010_00.png" ]
[ { "role": "user", "content": "<|image|>Interpret the figure as Markdown format." }, { "role": "assistant", "content": "<md> | | Focus genes | Interacting genes | Score | Top functions | \n | --- | --- | --- | --- | --- | \n | 1 | ACTA1, ACTA2 (includes EG:59), ARL1, ATP2B4, CNN1, DCBLD2, FGF2, HOXA10, ITGA5, ITGB3, MAP2K1, SEC13, SHOC2, SRF, TNC | Actin, Akt, Alpha actin, ERK, ERK1/2, FSH, IKK, Integrin, Jnk, Mapk, Mek, Pdgf, PDGF BB, PI3K, Pkc(s), PLC gamma, Pld, Ras, Tgf beta, Vegf | 31 | cellular assembly and organization, cell-to-cell signaling and interaction, viral infection | \n | 2 | CDCP1, CROT, DYX1C1, ERLIN2, GCOM1, GLS, GPR137B, HIST2H2AA3, PPM1K, SLAIN2, SPOCD1, TTC39A, TUBB3, ZDHHC2 | beta-estradiol, F2, HSPA1A, HSPA1L, IFRD2, KYNU, MAPK11 PREDICTED, VCP, MFHAS1, MMD, NFRKB, NOS3, PGLYRP1, SAMD4A, SLC16A5, SPR, TNF, TXN2, YWHAZ, ZDHHC8, ZNF267 | 28 | cardiovascular system development and function, tissue morphology, organismal development | \n | 3 | ACADL, ACADSB, CPEB3, ENTPD7, EVI5, CFI, CPA4, TLR3 GATM, LIPH GBP3, RFK, PPP1R9A, OSTM1 | 9330129D05RIK, ACAD8, ACAD9, ACAD10, ACAD11, Acyl-CoA dehydrogenase, C3, CDKN2A, CFHR3, CFHR5, F Actin, Glycogen synthase, GTP, heparin, IL4, IWS1, NFkB, NFYB, Pka, PLK1, RAB1A | 28 | lipid metabolism, molecular transport, small molecule biochemistry | \n | 4 | DCP2, FABP5, GLT8D3, HIST1H1C, HIST1H2BK, NASP, NUPL1, PCDH7, PPP1R3B, SEPX1, TM9SF4, UBE2N | ANXA9, DHX8, ERLIN1, FASTKD2, HNF4A, IL1B, MGEA5, MRTO4, NAT13, NUDT11, NUP62, OTUD7B, PHPT1, PSMC3, REXO2, SEC11A, MEM176B, TMEM189-UBE2V1, TRAF6, TRAFD1, Ube2n-Ube2v1, UHRF1, WRNIP1 | 23 | cell signaling, cancer, cellular compromise | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC5037662_004_00.png" ]
[ { "role": "user", "content": "<|image|>Interpret the photo as Markdown format." }, { "role": "assistant", "content": "<md> | Independent Predictors for Higher rHU | OR (95% CI) | p | \n | --- | --- | --- | \n | Use of Antiplatelets | 4.24 (1.10–16.3) | 0.036 | \n | Erythrocyte Count | 0.18 (0.05–0.55) | 0.003 | \n | Thrombocyte Count | 0.99 (0.98–0.99) | 0.029 | \n | Vessel Affected (M1 vs. M2) | 9.03 (1.36–59.73) | 0.022 | \n | History of Atrial Fibrillation | 2.96 (1.07–8.20) | 0.036 | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4717338_004_00.png" ]
[ { "role": "user", "content": "<|image|>Parse the figure content behind with markdown code: <md> | Locus | N | Na | Ho | He | HWE | FIS | NE‐2P | Null alleles | Error rate | \n | --- | --- | --- | --- | --- | --- | --- | --- | --- | --- | \n | CC141 | 50 | 3 | 0.400 | 0.369 | Ns | −0.073 | 0.842 | −0.042 | 0.009 | \n | CM72 | 50 | 5 | 0.460 | 0.570 | Ns | 0.202 | 0.713 | 0.020 | 0.026 | \n | EIM12 | 50 | 10 | 0.800 | 0.845 | Ns | 0.064 | 0.307 | −0.012 | 0.049 | \n | HKB24 | 50 | 7 | 0.560 | 0.564 | Ns | 0.016 | 0.669 | −0.010 | 0.012 | \n | EIM11 | 50 | 10 | 0.780 | 0.825 | Ns | 0.065 | 0.341 | −0.020 | 0.012 | \n | EIM31 | 50 | 10 | 0.760 | 0.728 | Ns |" }, { "role": "assistant", "content": "−0.034 | 0.500 | 0.004 | 0.013 | \n | HKB25 | 50 | 3 | 0.080 | 0.078 | Ns | −0.021 | 0.961 | −0.025 | 0.009 | \n | CC117 | 50 | 9 | 0.720 | 0.743 | Ns | 0.041 | 0.473 | 0.007 | 0.047 | \n | EIM17 | 50 | 6 | 0.740 | 0.735 | Ns | 0.004 | 0.496 | −0.24 | 0.012 | \n | EIM6 | 50 | 13 | 0.898 | 0.788 | Ns | −0.129 | 0.392 | −0.068 | 0.082 | \n | EI8 | 50 | 8 | 0.686 | 0.720 | Ns | 0.052 | 0.519 | −0.031 | 0.026 | \n | HKB32 | 50 | 3 | 0.060 | 0.059 | Ns | −0.014 | 0.971 | −0.008 | 0.002 | \n | Across all loci | | 7.25 (±0.29) | 0.57 (±0.28) | 0.58 (±0.08) | Ns | 0.01 (±0.08) | 0.00093 | 0.004 (±0.04) | 0.025 (±0.02) | </md>" } ]
mp_sft
PubTabNet
null
[ "./val_imgs/PubTabNet/val/PMC4168158_003_00.png" ]
[ { "role": "user", "content": "<|image|>Transform the picture into Markdown format." }, { "role": "assistant", "content": "<md> | Variable | Mean ± SD | N (%) | \n | --- | --- | --- | \n | Cluster 1 (social-demographic) | | | \n | Age (years) | 31.4 ± 9.2 | | \n | 16-25 | | 125 (8.7) | \n | 26-35 | | 564 (39.2) | \n | 36-45 | | 398 (27.7) | \n | ≥46 | | 351 (24.4) | \n | Marital status, married (yes) | | 997 (69.3) | \n | Medical insurance (yes) | | 1211 (84.2) | \n | Education | | | \n | Primary school or lower | | 290 (20.2) | \n | Middle school | | 846 (58.8) | \n | High school or above | | 302 (21.0) | \n | Duration of employment (years) | 2.2 ± 3.0 | | \n | <5.0 | | 1273 (88.5) | \n | 5.0 ~ 9.9 | | 111 (7.7) | \n | ≥10.0 | | 54 (3.8) | \n | Cluster 2 (health-related) | | | \n | Recent-month self-reported morbidity | | 973 (67.7) | \n | Body mass index (BMI) | 22.4 ± 3.4 | | \n | <18.5 (Underweight) | | 139 (9.7) | \n | 18.5-23.9 (Normal weight) | | 932 (64.8) | \n | 24.0-27.9 (Overweight) | | 262 (18.2) | \n | ≥28.0 (Obese) | | 105 (7.3) | \n | Chronic diseases | | | \n | 0 | | 1318 (91.7) | \n | 1 or more | | 120 (8.3) | \n | Cluster 3 (HRQOL domain scores) | | | \n | Physical functioning (PF) | 93.8 ± 10.9 | | \n | Role physical (RP) | 85.9 ± 25.6 | | \n | Bodily pain (BP) | 85.1 ± 16.6 | | \n | General health (GH) | 70.6 ± 18.5 | | \n | Vitality (VT) | 71.4 ± 18.0 | | \n | Social functioning (SF) | 89.9 ± 14.2 | | \n | Role-emotional (RE) | 82.0 ± 28.1 | | \n | Mental health (MH) | 78.4 ± 15.2 | | \n | Outcomes | | | \n | Recent 2-week physician visit | | | \n | 0 | | 1319 (91.7) | \n | 1 or more | | 119 (8.3) | \n | Hospitalization in the last year | | 88 (6.1) | \n | 0 | | 1350 (93.9) | \n | 1 or more | | 88 (6.1) | </md>" } ]
mp_sft
PubTabNet
null